5B0AA

Polyketide cyclase oac from cannabis sativa, h5q mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
100
structure length
95
Chain Sequence
b'AVKQLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNGYTHIVEVTFVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 22
structure length 95
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0aA00
3HHLD 5B08A 2RSQA 3CJKB 5A6WA 3UDCA 3QGPA 1FD8A 3HDSA 2OD6A 1Q8BA 1FESA 3HFKA 3FGVA 3MZIA 3TNVA 4OIXA 1AW0A 1OPZA 3BN7A 1P8GA 1TR0A 2PGCA 3LGNA 2GGPB 1CC7A 1YG0A 4A4JA 1RJJA 5IXUA 2GV1A 2K2PA 2G9OA 2ROPA 2CRLA 3TOQA 3IWXA 2KYZA 2XMKA 1V3ZA 2VH7A 3K7RA 5T7LB 3TRGA 2OD4A 1JWWA 2KT2A 2BJEA 2ZDOA 2XMMA 4A48A 1FVQA 3LO3A 2XMJA 1OQ6A 2KT3A 4A47A 4OJ3A 2GGPA 4Q2LA 2GCFA 3MCSA 3LGMA 1TL4A 2L3MA 2RILA 2BYCA 2W4DA 1YJTA 5F0WA 1K0VA 1OQ3A 2HLTA 3I9ZA 4QOTA 5B0FA 5T7LA 1XBWA 2BJDA 2HLUA 4Y2KA 4HL9A 5B0GA 4EFAC 1GXUA 1VQYA 2XMWA 3HF5A 5K9FA 4DN9A 3BR8A 2IYGA 3BGUA 1R6YA 1Q4RA 2HQIA 2Q3PA 2ZDPA 3KKFA 1GXTA 2LQ9A 1SB6A 1YRXA 2OMOA 2AJ1A 1YJRA 3FRYA 3BM7A 1QUPA 5A6PA 3CJKA 2K7JA 1KVJA 2XMTA 2ACYA 4U9RA 2N4CA 1URRA 4FNIA 1Q53A 1X0PA 1W2IA 4HH0A 1FE0A 2KKHA 1TZ0A 1S6UA 2N7YA 3BB5A 5B0EA 2LDIA 1LQ9A 3T9NA 5B09A 1IUJA 3E8OA 3IWLA 1N5VA 2IYIA 2N4DA 1X7VA 5F0UA 2XMVA 2FHMA 2K1RB 3HHLC 3KNGA 3GZ7A 2IFXA 1S6OA 1AFJA 1MWYA 3FMBA 2ASYA 1FE4A 3KG1A 5B0CA 2QLWA 4F67A 4YEAA 1U7LA 2QYCA 4ZA1A 3F44A 2QIFA 2W4CA 5KAKA 2RU9A 1SI9A 2HFOA 2K1RA 3BDEA 2BUNA 4FNHA 4HI1A 4OJHA 4DL0C 2EW9A 2GA7A 2AJ0A 4NPOA 2ROEA 1VQSA 2HIQA 1JK9B 2HFNA 1X8DA 3WDOA 2PD1A 4NL5A 1P6TA 2LXFA 1SQEA 1Y0HA 2K7KA 2FTRA 1Y3KA 2AP6A 2FIUA 1CC8A 2BBEA 1N5TA 2OKQA 2RMLA 3KG0A 1YJUA 2OP5A 4A46A 5B0BA 3HX9A 1KVIA 2JDJA 2LQBA 2XMUA 3DCAA 1APSA 1N5SA 1KQKA 3BF4A 4Y2MA 3HHLB 2GO8A 2OFGX 2GFFA 2W4PA 4ZOSA 1OSDA 1FEEA 1YJVA 1N5QA 4Q2MA 1TL5A 4Y2IA 2QLXA 4YDXA 4HH1A 1Y3JA 3DXSX 1TUVA 1ULRA 2VV5A 4OJ1A 4OJGA 1MWZA 2ROGA 5B0AA 1Y9OA 3HHLA 1WD6A 2OFHX 1Q8LA 3VTIA 2FB0A 4DPOA 4HI2A 5B0DA 1AFIA 2AW0A 1FVSA 1CPZA 3QMQA 2OAUA
chains in the Genus database with same CATH superfamily
2B6AA 2QN6B 1AUSL 3L95X 1HR0F 3ET6A 3D68A 1Q8IA 3MM6A 2CRLA 2HZVA 1OS5A 1N52B 1P9YA 3CE8A 2ADCA 3IR5B 4I2QA 2XNRA 1R8PA 4NLOA 3SDEA 5DGAA 4X4NA 5I4MA 1S6PA 3EE3A 3L7UA 2MKJA 2CQ0A 3N4WA 4URQU 1MSWD 2XNQA 1RT7B 1X7VA 1REVB 3DM2B 4HR2A 3PIOQ 4ED5A 5DRKA 1HW8A 5DO2A 1C4CA 1CS4B 3M7VA 4USKA 3AJ2A 3PX0A 2CFXA 5MLCV 2SXLA 5KT2A 2GJ2A 3ZNJ1 2HWIA 3J80Y 2IBKA 2K7KA 2H5JB 4X66F 1ZZFA 4ANEA 1RBOB 3I5CA 2OTJS 4ETXA 5D3GA 3G9CA 1HQEA 3BO3A 3R7BB 1S9GA 1HBUA 3ISZA 1WEXA 2OO4A 3D67A 1FESA 4RBTA 4PPZA 3T6JA 4JI6J 4NLUA 3VAKA 3L9ZA 4FYVB 1TK5A 2LCWA 5K14B 1SKWA 3KHGA 3LA0A 4OMFG 1OQ3A 2XMAA 3ILOA 5EWEA 1WC4A 1LWFA 1QSYA 3B78A 4QPXA 1PIEA 1WOSA 2RS8A 2CQHA 4J90A 2CPDA 2BX6A 3TAPA 2KJWA 2QLWA 2O3DA 2QIFA 2AEFA 2N3OA 4DQQA 4PWDB 2DGWA 3I56S 5D15A 5ITHA 2HNZB 2VICA 2V2KA 3L09A 5T14A 2YWKA 1DFDA 3VF0B 2AIRB 2EK6A 3ENVA 2AZ1A 2HIYA 2JJ4D 2KL8A 4MYUA 3MEDB 3M2UB 2XY5A 1S7HA 1VQNS 1FXRA 3HD1A 4NOHA 2IVFB 4IR9A 2DO0A 2YPZA 3A8JA 2DXFA 3GIKA 4LFBF 3KHHA 3CVKA 3R3TA 3FQLA 4LSNB 4MIWA 1B4SA 1AFIA 1ZA1B 2C2MB 2FYXA 1C0UB 1RAEB 4PG8A 4OIXA 1FTCA 3LWMA 3IG1B 1RWXB 2I6WA 2H5IB 2ZJRQ 3NMRA 1NZ8A 2DTJA 1KBRA 4R5PA 2HNDA 2HKEA 2GIFA 1TAQA 2VQFJ 1HHSA 3LF0A 5HSPA 4Y0FA 4KBIA 4NWBA 1JLCB 1FFSB 2RU3A 1CJUA 3OL8A 4ED4A 1OWXA 1NU4A 5HMYA 2MQPA 1AFJA 4M5MA 4C9DA 3NGKA 1U09A 2HFOA 2UU9J 2HQDA 1ZA2B 1YLXA 3R9LA 4RLEA 1IJEB 2HMIA 1FTRA 1S1XA 5F8JA 2HURA 4HACA 3TZXA 3NKYA 1S0MA 1IBLF 3ILIA 1TL5A 2F4VF 3ENAA 4R25A 4J9NA 3RB4A 3MTJA 2CJKA 3VTIA 4RW4A 2XS5A 2FLOA 3CJTA 2JOQA 3BBCA 2JC1A 4TY9A 3TR5A 3G86A 5C7PA 2CWKA 2CWXA 2EKNA 3OTCA 3IGVA 3R5GA 3MGJA 2FPHX 4P52A 5KG7A 2E1MC 4IOAQ 2PI4A 2W4DA 1B0VA 2HBRB 4BWJA 2V2ZA 3QWUA 5HN0A 1D1UA 1LW0A 2Q3PA 4B3TF 2AJ1A 4IKAA 4IQXA 4A8XA 1U0SA 2OMLA 1RDRA 2CJYB 3MM8A 5CZVA 2KRBA 4RU2A 4ANCA 1L3UA 3BDEA 3M9OB 4ZP8A 3J7A1 2LA4A 3O44A 4C0BA 2RQCA 3JAMY 3KLIA 3KLHA 1HD0A 2CJXB 3GCWP 3GFXA 2A6OA 1N36J 3DRRB 4FP9A 3KDOA 4KHPF 3OL7A 3EGNA 1B99A 4IH5A 1SL2A 3IS9B 3OPKA 1FVSA 5J2QB 2RUSA 1SIWB 3SEOA 4P2MA 3MTKA 3MXHP 2YPYA 2YKNB 3C66A 4RZRA 3V6DB 4G1IA 3UCGA 1ACMB 3EUNA 2RNEA 5KFCA 3GILA 2NUHA 3Q2SC 3BPDA 2VG5B 2BE2B 1TL3A 4GVLA 4CLSA 3NGTA 3E2EA 4DBQA 2B0GA 2KM8C 1EKSA 2AEJA 4LF2A 3NP5A 2CQ3A 2XI2A 2MSTA 4LVOP 4YQWA 3PG9A 2KXHA 2FJVA 3FJ2A 1S10A 4CLZA 1S1TA 1QSSA 4F67A 4WFYA 1FJGF 1VLOA 2BJ7A 4JI2F 1DLOB 1ZZNA 4F4XA 4M5IA 2IJRA 2LLZA 2C3MA 2AX0A 4OI0A 3THPA 1UW9A 4XPEA 2OSQA 2KFNA 1YI2S 4F25A 1AZSB 2D9PA 1C4AA 2HFVA 3MPUB 1LXNA 1MNEA 2MEWA 4M5DA 4E0DA 3ISNC 4DOZA 4R0JA 2B7BB 5GVQA 3P6YC 1H2UX 2HZAA 2R7SA 3CCUS 2ZNYA 3I0RA 3CJQA 3NY0A 4FF4A 2QJ3A 2UVUA 2P2CB 3MMCB 4NCBA 1EKRA 3EZUA 2PT0A 4XAKA 1SB6A 2AQ4A 4IFVB 2C2EA 2FZCB 4Y34A 1RTDA 1NDLA 2CPFA 2RS2A 3N9UC 2M4MA 3OR1B 1PAUB 3MWBA 2IIHA 1S7IA 3TUIC 4ELUA 2IYIA 4DS4A 3HMJG 3OT9A 1RISA 3R5AA 4CLLA 4WK1A 3NGSA 1KWMA 2LQJA 4EMDA 4CZCA 1HLWA 3RR8A 2BZ2A 4DCPB 4UQTA 1YX2A 5CYJA 2QA4G 5IT4A 1Y5IB 1L3TA 2V4JB 4I68A 1WI6A 1N5TA 2YNGA 2E1CA 4XTTA 3LP0A 3SV4A 3CULA 2HVZA 4KH0B 2YNFA 4P74A 3PKMA 2APOA 1N0UA 1EQMA 1TKTB 1VBZA 1RACB 3AJDA 1D9FA 3MMBB 2QE5A 2GZOA 5A6WA 4MFBB 3RAQA 2VONA 1ZOTA 2J0WA 3BN7A 1NH7A 4B9UA 3RU0A 1VQPS 1YG0A 1U6BA 3O6QA 2GHPA 3FBEA 3D28A 3BO4A 2LECA 4LREA 2WSCC 3KHRA 2MHNA 1WTBA 2M8HA 4DR6F 1OYEA 1N5YA 3D6FB 4DV5F 1NJYA 2D3UA 4M95A 1D0EA 3J7Z5 2RDDA 4EEYA 5CHCB 2CNNB 5HVGA 2P6TA 2QTWA 2MY7A 2Z2LA 4DR3F 3CB4A 1XC9A 3MUTP 1NNDA 1BQNB 2DNYA 5KFEA 4KGKA 1RT1A 3VAMA 1SJQA 4DN0A 1KHWA 4UT4A 2BANB 4W98A 3HVRA 3WZ0A 1T03B 1U47A 1ZAXA 2DO4A 3DRSA 2YNHA 1SJ4P 4FZVA 1T05B 3FGVA 1X9MA 2J76E 1GMUA 5DZ7A 4C8MA 3CO0P 4CIOA 3T1YJ 2LU2A 5L46A 4W92B 2LU1A 4B17A 3FUYA 2CQDA 4JI7F 4ZCMA 1LNQA 1CG2A 3KG4A 3CDUA 5KFIA 4WBFA 2PN6A 1OY8A 3SCLE 1FRIA 4DSFA 2N4CA 2JH3A 3KNGA 4HKQA 1J5OB 1ZPWX 3KG1A 2CPXA 2W2OP 4W4MA 3K8WA 3OFGA 1FRXA 4DI6A 1Z2LA 4I67A 2PD1A 4JV1A 1RT2B 3CUNA 3F73A 2HGMA 5HQ8A 2OI2A 2BJ1A 1WC5A 4QBUA 4MJKA 2B51A 1FKPB 1PILA 2DGTA 3E01B 3N0VA 4F3OA 5B0DA 4NXNJ 1UAWA 4H4OB 1WI8A 2BE9B 3UFCX 1VC5A 3TEHB 5F8IA 4WKYA 3MD3A 1NHKL 4LRAA 3J81Y 4YHHJ 3KK2B 2C3UA 1SH3A 3RW6A 2EC0A 3AD7C 2ERRA 2ZZMA 1N88A 2YXLA 1J5EF 4RW8A 3RB6A 3T1HJ 3DI6B 4LR7A 3C6UA 3OXGA 3B8HA 1VRTA 4TKTA 1RHJB 4LF6J 2VKRA 4FKYA 4CT9A 1HNWF 4RWWA 3UVJB 2V8HA 2QX0A 3J81j 2DNZA 4CO4A 4ID8A 2ZD1A 4ERDA 3CJ0A 2HFUA 3M30B 2HS0A 5D6GA 2YX1A 1Q8LA 2IC3A 1H73A 4HI2A 4X66J 4ZPTR 3VAJA 1DRZA 2VF3A 1GEHA 1DTTB 1EX8A 1HBMA 2UXBJ 2O1PA 1CEZA 1RWMB 2KT5A 1CC7A 5IFMA 1F60B 3E51A 3KJVA 4I4BA 1SJRA 2CQ2A 1T9XA 3KMQA 4N8NA 4CNYA 2K3KA 4CH1A 2ZEJA 3PW2A 3H8YA 2H48B 4F8RA 5E0OA 3NWRA 7FDRA 4Q43A 1TV6A 2OTLS 2B8PA 4AL5A 1CJKA 1VIXA 3LAKA 3IXQA 2L9DA 2YWHA 4TXSA 1K8AT 4ZMMA 2MKYA 3F0NA 3Q8QB 4DR4J 2WVFA 4PG6A 2GA7A 1QAJA 1RTHB 2ZJPQ 4CP5A 1AYEA 2I2YA 1XEZA 3DDNA 4USWA 1PC4A 1HKAA 2F63A 2Z57B 1AA1B 2OPPB 2DNLA 3ADAC 4QR2A 2BJ8A 3DM2A 4OZ3A 2GQCA 1RUSA 1NJIT 4OYOA 4CYUB 1JLQA 3BKTA 4I2PB 2VC0A 5CH7B 1W25A 3W63A 3CJKB 3V6JA 2YKPA 3MEEB 2YTCA 4KFBB 4B3OB 4TLQA 4NE9C 2K2PA 3QATA 4LFBJ 3LQVA 4ATNA 3PJXA 3SQGB 1RWUA 2X1AA 2BABA 3VZIA 1TAUA 2CG4A 2RIJA 1KHVA 2HAFA 4OX7A 1UZHA 1VGYA 2PDAA 3CWJA 4IRKA 2V68A 1UVMA 4CLTA 2D3O1 4JV5F 3OFEA 4KV8B 1NO8A 2HG4A 1QAIA 4DEZA 5K14A 2RQMA 1BQMB 1U49A 2OHDA 4NPOA 5G0RA 3ZC4A 2LXFA 2ZNZA 3MR2A 3DLLQ 2E9ZA 4BBYA 4CO5A 4YR2A 1R8AA 3NGDA 4EK2A 4MAKA 1U1RA 3BBFA 4F0HA 1WWHA 3KUGA 4ZVSB 1T8EA 3I5BA 3PEHA 3DRXA 3QO9B 3W9HA 4QYRA 3BSCA 3MR7A 1HMVA 3QFWA 3DLGB 5K20B 2E5HA 4Q8FA 2LXIA 3R2DJ 1KVKA 3QBCA 2G4BA 4B3MF 1RA7A 5HVFA 5BYSA 1UCNA 4FKXA 4JV0A 4HTJA 3MCMA 5IT9U 1H2VZ 1B0TA 1NDKA 3LP2A 2KYXA 2OUGA 1N5VA 3ETOA 4K50A 1JLAB 1S1VA 2J6UA 5ETQA 4NLVA 1U7LA 3RZAA 2W4CA 1NSPA 2KJVA 3KHLA 3DLEB 1EP4B 2BACA 3GP9A 4ZVHA 3U02A 5HI7A 3BQ2A 1KQKA 1NSAA 1XR5A 2M7SA 2O5DA 1Q78A 1HQUB 1VYAA 3D1OA 4DPXA 5IQQA 4FF3A 4DX8H 1H72C 4DPOA 3US5A 3KUEA 1RTIB 4QWDA 4BCAA 2ROPA 2R4FA 3BH7B 1KQGB 2HWTA 5JMNA 5F9LA 4J9RA 4O3NA 2FLLA 5C24B 4MIBA 3JTPA 3N5BA 4ZPBA 4S0MA 1XMOF 1JIHA 4KKOB 4MYTA 2CVEA 2ASLA 4IG3B 4ZPWR 2YX7A 2EWHA 4ZDNA 1NJZA 1GK8A 4O0IA 1TL1B 1UVKA 4YEAA 2DNNA 5GMEA 2MQMA 1S9EB 2HQ3A 5L9XA 2Z58B 4P2SA 3RTVA 3KDNA 5FDLB 2GIRA 1M1KT 1FJGJ 3M1VA 5J2MA 4LF7J 4JV2A 4JI2J 2GJFA 2W01A 1IBCB 1F9FA 4A8KA 3QNWB 4DSIA 2VG6A 3C14A 2ZBRA 4KC5A 1NKBA 1U8WA 2A2DA 4J9PA 2B5JB 4J9SA 1V3ZA 5T7LB 1YVFA 2JRSA 2RRBA 1WHVA 5E3PA 1VHIA 3KUHA 1F0XA 1NDCA 1MMLA 4RPFA 4WP9A 2HW3A 5CYQB 3CJ3A 4TQRA 3RRHA 1Y7PA 5DM7Q 1YTYA 4DV7J 2F8EX 5KT4A 2YKNA 3JTNA 2MQNA 3V81A 4OZLA 1VRQC 2F65A 2GX8A 3DN9A 3A8IA 3ZZYA 3TJAA 4ZVRB 4DMZA 2MZTA 1HI0P 2VUGA 4GKKF 2EFOA 2MHEA 3LGHA 2V5HG 2CDQA 4MIAA 1U1QA 3G82B 3H25A 2E5GA 4ILLA 3Q23A 3GJRB 1FFWB 3M32B 4N8OA 3HCXA 4LQ9A 2ROGA 5DQHA 2ZOMA 2BXJA 4HHHA 3KLGB 2V8PA 3NEKA 3UDCA 4OI2A 3DC2A 3ZTSA 2GVZB 3BEGB 3QFHA 4KRWA 2CAJA 4RUHA 2MKKA 2ZE2B 2A18A 1OJ4A 3HVAA 2OPSB 3HZGA 2WBMA 1QAXA 5LXRA 2EPIA 4Q8EA 3M8PA 3QAUA 3JYTA 2CQ1A 2ZOFA 2RF2A 2XMWA 4DN9A 5ETLA 5KT5A 2FJAB 3BM7A 2VA3A 3CDBA 3PACA 4B3SF 1LQ9A 3CMQA 2EEYA 5KFJA 3DYAB 5KTQA 1B64A 1T7PA 3AB4B 3HSJA 3CMAS 5KAKA 4Z37A 4V1Ak 2NXUA 1SH0A 4DV5J 2R8KA 1CJVA 4EGLA 4BC7A 1YK9A 4IFVA 4HVZA 1E6YB 4IG0A 3QT8A 5HLFB 3HHLB 3LTOA 5FD1A 1N34F 4B3RF 3MR5A 3WBZA 2AW0A 4KYZA 3DMJB 1FNMA 1ELOA 1KKHA 5BXIA 2DGOA 3I6PA 2RKIB 2C3YA 5KFPA 5HROB 1VS3A 2X3GA 1MMDA 1JWWA 2GGPA 1M0SA 5HATA 2B9WA 2P5VA 4CH0S 1TKTA 4I69A 3MMBA 2E7WA 5EHHA 3QGGA 4DG1B 5KG6A 2DR9A 4OZNA 2F4FA 5ETSA 1RGVA 4F0KA 1VQ8S 3LH2S 3FMBA 5AXNA 4CT8A 3SFGA 1Y5LB 1RWKB 1WKKA 3MPDA 2AHOB 2J0QD 2UUCF 1JLEA 5E3AA 4XIUA 2FTRA 3TX0A 1N33F 4PR6A 4F26A 4WFAQ 4JI3F 1XIQA 2B4UA 4NLDA 1N32F 1LV5A 3MUVP 4OZ2A 1JLGA 2V8GA 3MHYA 4J9OA 2MGZA 3QLHB 3AOBA 1RYRA 4YB6A 3POTB 5D4OA 3MPWA 4ICLA 3MD1A 1BQNA 2NZ4A 3DGPA 1XNQF 1SH2A 1Q8KA 2DEJA 2F1FA 1CJTB 4AYBD 3R2CJ 4X64F 3EJMA 2BANA 1FJ7A 4HL9A 3TYTA 3IRXB 3HI9A 1R6YA 1X31C 1M1GA 2AGQA 2K7JA 1R7IA 5K8PA 4JI0J 3D9BA 2CZVC 2R7VA 4MMOA 3QWPA 1FX4A 1R43A 3R5DA 4JI1J 1KQFB 3G8QA 3D66A 1RHRB 4ZVOB 2DVIA 4HT7A 3IM8A 1UWBB 2VFVA 1UMJA 2BV3A 4F36A 2VU5A 4WFNQ 1YWXA 4V19X 1J5EJ 5IC4B 2Z56B 3AB2B 1OPIA 3JSRA 5HBMA 4ECRA 3R97A 3MAAB 4WU2A 2UUWA 4QR1A 2MPUA 2DHHA 1HNWJ 4AT1B 3G6XA 2RJZA 2ZBPA 4C8YA 2MQ8A 5LOQA 1MN9A 2BW2A 2L9WA 3C8YA 3EXCX 3HLUA 2CPIA 5KFSA 3GV8B 1UVJA 3AQPA 3CCMS 4N76A 1T9TA 3TAMB 3QGIA 1S1WA 4PXDA 3OSPA 4OLPA 2VHGA 3HJVA 1GMWA 4ALZA 3DXBA 3JQKA 1RADB 2U1AA 2ACYA 1SIZA 3OXFA 4O4GB 4YN3B 4ED2A 3GMGA 4K5SA 3PNIA 3IGNA 2BKPA 1ITPA 3E3XA 2W9BB 2IHR1 1BXNA 1H6KX 3PM9A 2OPQB 3K58A 4B9MA 2RVJA 2FGCA 2PMWA 4L74A 1NRKA 2P6SA 5F8LA 3KJNB 1JX4A 3NWGA 1KC8T 4I1TA 4F2SA 2UUAF 3BGLA 2XTJP 5LMUF 3BGFA 4USHA 3EXYA 3GYXB 1FEEA 3OR2B 4N41A 1KLMA 3DXSX 4ZHRA 3M8RA 1CPZA 5D4NA 3DLBA 2RDIA 3F41A 1UZDA 1KDNA 4N5SA 3DOLA 2HHXA 3A8EA 3UVJA 3HSZA 1T3OA 1RSCA 5EN1A 1MG7A 3U7JA 3Q22A 1FVQA 5DM6Q 2M5YA 2HK2A 3MFIA 4AFFA 1LWEB 2XLJA 2JEIA 1IQZA 1UW4A 1GX6A 1Q4RA 2YVSA 3BQ1A 1YZ7A 3FRYA 4QWCA 3D1HA 2EFNA 3Q8UA 1DTTA 1RWPB 4RW7A 2PC6A 5C2GA 4YY3J 4OL8A 2GQ2A 2COLA 2BOAA 4C4WA 1DBDA 2JVRA 4JV5J 1PO6A 2MKSA 2CPZA 2CQPA 4C6AA 1CLFA 1YJUA 5K8OA 5D0HA 1D9AA 3G2XA 1AROP 2IRYA 4NLRA 3CJ2A 3JAMU 3QIPA 3HHEA 1N5QA 4K4XA 3I4HX 4DJBA 5DDRC 1Z2ZA 4IQMA 5E41A 5KFBA 3H5YA 2WVDA 4FYWB 3KJQB 2KG1A 3HD2A 2VPYB 5GAEI 1H2TZ 3M2RB 2R7QA 4FF2A 3QYYA 1EHWA 4M5NA 2Q6CA 3DFEA 1B0PA 3FSYA 4C8OA 2XULA 2IVYA 2FLPA 3NL0A 3V5RA 3KLFB 4LF9F 2Y3YA 4DX6A 1FXLA 4DX7A 1S1UA 2ZUAA 1WDTA 3W2VB 3WC0A 4DSLA 1IN0A 3EDRB 1VQMS 3PXGa 3EZOA 4IYQA 6FD1A 4P9SA 2IY5B 4DPUA 1PSDA 3CJKA 1XN9A 3NGUA 4RU9A 2PI5A 4C48A 1Q53A 1M5SA 1YGYA 1QSLA 1UVIA 4U7UD 3OXLA 3FCHA 3GQCA 2XZWA 2CKWA 3QT5A 5H9FJ 2XZTB 4B9LA 5B0CA 2HQCA 2LEAA 5I3QA 1NLKL 2IRUA 2ZH7A 4LMZA 2KXNB 4DUTA 1LWCB 1X0FA 4DX5A 2B56A 1UP1A 4EBDA 2B4VA 5IM0A 3PZPA 3QT7A 1IKWB 4HYKA 1U2FA 4ECXA 5KFVA 1Q86T 4LF4J 1WACA 2AMCB 1JJ4A 2R8GA 2R8HA 1VJQA 1GQEA 2QL9B 3HHLD 4OYAA 4RW9B 1T9UA 2WTFA 3K17A 1D8YA 4NLYA 2B4PA 3FKBA 2MZSA 1D9DA 2YKMB 1XMBA 1IKYA 4KGXB 3ETMA 3NRBA 4JBCA 3CXCR 1K1QA 3EICA 3ZFVA 1TUGB 2DNKA 4MK7A 3GJSB 2IMWP 3Q89A 4Q45A 2A0FB 5SUHA 1F9HA 1G4CA 4Y3CA 4AE5A 2OMOA 1QAYA 4F7VA 4IR1A 3R5BA 4U67Q 4J9LA 4FS1A 1URRA 1L5UA 1T94A 4K2JA 2MXYA 2GQQA 4LT6A 2R7UA 4ELTA 4DV6F 1SI9A 2D7SA 1S76D 4QYZK 4NI2A 2HVEA 5KFXA 3SI8A 4NRTA 1FF2A 2XBPA 3UQSA 1ZM9A 2FVCA 4CLWA 1Q1KA 3NCQA 4TY8A 2WHOA 2HZCA 3B6BA 2DNOA 2BKNA 4P71A 2K8GA 2FJDB 3SYZA 2EI5A 4J9MA 5BJRA 3M2VA 4FBUA 3BPSP 5HQMA 1G6BA 4DU7A 1P8GA 2DGSA 1TFYA 4EUVA 4UOGA 2OEJA 5EX3A 3MPVA 4ZVGA 3PDNA 1BC6A 1RT4A 5JJBA 5I42B 1K47A 1D8ZA 4DUYF 4A8WA 3OW2R 4B9NA 3MOJB 4UQGA 3C15B 4P2XA 1FA0A 3BKUA 4XDCA 2ASJA 4QU7A 4UY85 4FNIA 3UI3A 3HULA 2QA1A 3RR7A 4RO0A 1NPKA 5LXYA 2KRRA 1RTIA 3NNAA 4KO0A 1C1CB 1V3SA 1TVRA 1VLYA 2F5GA 3W66A 1SVDA 4C3MA 2A6MA 5GAEU 1H7XA 1QJHA 3SSRA 1VC0A 2VJVA 1Y0HA 1YSJA 1FWKA 5D4PA 4DZDA 3NLCA 5CD4A 4M5GA 3ZZZA 3DRPA 1URNA 3P4UB 1GAOA 4DPWA 4IG3A 3C6TA 4USJC 5F3ZA 4F4AA 2CQCA 3QGHA 5E5NA 1TL1A 4CI0B 4GKKJ 2ILYA 5KFGA 4IFYB 4O3QA 1IKVB 3GV7B 3NGRA 4EO8A 1OMSA 1X5PA 4F04B 3IBWA 1FRKA 5A8RB 1FRMA 3FBFA 2B4OA 2E7VA 4LJMA 4EBCA 5DG8A 2FZGB 3KXDA 4NLTA 3IBFB 1YJRA 3LP1B 3TQEA 5KG2A 1N48A 1IBMF 1BWEA 1HNXF 4URGA 3TW0A 3MI7X 1ZH5A 2DH7A 5ETTA 4ZVFA 3A1YG 2MDAA 3PX6A 4DXLA 2K1RA 2NLWA 3THVA 4MK8A 1AXQA 1HWLA 1REGX 4B3SJ 5J1EB 2N7CA 1I5OB 2R2UA 1IR1A 3EGZA 2RQ4A 1NHUA 4KR0B 4F4KA 3N6LA 3ENWA 1I3OB 4RW6B 1JQGA 1XTZA 3JSYA 1TUVA 2B9XA 1EETA 5EX0A 1Y9OA 2MTLA 3PVXA 4QIWD 4RKUC 2BR0A 5IT9Y 3M8WA 3Q8YA 1FD8A 4YB7A 2JFDA 2IDEA 3UO0A 2DITA 3H5XA 4H4KC 3OVAA 3K7RA 4B3RJ 4NXMF 5CYMA 4RNHA 3O5TB 3MR3A 3WC2A 3G82A 1T11A 1M1HA 4PYDA 2PFDA 3PO4A 1K0VA 1S9FA 2DY1A 5ETOA 4R8UA 1GXTA 1RYSA 2W7AA 7AT1B 1IR0A 3KLGA 3T6BA 3FDSA 2W8KA 5BR8J 2Y1RI 4KH1B 5KFUA 1NCLA 1U24A 1JB0C 2YY3A 3ENQA 4G6VB 5FLXU 2CXEA 5A8KA 4HHUA 1TKDA 2OPSA 4I56A 2VD3A 4ECSA 1YQHA 3DHWC 5KFKA 4OI1A 2ZBQA 4DQIA 1WJ9A 2HIQA 3GCXP 4TLRA 2JLGA 4CLFA 2R7XA 5D78A 1KVIA 4O3OA 1DURA 3BSOA 2NSCA 3AA8A 2UUCJ 1NZAA 3PYGA 3RG6A 4K4WA 4L3KA 1OSCA 4Q2MA 2H4YB 1VI7A 2XLIA 2R9LA 1SQGA 2XI3A 2AGOA 4CDIA 1N33J 1MU2A 2CNKB 4PXCA 4JI3J 2MLYA 1IM6A 1N32J 3GYGA 4DR1J 3ITHB 1KEKA 5IV3A 3D6HB 1CVJA 4I64A 1JLFB 4EYHB 4P2FA 4QCLA 4WF9Q 2F7VA 1PC5A 2DD8S 3QJPA 4K7QA 4ER8A 1DY3A 2QC3A 1WNEA 3CCWA 4LSLB 5F8NA 3W8PA 2LYVA 5IOLA 3DMJA 4CTAA 1XNQJ 5KOWA 3I87A 4GVBB 3TP2A 1G2EA 4DV4J 1RT6B 5B09A 4X64J 2Z2MA 1H74A 5HROA 2JNJA 3OUYA 1KRPA 2ZM6F 3QZ7A 1SC4B 2VPWB 2KVQE 2YWEA 2XGPA 1HWJA 4ZP6A 4U95A 2DIUA 2FJXA 3FSXA 2DBBA 1LK7A 4N56A 3AH6A 1NJWA 2D41A 3TARA 2HHSA 1SXLA 2UZAA 1C0TB 3EPIA 1GMVA 3OL9A 2K06A 2WONB 2R2SA 1NK8A 5LMNF 4NCGB 1YBUA 2OEKA 3AA9A 2B8QA 3W2WA 3BDPA 2O67A 4KQZA 2HNYB 4BC9A 1TL4A 3FFIB 1YJ9S 3OL6A 2EBEA 3GIIA 2ZZTA 5K5MA 2EKYA 2ACMA 3QLHA 3VQTA 3CD6S 4K4ZA 3V2UC 4U8YA 1TUWA 4RUBA 3EWGA 2HWHA 2IBOA 1W2IA 2IAJA 5E3RA 3CDEA 5L1LA 3GZ7A 3TI0A 4PKDB 2I8EA 1BMQB 1CJTA 1RWOB 2RE1A 4K2XA 4OQJA 2E1RA 2EK1A 4C97A 3IRXA 2DCLA 4X2BA 3X3UA 1RAGB 1HYSA 2LVWA 2FHKA 3I4PA 4OYWA 4E8UA 4ZS6A 3DNCA 2CQBA 2UUAJ 1WC0A 3HK2A 5HK4A 5HMWA 1FFGB 2YNIA 1RAJA 5HP1B 2CPHA 2C2RA 1RT5A 2VH7A 1NUEA 4ZP9A 3Q8RB 4RUAA 4M1KA 3MCSA 1TMJA 3GIMA 1Q7YT 1F2GA 2XHCA 2VPZB 1U1KA 2ZHAA 4L72B 5J2NB 1UA1A 2LMIA 2R8JA 4MH8A 2BQUA 1FK9B 4KPCA 3Q2TC 3TX8A 1ZETA 2XMVA 4WFZA 2R7TA 2ZH4A 3BBBA 3CEDA 1JKHA 2Y1LB 4DDFA 4WXOA 2J7KA 5CCMA 2RH3A 1IWGA 1IKXA 1I6JA 4WE1A 5THWA 3M9MB 3DOKB 1RKJA 1L3VA 3BV8A 3NG8A 4HH1A 3EVMA 2EVZA 4IRCA 1HBNB 1UKUA 3GE9A 4QIFA 1X9SA 3ZXWA 1HNVB 1B7FA 2D74B 2VKZG 3OD2A 4C7QA 3P5BP 3T1AA 4PABA 4FBTA 2J9EA 4L73A 1X9WA 3UR3C 2XMJA 3V6KA 3DLKA 1T9WA 1AT1B 3RGIA 4K4YA 5E2QA 1XMQJ 1RHKB 3MEKA 4LF9J 3H4BA 3MECA 4PQUA 4ECUA 1U0HB 1NMEB 4HEA9 4LF5J 3AT1B 3GIJA 2HYIB 1TMMA 4EYIB 1U4BA 1RQ0A 4KJIA 5A0YB 1N54B 2VL1A 2IDLA 3R27A 5F9NA 2YX4A 3EGWB 2XG8A 1WORA 4UUXA 2RT3A 1HWKA 5KFTA 2CJ9A 2RRNA 2E66A 1ICEB 4ZLJA 2CNLB 1Y3JA 3OFHA 2VB6A 5AJ3F 2QEXS 4CO3A 2KG0A 3ET6B 1QE1A 2I0XA 4BDPA 3G8SA 3PRDA 2W7OA 4LIWA 2EXUA 1SJ1A 3UN3A 3CT9A 4AD6A 4OI6A 2G9OA 1VQ9S 2YQ3A 4A48A 1DQ9A 2PA8D 1PYOB 3D7SB 4X4OA 4IDKB 3I9ZA 1S6PB 4O44B 3BO2A 1IWAA 1X60A 1Y5NB 2HLUA 4BLGA 2C3OA 2HQIA 1GNKA 3H2VE 4YOEA 2BMBA 5D0GA 4ZVTB 3RW7A 4A8QA 2C2DA 4HDGA 1TFWA 3W3SA 1AB8A 1VK3A 5KT6A 4GKJF 2AJQA 1FE4A 5IZHA 3KLFA 1FD2A 1FXDA 1NPPA 4N7TA 5L8RC 3M9NB 3ZTOA 1FRHA 1HQEB 4NLQA 1RT3B 1S9GB 1HBUB 4FN5A 4DV6J 1HBOB 5LL6d 1C2PA 2XWXA 3H98A 4Y2IA 3B4DA 7FD1A 1LWCA 1BD6A 2ZBCA 4X4PA 2DT9A 3D0GE 1FKOA 2VFUA 4HDHA 4P7TA 3UR0A 1NH8A 3H4DA 1FEHA 4XO0A 2J9CA 3NS6A 5B0FA 1BWVA 1SUQA 4DL2A 2XSJA 2Y9HA 4X62J 1S0VA 1VQ6S 3HHDA 4USTA 4DUYJ 4LRBA 2IA6A 1RAAB 1M5VC 1B3TA 3D3BJ 2BW7A 3M05A 2C2KB 5E33A 3L7OA 3SV3A 2JLFA 3IA0A 3IBCB 2W9CB 3JQMA 4ZLPA 2VIHA 4OYMA 2DHXA 4OYXA 3I82A 3MEGA 4LUBA 4DV2J 1S6QA 1BY9A 1KP6A 4QWBA 2OFGX 3A4TA 4TU9A 3MAHA 1TKZA 2VV5A 3CDAA 4WZQA 4PXEA 2X3DA 3MFHA 3H2LA 3GG1A 3I0SA 2IVMA 5HJXA 4X4UA 1AW0A 5KFLA 2HNDB 5CAAA 4JI6F 2KB2A 3L3CA 1KS2A 3G8TA 1PG5B 2L48A 3R6LB 2NPFA 2CQIA 1JXEA 4Y2KA 5AT1B 1SKUB 5BYQA 4QJVA 3TEGA 5KT3A 1CJUB 2HSEB 1KVJA 1FWPA 2OIHA 2N7YA 3E8OA 4I7FA 5I3PA 3ZZPA 2N4DA 3ZZOA 1CSJA 4AL6A 3J7ZT 4A8YA 1WC3A 4EZ6A 5C42B 4ED1A 3TA0A 4OJHA 4DL0C 1V3RA 1HNXJ 2HMIB 1S1XB 5CABA 2GC8A 1R3NA 2MLXA 4Y65A 5M2PA 5KOXA 2EG1A 4HACB 4EWTA 1WOPA 5AE1A 3CC7S 4RW4B 3NXZA 1GX5A 2LDYA 4JI5F 2D9OA 2DYAA 1KTVA 1G1XA 4DSKA 4USMA 4ED3A 1SPBP 3EYZA 2UVRA 5ETNA 3ILLA 3MM7A 2ZC3A 2UUBF 5L9NA 1LW0B 2BRLA 1OY9A 3DRYA 2C2ZB 1DTQA 5D0EA 1T9VA 4WIIA 2VQFF 1HNIB 2BKOA 4WK3A 1U25A 2E9TA 3MM8B 1F6TA 2K3IA 1U48A 2Y0SD 2IM3A 3PW7A 3BB5A 3OTOJ 4Q5VA 3UNGC 2UXCJ 1HNZF 4G1QA 1F5BA 5IWAF 3FNNA 3ZZRA 3KLIB 3KLHB 1JK9B 1UL3A 1CBKA 2VPXB 4NYOA 4M63A 3DGVA 2F8MA 4UOCA 2HQFA 4LRFA 2OSRA 1N8RT 3R5CA 3SCJE 2CYYA 3HHKA 1XERA 3K5MA 1UJ4A 3NS5A 3KOAA 2AJFE 3DDKA 2JL9A 3B4MA 2AYEA 5J1EA 5JVHQ 2E5JA 3RJMB 1TR0A 1V5VA 5E3QA 3PEJA 1VRUB 4RNNA 5CD4H 3OJUA 4AQYF 3LO3A 1N0VC 3PW0A 5E7OB 4RW6A 1TL3B 1QTNB 2H65B 5GAHU 3GFZA 5J2PA 1NK7A 3DLHA 4JYAF 5F41A 2X1BA 4RBUA 2HVHA 1RHMB 3MR6A 4J9KA 2OLWA 4OHYA 1S1TB 2W8LA 3EPGA 2A10A 2J5AA 1WHYA 2VJUA 4QW9A 2PA3A 3KK3A 5BYRA 2KH9A 2B7CB 2VG7A 3CTRA 4ECZA 2X1GA 2AD9A 3C16A 3PHEA 2ZM6J 2RMLA 4A46A 2KVIA 5DDOC 4TU7A 4A8SA 1BGXT 2A2CA 3K89A 2KI2A 1FI4A 3O1LA 4M5DB 2HQGA 2FY1A 3J7AN 1RLCL 2IJNA 2QRRA 1KFSA 4DV1F 3I0RB 4D3GA 4F4YA 3CCVS 4NLXA 3SZ2A 3MF5A 5D77A 2JSXA 3BGOP 4ZIWA 1R0AA 2PFFB 2RILA 2FJWA 1NKCA 4DPTA 1RTDB 3OHBA 2V6AA 1NBEB 1NAQA 1KOHA 2DNRA 4EU0A 5K8MA 3C3LA 4JB8B 2EG2A 5DETA 1LFWA 2HRYA 2DEIA 3ITHA 4K4VA 1TTHB 3ZNUA 4LFAJ 2IFXA 5RUBA 3TA2A 3SFUA 1UFLA 4WP3A 3P49B 4Y6IA 2VQEF 4KHMA 5HL7Q 5F8MA 4Y2CA 1NSQA 4K0KJ 4UUWA 1KSPA 4UOHA 3RAXA 4DL6A 1YRTA 3IM9A 3K2YA 2UV8G 2GJIA 3GU0A 2BEFA 2YNFB 1QTMA 3KLEA 3VAIA 3PYFA 4WKRA 1ULRA 2WB1D 4OJ1A 3IRWP 1LKZA 2WVEA 3PIPQ 4MKVA 2FZKB 2QSFA 5EWGA 2ZUGA 2HVIA 3Q24A 2KZMA 5KFYA 3P5TL 4DWIA 4IOCQ 3M6XA 1Q82T 2DGVA 2YKOA 5F8GA 3OLAA 4Q2LA 2V4QA 4FXDA 1Y00A 3LGMA 2J9DE 3DOMA 2BDPA 3MM5B 1GXUA 1N5YB 3GLJA 2BM0A 5KG0A 1U6FA 4OX9J 2FVPA 2QZ8A 2VA2A 1FE0A 3UW1A 4EO6A 4H4MA 5CA5A 4TVAB 1VFJA 4DV0J 2HGLA 4H4KA 2QYCA 4LF1A 4LF8F 1U02A 3FFIA 2GVDB 3T5HA 4WP8A 3PW5A 2MJNA 5KFQA 1TU0B 1RXOB 4DFPA 1CC8A 1FDAA 3HX9A 3DCAA 3GYNA 3V4MA 2BQRA 5KG4A 2Q6BA 4DPYA 3HVTB 3QRQA 3DRSB 2YNHB 1LW2A 3FCWA 1HD1A 3ELHA 1WDDA 1I1GA 1R6VA 3FRZA 3C46A 1FJEB 1HR0J 2KXFA 3ILJA 2M70A 2YKAA 3LGNA 5FLXY 2P9GA 2WBRA 1R8HA 1TKXA 3TRGA 1DJ0A 1KR4A 3DDIA 4YS2A 1OQ6A 4PCQA 2FC8A 2V94A 4K4UA 1X4GA 2Y0BB 3MURP 1SC1B 5HP1A 2HHHF 4OZ0A 3HM9A 1WG5A 3WQPA 1MMNA 1MLAA 2G0CA 3WX8A 3CD7A 1JJCB 4IH6A 3CD0A 2J0SD 4ZJQA 1NK4A 2DR5A 1RBLA 1DQAA 2BBEA 5EDWA 3NNCA 3VGVA 2UUTA 1RHUB 4TN2A 5J1NA 3TUZC 4E98A 3BQ0A 1I51B 3LUYA 1KFDA 2G2OA 3W1YC 4HLBA 3ONQA 1VC6A 2KZZA 4Q0BA 2B43A 2D69A 2E29A 3RBDA 4QQBA 3CO9A 4F0MA 4D3HA 2UVVA 3T1YF 3MOZA 5M2RA 4YR3A 3SBMA 3DOKA 1FJCA 3PKYA 4P73A 4PQAA 4FPIA 2DK2A 1UFKA 1H7WA 1EJ7L 3ZTPA 4BHQA 5K8NA 3IAM9 4ES1A 4DSEA 3C6UB 2ZKTA 5D4LA 1X5TA 2KTQA 3D54A 1GH8A 1VRTB 2MLZA 1W7WA 1WC1A 2MJUA 1P27B 1JMTA 1C1BB 4ILRA 1RT7A 1UETA 2WSEC 1HIYA 1REVA 1CS4A 3N6MA 1NDPA 4QZVB 1EB0A 2Y8WA 3Q8PB 4GKJJ 3W9JA 4F50A 2HFZA 3CCSS 4TYAA 4DU8A 3GFHA 5J1PA 2IC3B 1AUDA 3VVUA 1ZPVA 4ZKAA 2EFQA 1HBMB 3CIMA 1R27B 1OYDA 2GHWA 1UJ6A 2EFGA 2AJ4A 3QMQA 3W65A 4WTOB 2DISA 2F8HA 3A3NB 4ECTA 4F4ZA 4CLYA 2QSWA 3BZQA 3NCRA 3C19A 3IWXA 2BM1A 3UDLA 1T3NA 2R7OA 5DDQC 2GIQA 1VIOA 1O6XA 3K59A 1TV6B 4YHHF 1PBAA 2IYGA 5D0RA 4K4TA 2I1RA 1CJKB 3FBCA 2JVOA 3LWLA 3FZBA 4M5LA 1RP5A 3N01A 3W62A 3QIDA 3H5UA 3JSMB 1VQKS 4L75A 4OYBA 3GSIA 3T1HF 1MWQA 3MCOA 4IDKA 1S4EA 4O44A 1P1LA 4LF6F 1S4FA 4ENOA 2AP6A 4PWDA 3M4XA 2HNZA 3Q86A 2ZH6A 1RAFB 2CG8A 1B7YB 3HT3A 4OHWA 4OLOA 4L6V3 1IBLJ 1JLQB 4Y2MA 2F4VJ 2W4PA 3HP6A 1Q5YA 3LW5C 1ZTTA 1VQ4S 2AYMA 1S12A 3MEDA 3M2UA 4TYBA 5LM7E 1VISA 3HFKA 1NJXA 3KTQA 4LSNA 2FQQB 1HL6A 2UXBF 2Z8QA 5IC6B 1C0UA 1RT3A 3D0HE 3P96A 4ZVQB 2OD4A 2MY8A 4NLWA 3HSGA 4PRFA 3L7PA 4P75A 3IG1A 1X4EA 2R2TA 1YBAA 1O51A 1WEZA 2C2NA 4B3TJ 1HBOA 1VCTA 1O8BA 5LJ3Y 2J8AA 4E2FB 4NMLA 3EVWA 4Q7AA 3N28A 4CLKA 1DAXA 2MSSA 1VDHA 4YFUA 5JVGQ 1FRJA 3Q83A 1JLCA 4GO5X 2RDJA 3DHXA 3IFEA 5G0RB 2OEMA 2AWZA 1WTFA 1LOUA 2ZH9A 3W5ZA 1S72S 4DR4F 4X4RA 3W64A 2Z0GA 1F1BB 2VDIA 2YWWA 6FDRA 2ZH2A 3ZTRA 3T9ZA 1HPZB 4KHPJ 1WF2A 1VBKA 1WEYA 5JXSA 1RU2A 2DNMA 1UEKA 5KG1A 4I0WA 5ETRA 1HMVB 4KGMA 2QV6A 3DU6A 3VR1A 2DB1A 4CLPA 2GAGC 5I3UB 1T02A 2W9CA 1XQIA 1IBKF 5H9EK 3AFGA 1VQOS 3AD9C 3QRPA 1BQXA 2IM0A 2PGCA 5GAGU 2NCKL 4JI5J 1NB2A 5F8HA 3OLBA 3LPYA 3SCKE 3UDEA 2J0XA 5K9FA 2VFSA 3LP2B 2HS4A 2W7PA 2CIMA 2XQCA 1M5PC 4NLPA 1S1VB 2UUBJ 5CZXA 2OELA 3IWLA 1RABB 3BYPA 3HHLC 4C11B 3QRRA 3K57A 2GO9A 1QVGR 1M90T 3FEYB 1R0CB 3PFEA 4URSA 1KOOA 4ZPVR 3DKDA 3ZTQA 2UXDF 1HQ2A 1T95A 3GR1A 1HNZJ 1QM9A 4I6WA 1R8BA 1A6LA 2MYFA 5DG9A 1U26A 1EAYC 2ZBIA 5IWAJ 1RAOA 3QPIA 2LXUA 1XNRF 5C42A 1SL1A 3DRRA 2RB7A 1V5IB 3VQSA 2PEBA 4B9VA 1IXKA 4DV3F 3IS9A 3D6TB 5GMDA 3T3FA 5IXUA 5J2QA 2XWYA 2QLJB 1RWWB 5AE3A 4QWEA 2KT2A 4YUDA 2GCFA 3D3CJ 3V6DA 1RLDA 4F02A 4K5RA 3KKFA 4WCEQ 1JXVA 1TELA 4AQYJ 2GMHA 2VG5A 2BE2A 4WZMA 4X4QA 4JYAJ 4J9QA 1WSVA 1E6VB 1JJHA 3PFOA 3D6MB 3HT0A 2JEJA 4QYZJ 3M1VB 5J2MB 3FZ2A 1HNIA 3A13A 2JHEA 2M0GB 2X7IA 1DLOA 3MCNA 2V8VA 5B0BA 3H40A 1PCAA 2VG6B 1N5SA 3NBPB 3C14B 4ID5B 2DNPA 1MWZA 5C2CA 3B82A 5L1KA 2G2YA 3PJ9A 1AZSA 1S57A 4ANDA 2AX1A 2QYGA 4C8NA 4PWUA 5GADI 4ZPAA 1N4LA 1U1OA 1YZ6A 3AODA 3P45B 4DV1J 1KQSR 3DLJA 4KPYA 3SIPB 3U1LA 5L39A 2G2ZA 3FBBA 3SQOP 3SXLA 4DR6J 3MMCA 4JUZA 3V81B 3GPAA 4DL3A 2ZH8A 1SCJB 4MKYA 1VRUA 4OHXA 3PRBA 3OR1A 3H2UB 4N77A 3PYEA 5ETPA 3GIRA 4DR3J 3WDOA 1BHNA 1JXLA 2ZZNA 4IH7A 4ES2A 1KONA 3NS7B 2F40A 3FVYA 4O23A 2V4JA 2VQEJ 4LF7F 4C8ZA 4OZ1A 4ED6A 3TVYA 5DS7A 3QSYB 2ZVSA 1HA1A 1HFEL 2NXEA 2XHWA 2E7XA 2OD6A 3MPYA 4ECVA 4PXBA 4B08A 2JEGA 1HARA 3G96A 3QSIA 1TQLA 3M8PB 4MFBA 3JYTB 3I55S 4JI7J 2RF2B 2V2VA 3KLVA 2R42A 3M8SA 4XPCA 2LQ9A 3T19A 1I94F 2XCPA 2VBZA 2GAHC 5B7WA 3X1LB 1N6QB 4DV7F 2DR6A 3CCTA 4NYZA 4ZCIA 2DH8A 5HO4A 2Q1LA 4RNOA 4IOBA 3H90A 4Y00A 3TUPA 3LOUA 2M9KA 2NXCA 1CJVB 2QMXA 3BGRB 4IG0B 1HHQA 1PJ5A 1CULB 1UVNA 2XYHB 1S0OA 1T9YA 4J5OA 2DRDA 2LQBA 4LF8J 4Y2AA 4C3LA 3R7SB 2UV8A 3M8YA 1F2HA 1Y11A 3PR4A 3U1MA 1KD1T 4ED0A 2QA2A 3AXMA 1PBUA 4M94A 4NX9A 1VMBA 2QLFB 1T03A 2GGPB 3L4BC 4FXWA 1RJJA 1PKUA 1Q0NA 1UPMB 3M8QB 1T05A 5KFAA 4NMXA 2DHSA 5F0WA 1F9EB 2R3VA 2DY9A 1YJWS 3K5LA 4U6PA 3H42A 3HF5A 4LRCA 3RUBL 5KFOA 1LEOA 5C25B 2HRUA 4DFKA 5HQLA 4OV1A 9RUBA 2PO4A 1RWVB 2I9SA 3S01A 4C2MA 1JLEB 1FDDA 3O8WA 3OBIA 4OI4A 3W61A 4DLEA 2E5IA 4FNHA 3HZEA 1J5OA 3RAMA 4FF1A 2HFNA 1RB0A 1X8DA 3MM5A 5AE2A 2HHHJ 4M8LA 3ULHA 5GADU 5EWFA 3OTBA 2KM8B 1NB7A 2YH1A 2Y1IA 1RT2A 3BF4A 4IO9Q 1B70B 1JLGB 4U8VA 1QDUB 4ED7A 2BVZA 2MGZB 2YKQA 3R1LA 5HVHA 3QJLA 3R1HA 2ZH1A 4ICLB 1RZMA 2E1AA 2GVDA 1FKPA 3R8YA 3E01A 3DGPB 4Z2XA 5KFWA 3FEZA 3W9IA 3TZWA 4A4JA 1U1PA 4H4OA 5HJYA 1D3WA 2KYZA 2XMKA 1Z4UA 2NSBA 2YQ1A 4NA3A 3HVTA 4PG5A 2C2OB 3KJFB 2E5LF 3Q8VA 2OH2A 3W60A 3KK2A 3QJJA 2XSFA 3S8SA 1FCAA 2G1DA 1OO0B 4WYWA 2GMLA 3HVWA 3P3DA 2RD5C 1PYSB 1FNXH 3AAWB 5IT0A 3NCPA 4KY3A 3DI6A 5HBMB 4X4VA 3N5FA 4A8FA 1CQNA 2QMWA 1Y3KA 2P9CA 2UVWA 4WTYA 2FIUA 4J9UE 4PG4A 1RU1A 2OKQA 4ZVUB 2J6TA 3I9V9 4Z7CA 8RUCA 3MUMP 2BJ3A 1X5SA 5A8WB 3QT6A 3RB3A 3JB9k 3I96A 4KGVB 4OJGA 2HHUA 3BH6B 2RAQA 4NEZA 4PWWA 2XO7A 3M30A 1U1MA 5H1SV 2R7RA 4X4TA 1SBRA 5KFNA 4TQSA 3TVZA 1S1WB 1MROB 2M52A 2VC1A 2F9JA 4PAAA 1Q95G 4UY8T 3BKFA 2H3EB 3PX4A 2DH9A 2D3ZA 2RRAA 4JI0F 3M8ZA 2FHMA 2ADBA 4RX6A 4JI1F 2AYBA 1RCOB 4ZA1A 1K73T 2WW4A 4DUZF 1V9OA 3TUJC 4V19J 2WOMB 1K9MT 2B9EA 1NSKL 1SQEA 2EBGA 5KG5A 3OFFA 3UN5A 2QLBB 4YDDB 3OTEA 4EBEA 1RTHA 1KLMB 4ZHRB 3BR9A 3WIVA 2GFFA 3M6UA 2XLKA 1YJNS 2R7WA 3BREA 2OPPA 1IQTA 1C1BA 2NXJA 2G1HA 2EC2A 3DOLB 4LR8A 2QL7B 5KFMA 4CYUA 4I2PA 1ZBTA 4UW2A 2ZWPA 4DCOB 2XO6A 4O4RA 4B3MJ 3MEEA 2MB0B 4NZ6A 4KFBA 3FMWA 2FGOA 4P6QA 4B3OA 2RHSB 5L1JA 3EVOA 3CCRS 2F9DA 4RNMA 1YIJS 4RW7B 1YRXA 2KN4A 3SQGA 1LFPA 3UDVA 4YMEA 1L3SA 1VBYA 3V6HA 2KHCA 4DFJA 1F5CA 1NPRA 2DXEA 3RBEA 3N6NA 4KV8A 4ES3A 3VGSA 3V4IB 1BQMA 2PSZA 3QIPB 3KG0A 1GFWB 2G0JA 4CH7A 3JSMA 2QLXA 1GTEA 1UTAA 2E44A 2HHPA 4OYIA 4Q44A 1WD6A 1UEUA 1GT8A 1BE4A 1Q8BA 2QFIA 2BQ3A 5DZ6A 3QO9A 4CO1A 4ECWA 2GHVC 1S1UB 4NEYA 2N3LA 2F3JA 4RR5A 3DLGA 2VASA 4C8KA 4G3IA 2NUUG 1IBKJ 2V67A 5IV4A 4CLUA 3PRVA 1O5JA 1XMOJ 2MQOA 1WKLA 3RYLA 3TZYA 8ATCB 2AYGA 3T5LA 3KMSA 4PPDA 3RB0A 3KK1B 2ZITA 4L3NA 1YRUA 1VQLS 4YY3F 1F5AA 1XK8A 2XEXA 2HAIA 1ZS6A 1YBTA 1JLAA 5IM0B 4WIQA 1SKSA 2IPOB 2H54B 1VQ5S 4CM0A 3OQ2A 3KWMA 2VDHA 3NAHA 3DLEA 4EI2A 1SL0A 8AT1B 1JLBB 3UD4P 1EP4A 2FVRA 3F56A 2XS7A 3CNQP 4F3MA 4JI8F 2UXDJ 5FIIA 1YHQS 2WCXA 1HQUA 1IKYB 1T0TV 1UEVA 2HBQB 5A2QU 4RBVA 4UF4A 1XNRJ 3H20A 1HPZA 3VALA 2E9RX 3BYRA 4U96A 1UWAA 4DR5F 3J7YI 4DV3J 2MKIA 3MDFA 2KFYA 2V34A 1K0TA 4DQPA 5C24A 2DR8A 2WK4A 5I3UA 4U9RA 3IR7B 3BS9A 3G6YA 4X65F 1TZ0A 4GC6A 4CNZA 3VAFA 2HBYB 2BA9A 2WRMA 4KKOA 4NI2B 2RU9A 2N82B 3ZO7A 1LK5A 2XB2D 3GONA 3FSIA 1OIAA 2DIVA 1H3DA 4M5KA 1QVFR 4ZN3A 4TY8B 3EX7B 2DNGA 1S9EA 4FYXB 3SSQA 1X4AA 5CQGA 5KT7A 5FDLA 3VZHA 4C11A 3M2VB 4F4WA 5FJ4A 1ZAWA 1U2CA 2FHJD 4NLSA 4QIGA 4LF4F 1X4FA 2RSQA 4L76A 3HFVA 4ZLNA 3MZIA 3TAQA 2ZOGA 1Q7LB 1RT4B 2B5JA 2W2QP 2Y8YA 3JTOA 2JEFA 3H0PA 2KDOA 1W26A 4OFZA 3VV2B 4LFCF 1RA6A 4EZ9A 2HLTA 3FEXB 5T7LA 4DF4A 4IO1A 2P8IA 2IA0A 2JX2A 4CO0A 2ZDPA 4NA1A 4KO0B 1Q5VA 1TVRB 2W2MP 2W2PP 2IM2A 2HFSA 3RRGA 3CPWR 5CYQA 3CW2C 3ISND 5F3TA 4DLGA 3UCZP 2VFRA 2AT1B 2HHVA 2ZH3A 2ROEA 3CCLS 4TU8A 1FDBA 3DRPB 4RJVA 1ROFA 3WX4A 3C6TB 3KFWX 2MQQA 3CGIA 3H7HB 2JDJA 4RL1A 3O3LA 1S48A 4C98A 2MKCA 2GO8A 1SC3B 1OSDA 1N34J 1WC6A 4ZP7A 3UPFA 1E6VA 5DDPC 1K1SA 1YKWA 2ZKUA 1VJWA 3HKWA 4ZVEA 3M32A 3B54A 4A8MP 3HDSA 2AGPA 3I5AA 3EGVA 1FNOA 4OX8A 2DPJA 2GVZA 3NBPA 2AZ3A 3CSKA 3TQ1A 4ID5A 2C28A 4PUOB 2GS8A 2ZE2A 4EFAC 2FDNA 2KFZA 4C3KA 2OGUA 1GMWD 4USIA 1HWIA 4HTIA 1M5KC 2Z4PA 1Q81T 2L41A 2CPJA 2NREA 3IN5A 3OSNA 2K1RB 4A8OA 4ETZA 4K59A 2ASYA 5KFRA 5CCLA 2DHAA 3DYAA 2XM3A 3TANA 3GB0A 1I94J 4DF8A 3JSBA 1FT8A 4LBPA 4OYZA 4WU3A 2C3PA 2XYGB 3CC2S 2HHTA 2H1YA 2OPRB 2ASDA 3MAQA 4C8LA 3J7YU 5KFDA 4U7UK 3AD8C 2WSFC 3BJYA 1EETB 1N56A 1E6YA 1SV5B 2NPIA 2HHWA 5HLFA 3HHLA 3IMQJ 4LR9A 3TVKA 1NHVA 1U1LA 3G87A 3AOCA 5CYMB 2ZHBA 3D1QA 1UJ5A 1ZM3A 1RCXB 1Z1ZA 9ATCB 4MKBA 4PYAA 1R89A 2VOOA 1FDNA 2C1EB 2I5JB 2Q66A 4R8UB 2RKIA 2ZH5A 5D8HB 2NS1B 1U6ZA 4FDFA 1S99A 2YH0A 4GC7A 3UNYA 4QIEA 1NK9A 1GTHA 2X51A 5A8KB 2RUGA 3GG0A 2OJ3A 3ZZTA 2XCAA 1EARA 4DG1A 2C42A 2LEPA 3CCJS 5HANA 1RKIA 1XR7A 4HI1A 2CZ4A 4USVA 4O3RA 3CDWA 2MZRA 1KN6A 4LIRA 1FERA 4JI4F 2AU0A 2VFTA 2V9KA 5KFFA 1IR2A 1N6QA 2ILZA 1MU2B 4W90B 1D09B 3JS9A 5EUHA 2QG9B 1PYTA 4NLGA 4DHVA 3FC9A 3MMAB 5B08A 2VBWA 3BGRA 3IAS9 2CZ9A 1CULA 3EM1A 1HI8A 4GRSA 5LSRA 2L9NA 1OPZA 2Z2YB 3FK4A 2PMHA 3POTA 2XYPB 4CCHA 2V69A 3NNHA 2L3MA 4FYYB 2BYCA 2ZC4A 1X4BA 4CTAB 3SMZA 1WKJA 2V8DA 3BGUA 2DCUB 3T5JA 1X4DA 5A6PA 1VR6A 2QL5B 3OUYB 3LAMA 4KHRA 3TO8A 5BR8F 4M5HA 1Q79A 4PZVA 3UWTA 1RTZA 3W5YA 3M8QA 1U1NA 3M6WA 3WHIA 5HAOA 2E5LJ 3CCES 4DR2F 2EW9A 2J9DA 1HW9A 1QUVA 4ZN1A 1A7GE 2GNKA 2MZQA 4NL5A 1P1TA 2QGFB 5DGBA 5C25A 1UWBA 1RWNB 3S6EA 3VAHA 3CIZA 4Y28C 3AOAA 3SCIE 5LMUJ 4P10A 1A0OB 3MAAA 4PEOA 3HSDA 2OFHX 3K5PA 2J6SA 4OHVA 2FB0A 1TP7A 3QAEA 4NRUA 3W2WB 4UZBA 3J80U 3MM9B 1NKEA 4KIAA 2FHJA 4DR1F 1RTJB 4DL5A 2XMMA 3H5SA 3EDQB 3Q8SB 2V0NA 5ADZA 3TAMA 4XK8C 5EGYA 2IAJB 4UOFA 1NK5A 4DQRA 2VBYA 1VHFA 3NOGA 1WG4A 1S6UA 3CJ4A 3KYLA 1YJ7A 4DV4F 1J27A 4O4GA 3OHAA 1Y10A 2W9BA 3VVTA 3GV5B 1HYSB 1TL7B 2OPQA 1V6HA 2CPYA 3NOCA 1S0NA 3OTDA 4WPAA 2OP5A 1FKAF 4FPRA 4DUZJ 2CJQA 1HHTP 3GJQB 2QT7A 4P72A 2YNIB 5LSLA 4QIVA 3I31A 2PIIA 2HBZB 3OR2A 2H5EA 4IUFA 5DQIA 1RT5B 4CRJA 3K5NA 1PGZA 5ETKA 2NR0A 3CMES 3CCQS 3IR6B 4NZ0A 2BRKA 2MQLA 4C0HA 5A8WA 4CWBA 1UA0A 1RE1B 2ZFHA 1X5OA 3AHPA 1XBWA 1EIYB 5B0GA 2POKA 3C2PA 3RRKA 2W24A 1WELA 1LWEA 2WVBA 1EQ0A 1QY7A 2VZ9A 4DCJB 5B0EA 1JKHB 4DR7F 3PY8A 1XWLA 3UD3P 1U2RA 2O01C 4HHJA 4H54A 5DJBA 3P8BB 1NK0A 3TZZA 1IM4A 4NZ7A 2V50A 1MROA 2NYIA 2RQKA 2B6AB 3UN2A 1IKXB 1DZ5A 2XS2A 4WE1B 1H0HB 3MM6B 3TA1A 4M5JA 2CJAA 2HK3A 2AF6A 4I2QB 1IVZA 1FRLA 2DRBA 2HPUA 3SDEB 2V4RA 4JOUA 5T41A 1BUXA 2WOMA 4HT5A 2CADA 1UVLA 2W2NP 2J8SA 3R7NB 5U47A 2JZ5A 3DLKB 4K8RA 4OHZA 1EZZB 3M2RA 3GWCA 2A1BA 5LSOA 1SKRA 3R6GB 4KB7A 5KG3A 4QR0A 3BSNA 4ECYA 3MECB 4PQUB 3ICLA 5L1IA 3VHQA 3A3PB 3W2VA 2P9EA 3D4JA 4YB5A 5M2UA 5D3GB 4LQ3A 5LJ5Y 3K5OA 1IJFB 3HJFA 1S6OA 3TJ9A 2RHQB 1HWUA 3QZ8A 1S77D 2YBVA 4BS2A 2PMZD 1SQFA 1WF1A 4FS2A 2Q79A 3Q0AA 3H59A 2I38A 1RAHB 1VOMA 2AEMA 2WB4A 2ZWOA 1QE1B 1YJVA 1H38A 1S79A 4WFBQ 1IKWA 2XY6A 4N47A 5L38A 1NK6A 2GW8A 4O3PA 3IC1A 1LWFB 4WYLA 2WZ1A 3V4IA 4G1PA 4CM2A 3M6VA 4RW9A 3NAIA 4JI8J 3D5MA 4ZJLA 2V9WA 2BJEA 1YDLA 2KT3A 2CPEA 4FYDA 4NASA 2YKMA 5DQGA 1M5OC 1G3OA 3T5KA 2D3OR 4DQSA 4DL4A 4P7VA 1XMQF 2V2QA 2C22A 4CQ1A 5GAHI 4DR5J 3GR0A 4G65A 2LQ8A 4LF5F 1G7CB 4ZK7M 3RBXA 3UCUP 2Z30B 4X65J 4MKAA 4DL7A 2CUYA 4FVMA 4XDDA 5JUMA 3VWSA 2FHOB 3KK1A 2HHQA 3PJWA 4R5PB 1FWLA 4LSZB 1TK8A 4USUA 4LVNP 2FD2A 5MAOA 2OAUA 3CD5A 2CQGA 1FKOB 2MMYA 5ETVA 1VK8A 3SSSA 3JXOA 1WG1A 3TNVA 2JLEA 4ZCKA 3A8KA 1Y4ZB 2X1FA 5KFZA 2NYHA 1JLBA 1SUQB 3AQOA 3G6ES 2XGQA 1WSRA 2XSJB 4QOTA 2R8IA 4ECQA 1PJ6A 1VQYA 4UTGA 1R31A 3AXKA 5I42A 2HEKA 2V63A 2XY7A 2IRXA 1IBMJ 4RUCA 2DR7A 4Z7YA 4LFCJ 3C15A 2A3JA 1MWYA 1FX2A 4X84A 1R0BG 2HS3A 2H51B 1C1CA 3MEGB 2JWNA 1S6QB 1MW7A 4ILMA 4DSJA 3PW4A 1TKZB 4B9TA 4LBIA 5LT5A 4DS5A 4KAIA 2ALZA 3W5XA 4OZJA 3AJ1A 2JC0A 1RBAA 4BWMA 3I0SB 4FVCA 3QGPA 1U45A 4X4SA 1W2BR 4DFMA 2CQ4A 4IFYA 2CJBA 4NXMJ 1P9QC 3N79A 1IKVA 3R5JB 4QWAA 1GXLA 4QPTA 4UZCA 1LXJA 3NMAA 3A12A 5A8RA 1ZAVA 1WUUA 2NQPA 2QFJA 4I7FB 2YWFA 1QUPA 2UU9F 4X62F 4ZIVA 4NCAA 1X0PA 2FJEB 3CJRA 3LP1A 4ED8A 3O2IA 1TK0A 1F3VA 1L3KA 2KHDA 3PYDA 3K8VA 2AJ0A 1KLNA 2DXDA 4J91A 3HKZD 2ALYB 4B9SA 2MZ1A 2J7WA 4MK9A 3RBZA 3CJ5A 3CJSA 4ZLLA 4I6YA 4DV2F 4ZOSA 3W8GA 3DU5A 4PG7A 2IMOA 2FLNA 3K0JA 5B0AA 2J7UA 4K4SA 3MM7B 1ZYQA 2GMJA 5H9EJ 2LFVA 1UPPA 2DGUA 4OZ5A 4NYPA 1DTQB 4O3SA 4F2RA 5DG7A 3CCZA 2KO1A 3PTWA 4GMKA 2BJDA 4ZVPB 5AXLA 4OYPA 3HXMA 4GO7X 1NM2A 3T41A 3GJTB 2LA6A 4ZPCA 3BN4A 4G1QB 2DNHA 2LDIA 2ZVIA 2MZJA 2DGQA 2CNOB 1N36F 4PUOA 2DRAA 2EFVA 4IRDA 1FO1A 3JQJA 4J7CA 4YR0A 1DHMA 4DZ6A 5A2QY 1P6TA 2R2RA 5SZTA 2MKHA 5A76A 1WOOA 2LP4A 2G0IA 4KE5A 1SJFA 2AV5A 3S1TA 3HO1A 2FVQA 1A9NB 4MTPA 4YP3A 4JI4J 5C5JA 1K44A 3G4SS 5LMNJ 1Q16B 1UFWA 1S49A 4U7CA 2OPRA 4WFXA 3D0IE 5J2PB 1U8SA 3KNAA 4KSEB 2EFPA 2G13A 1CQMA 4OJ3A 4F3QA 1SV5A 1JLFA 3I32A 3UD5A 3MMJA 1QD1A 2Y1JA 3IWNC 3EZ5A 5AXKA 2YNGB 3OVSA 1XR6A 2XMTA 3HHNB 4LSLA 3KK3B 3LP0B 1SC6A 4GVBA 3OTOF 2HGNA 2VG7B 1JNRB 2PEHA 1RT6A 3G71S 2I5JA 3F44A 2UXCF 2D1CA 4ZITA 2H9ZA 3J81U 3C16B 3LALA 1DQ8A 2YWGA 1ZM2A 1KTQA 4WXWA 2L08A 2ZJQQ 1SJ3P 2XMUA 3TJ8A 2FJBB 1FHTA 3G6VA 1RI7A 4DR2J 4I6AA 3QQCD 1QLNA 4OI3A 1S59A 2LEBA 4YDXA 2UP1A 3GTYX 2BOPA 2BE7D 3GSDA 4NA2A 2NXNA 1YITS 1C0TA 2PE8A 1R0AB 3A3OB 3FCVA 2WONA 2Z2ZA 4LRDA 5AXMA 4NCGA 4AXIA 2ZDOA 4A47A 4B02A 4O0NA 4JP8A 2VODA 2DKOB 1RHQB 1M5HA 3W7BA 3WIUA 2HNYA 2FY8A 2VBXA 5HMXA 2DPIA 3MMAA 3OJSA 2QO3A 2KKHA 2W1BA 1X4HA 2H4WB 4AUKA 3CJ8A 2IM1A 1VBXA 1RT1B 2B9YA 4RNFA 2M88A 4J9VA 3OVBA 2WVCA 2BUNA 3OV7A 1X4CA 4FXVA 3S7RA 4AL7A 2ABYA 3KLEB 4R0EA 1RK8A 1ZTWA 4ZJOA 1S5ZA 1H98A 2M3DA 2XZDB 3VGUA 3TWZA 2IJFA 3IO1A 2FUG9 1MN7A 2DHGA 2AKWB 3VAGA 3FQKA 1HI1A 1KNZA 2WW8A 3VGTA 3PHTA 3PR5B 2M8DB 2GV1A 1RAIB 3BSAA 2KU7A 3TOQA 3HFZB 3ZZ0A 3DOMB 4CO2A 5CXTA 2QMUB 4RWXA 3LANA 1YJTA 2XC9A 3HPOA 1S97A 2Q43A 2LQ5A 5ETMA 2QA4S 2YQ0A 2JFKA 1WHWA 2BJ9A 2ZHOA 4H4MB 3D2WA 3MM9A 4KT0C 3T9NA 1IUJA 5J2NA 2WAQD 1FK9A 6AT1B 1RTJA 2FVSA 3VCDA 4TNOA 4LFAF 3PCOB 1OY6A 1NEEA 2AJ2A 1O0PA 4J37A 1VQSA 4DR7J 5HMZA 1PJ7A 1NXIA 4K0KF 3THTA 4ZPDA 5DLGA 1ZM4A 3AY0A 4QW8A 1DARA 1LW2B 4ZCLA 1WHXA 4KGZB 5AJ3J 3CC4S 2LKZA 1PAEX 2NZCA 1F3FA 3PO5A 2HRTA 4ELVA 1HBNA 5E3CA 1TKXB 1TL7A 1HNVA 4LBHA 4RW8B 4OX6A 1R8CA 2W25A 3LPEA 3GFYA 4QU6A 5KFHA 1XJWB 2DNQA 4WJBA 4AXJA 2DJWA 1WF0A 4ITSA 5GAGI 2E1PA 4OV6A 3BR8A 3IP0A 2M2BA 4MT1A 4KTQA 3PV8A 1LWXA 4OX9F 4WWSA 2W9AA 4HH0A 3U1NA 5F0UA 4C0OC 5H9FK 2ZD1B 1JNZB 5G4DA 5GMKa 2B3TB 3UE2A 2ATLA 2DGXA 2U2FA 2VOPA 4DV0F 1U0HA 3U27A 2CVIA 2ATCB 4NXNF 3KJVB 1VQ7S 5A0YA 5DLFA 2CDRB 2FC9A 5IQ6A 1APSA 2O66A 3CF5Q 2CA9A 5IS2A 1J2VA 2HVDA 3EMTA 4YB1P 4Q0BB 1BLUA 3ZZUA 1JJ2R
chains in the Genus database with same CATH topology
4YB6A 3B4MA 1HQUA 2AYEA 2B6AA 1IKYB 5J1EA 3L95X 1UEVA 5JVHQ 1HR0F 3POTB 4RBVA 5D4OA 3MPWA 4ICLA 2E5JA 1TR0A 5E3QA 1Q8IA 3H20A 3MD1A 1BQNA 3MM6A 3PEJA 2CRLA 2NZ4A 1HPZA 3DGPA 1VRUB 3VALA 4RNNA 2E9RX 1XNQF 5CD4H 3OJUA 1OS5A 1SH2A 4AQYF 1N52B 3LO3A 4DR5F 3CE8A 1N0VC 2F1FA 3IR5B 4I2QA 3J7YI 2ADCA 3PW0A 5E7OB 2XNRA 4RW6A 2MKIA 1TL3B 4AYBD 1R8PA 3GFZA 5GAHU 4NLOA 5J2PA 4X64F 3MDFA 1NK7A 2KFYA 2BANA 1FJ7A 3DLHA 4HL9A 3TYTA 4JYAF 3SDEA 3IRXB 5F41A 3HI9A 5DGAA 1K0TA 1R6YA 4DQPA 4X4NA 2X1BA 4RBUA 2HVHA 2AGQA 5C24A 5I4MA 3MR6A 1S6PA 4J9KA 2OLWA 2DR8A 2K7JA 2WK4A 1R7IA 5K8PA 5I3UA 4OHYA 4U9RA 2MKJA 2CQ0A 2CZVC 3IR7B 3N4WA 2R7VA 4URQU 3BS9A 1S1TB 3QWPA 4MMOA 3G6YA 1MSWD 4X65F 1TZ0A 2XNQA 2W8LA 3EPGA 2A10A 4GC6A 1R43A 1RT7B 4CNZA 3R5DA 2J5AA 1X7VA 3VAFA 1KQFB 1REVB 3DM2B 3PIOQ 2BA9A 4ED5A 5DRKA 1WHYA 3G8QA 2WRMA 4KKOA 1HW8A 5DO2A 1C4CA 4QW9A 2PA3A 3KK3A 2DVIA 5BYRA 2KH9A 2RU9A 3AJ2A 4HT7A 2N82B 1UWBB 3PX0A 2VFVA 2CFXA 1LK5A 5MLCV 2XB2D 1UMJA 2B7CB 2BV3A 2SXLA 2VG7A 5KT2A 3CTRA 2GJ2A 3FSIA 4WFNQ 1OIAA 2DIVA 1H3DA 2HWIA 1YWXA 4ECZA 3J80Y 2X1GA 4V19X 2AD9A 2IBKA 2K7KA 1QVFR 4TY8B 3AB2B 3EX7B 2DNGA 1OPIA 3PHEA 1S9EA 2RMLA 3JSRA 4X66F 5HBMA 4A46A 1ZZFA 4ECRA 2KVIA 5DDOC 4TU7A 3SSQA 4WU2A 3I5CA 2UUWA 4QR1A 2OTJS 1X4AA 5CQGA 2MPUA 4ETXA 4A8SA 5KT7A 5D3GA 3G9CA 1HQEA 5FDLA 3BO3A 3VZHA 1BGXT 2A2CA 4C11A 2KI2A 3M2VB 3O1LA 1S9GA 1HBUA 4F4WA 1ZAWA 5FJ4A 4M5DB 2FHJD 3ISZA 1WEXA 2OO4A 4NLSA 4QIGA 3G6XA 4LF4F 2FY1A 2RJZA 2IJNA 4C8YA 1X4FA 2QRRA 2RSQA 1KFSA 4DV1F 3I0RB 1FESA 4RBTA 4D3GA 3MZIA 2BW2A 2L9WA 3C8YA 2ZOGA 4F4YA 3EXCX 1Q7LB 3CCVS 3TAQA 4PPZA 4NLXA 3T6JA 3HLUA 2CPIA 5KFSA 3GV8B 1RT4B 2B5JA 3AQPA 3MF5A 3SZ2A 1UVJA 3CCMS 4NLUA 3JTOA 3VAKA 2JEFA 4N76A 5D77A 1TK5A 2JSXA 2LCWA 5K14B 3TAMB 1SKWA 2KDOA 1R0AA 2PFFB 4OFZA 3KHGA 3QGIA 4OMFG 2RILA 4LFCF 2FJWA 1RA6A 4EZ9A 1NKCA 1OQ3A 2HLTA 1S1WA 3FEXB 5T7LA 4PXDA 4DF4A 3OSPA 4OLPA 1RTDB 4IO1A 5EWEA 2IA0A 3OHBA 4ALZA 2JX2A 4CO0A 2ZDPA 1NAQA 1LWFA 1KOHA 1QSYA 3DXBA 2U1AA 4NA1A 3B78A 2DNRA 4KO0B 2ACYA 4EU0A 4QPXA 5K8MA 1SIZA 3OXFA 4O4GB 3C3LA 2RS8A 2EG2A 1TVRB 5DETA 2CQHA 4ED2A 1LFWA 2HRYA 2IM2A 3GMGA 4K5SA 3PNIA 3IGNA 3ITHA 3RRGA 4K4VA 3CPWR 2CPDA 3E3XA 2W9BB 2IHR1 2IFXA 5CYQA 1H6KX 3TAPA 2KJWA 2QLWA 3ISND 3TA2A 3PM9A 3SFUA 2O3DA 1UFLA 2QIFA 5F3TA 2OPQB 2N3OA 3P49B 4DLGA 3K58A 4B9MA 3UCZP 2RVJA 4Y6IA 2VFRA 4DQQA 2FGCA 2HHVA 4PWDB 2DGWA 3I56S 2ZH3A 2VQEF 5ITHA 2ROEA 2HNZB 3CCLS 4KHMA 5HL7Q 5F8MA 4Y2CA 1NRKA 2V2KA 4TU8A 1FDBA 2P6SA 4UUWA 3L09A 5F8LA 2YWKA 3DRPB 5T14A 1KSPA 1DFDA 3RAXA 4DL6A 1ROFA 1YRTA 3WX4A 1JX4A 3NWGA 3VF0B 3C6TB 1KC8T 3KFWX 4I1TA 3K2YA 2EK6A 4F2SA 2MQQA 3ENVA 2UUAF 3BGLA 2UV8G 3CGIA 2GJIA 2JDJA 3O3LA 2YNFB 1S48A 1QTMA 2JJ4D 4C98A 2MKCA 2GO8A 3KLEA 5LMUF 3BGFA 3VAIA 4USHA 3EXYA 4MYUA 3MEDB 1OSDA 3GYXB 1FEEA 1S7HA 3M2UB 3OR2B 2XY5A 1VQNS 1FXRA 4NOHA 4N41A 4WKRA 4ZP7A 1KLMA 2IVFB 1E6VA 3DXSX 4ZHRA 1ULRA 2DO0A 2WB1D 4OJ1A 3UPFA 1LKZA 5DDPC 3IRWP 3GIKA 1K1SA 4LFBF 3PIPQ 2ZKUA 3M8RA 3CVKA 2QSFA 3R3TA 3FQLA 1VJWA 4LSNB 3HKWA 3KHHA 4MIWA 4ZVEA 5EWGA 1AFIA 1CPZA 3M32A 2ZUGA 2HVIA 3Q24A 2KZMA 5KFYA 4A8MP 5D4NA 3DLBA 2RDIA 3P5TL 3HDSA 3F41A 1C0UB 2AGPA 4DWIA 4PG8A 4N5SA 4IOCQ 3DOLA 3I5AA 3M6XA 4OIXA 2HHXA 1Q82T 1FNOA 1FTCA 3A8EA 2DGVA 3LWMA 1T3OA 3IG1B 4OX8A 2DPJA 5EN1A 2YKOA 3U7JA 2ZJRQ 5F8GA 3NBPA 3Q22A 1FVQA 5DM6Q 3OLAA 3NMRA 3CSKA 4Q2LA 2M5YA 2DTJA 1Y00A 3LGMA 4ID5A 2V4QA 3TQ1A 2C28A 4PUOB 4FXDA 4R5PA 2HNDA 2ZE2A 2J9DE 3DOMA 4AFFA 3MFIA 1LWEB 2BDPA 1TAQA 2XLJA 2JEIA 4EFAC 2FDNA 3MM5B 1GXUA 1IQZA 1HHSA 3LF0A 1N5YB 1UW4A 1GX6A 2KFZA 1Q4RA 4C3KA 2YVSA 4Y0FA 2BM0A 4KBIA 5KG0A 1U6FA 3BQ1A 3FRYA 4QWCA 4USIA 3D1HA 4NWBA 1HWIA 4HTIA 1M5KC 2EFNA 2Z4PA 1JLCB 2FVPA 1DTTA 2QZ8A 1Q81T 2VA2A 2L41A 2CPJA 1FE0A 4RW7A 2PC6A 2RU3A 2NREA 3IN5A 3OL8A 3UW1A 4OL8A 2GQ2A 3OSNA 2K1RB 4EO6A 1OWXA 1NU4A 4H4MA 4A8OA 5CA5A 5HMYA 2MQPA 4ETZA 1AFJA 1VFJA 4K59A 2ASYA 2COLA 5KFRA 2HGLA 4H4KA 4C9DA 5CCLA 4C4WA 2DHAA 2QYCA 4LF8F 3DYAA 3NGKA 3TANA 1U09A 2HFOA 3FFIA 3GB0A 4DF8A 1DBDA 3T5HA 3JSBA 3PW5A 1FT8A 2JVRA 2MJNA 4WU3A 2C3PA 5KFQA 4RLEA 3CC2S 1IJEB 2HHTA 2OPRB 1PO6A 2MKSA 4DFPA 1CC8A 1FDAA 2CPZA 2CQPA 2ASDA 2HMIA 1CLFA 1FTRA 1S1XA 1YJUA 5K8OA 3MAQA 4C8LA 3HX9A 1D9AA 3J7YU 5KFDA 4U7UK 5F8JA 3DCAA 3GYNA 2WSFC 1AROP 2IRYA 1EETB 3BJYA 4NLRA 3CJ2A 3V4MA 2BQRA 3QIPA 5KG4A 2Q6BA 3NKYA 1N56A 1E6YA 1S0MA 3HHEA 1SV5B 1N5QA 2NPIA 4K4XA 1IBLF 1TL5A 3I4HX 3HVTB 4DJBA 5DDRC 2F4VF 1Z2ZA 3DRSB 2YNHB 4IQMA 2HHWA 5E41A 1LW2A 4R25A 4J9NA 5HLFA 1HD1A 3HHLA 3MTJA 5KFBA 3RB4A 2CJKA 3VTIA 4RW4A 1I1GA 3TVKA 3H5YA 2XS5A 3FRZA 3C46A 1FJEB 1NHVA 1U1LA 2FLOA 2KXFA 2KG1A 2VPYB 5GAEI 1H2TZ 2JOQA 2M70A 2JC1A 4TY9A 5CYMB 2ZHBA 3D1QA 3M2RB 1UJ5A 1ZM3A 2R7QA 2YKAA 3LGNA 3QYYA 4FF2A 5FLXY 2P9GA 1Z1ZA 2Q6CA 2WBRA 3TR5A 3DFEA 1R8HA 1B0PA 1TKXA 3G86A 4MKBA 3FSYA 4C8OA 3TRGA 1R89A 2XULA 3OTCA 2IVYA 3IGVA 3MGJA 1DJ0A 1KR4A 2FPHX 1FDNA 2E1MC 5KG7A 2FLPA 2VOOA 3NL0A 3V5RA 4IOAQ 1OQ6A 2I5JB 3KLFB 2PI4A 4LF9F 2Q66A 4R8UB 2W4DA 1FXLA 2RKIA 2ZH5A 1B0VA 5D8HB 4PCQA 2NS1B 1S1UA 4BWJA 1U6ZA 2FC8A 3W2VB 3WC0A 4DSLA 1IN0A 2V94A 3QWUA 5HN0A 1D1UA 1LW0A 1S99A 3PXGa 2Q3PA 1VQMS 4K4UA 4IYQA 4B3TF 6FD1A 1X4GA 2YH0A 2AJ1A 4IKAA 4GC7A 1PSDA 3CJKA 1XN9A 4IQXA 4RU9A 4QIEA 4A8XA 3MURP 1NK9A 1GTHA 2PI5A 1Q53A 1M5SA 1YGYA 2X51A 1QSLA 2OMLA 5A8KB 1UVIA 1RDRA 2RUGA 3GG0A 3OXLA 5HP1A 2OJ3A 3FCHA 2HHHF 3GQCA 4OZ0A 3ZZTA 2XZWA 2CKWA 3MM8A 3HM9A 5H9FJ 2XCAA 5CZVA 2KRBA 1WG5A 4RU2A 4B9LA 5B0CA 2LEAA 4DG1A 2C42A 1MMNA 2LEPA 5I3QA 3CCJS 2G0CA 1L3UA 1RKIA 2IRUA 3CD7A 1XR7A 4HI1A 3BDEA 2ZH7A 3M9OB 4LMZA 4ZP8A 2KXNB 3J7A1 2LA4A 2CZ4A 4O3RA 1LWCB 3O44A 1X0FA 3CDWA 2MZRA 4IH6A 2B56A 1UP1A 4LIRA 1KN6A 4EBDA 3CD0A 2J0SD 2B4VA 4C0BA 2RQCA 1NK4A 5IM0A 2DR5A 3PZPA 1DQAA 1FERA 2BBEA 3JAMY 5EDWA 4JI4F 3KLIA 3NNCA 2AU0A 3KLHA 1HD0A 2VFTA 3GFXA 2V9KA 5KFFA 1IKWB 2UUTA 4HYKA 4TN2A 3DRRB 1N6QA 4FP9A 1U2FA 2ILZA 1MU2B 4KHPF 4W90B 5J1NA 3OL7A 4ECXA 3EGNA 4IH5A 5EUHA 5KFVA 3TUZC 1SL2A 4E98A 1Q86T 1WACA 3IS9B 3BQ0A 1JJ4A 3LUYA 2R8GA 3OPKA 2R8HA 4NLGA 1KFDA 1GQEA 4HLBA 3ONQA 1FVSA 4DHVA 1VC6A 2KZZA 4Q0BA 3MMAB 3HHLD 5B08A 5J2QB 2B43A 4RW9B 1SIWB 2E29A 2VBWA 3SEOA 2WTFA 3BGRA 3RBDA 3IAS9 1D8YA 3MTKA 1HI8A 5LSRA 4NLYA 2B4PA 3MXHP 2L9NA 4QQBA 1OPZA 3CO9A 2YKNB 2MZSA 1D9DA 3C66A 4RZRA 4D3HA 2UVVA 2YKMB 1XMBA 1IKYA 3V6DB 2PMHA 3NRBA 3POTA 4G1IA 3T1YF 3MOZA 4JBCA 5M2RA 3UCGA 4YR3A 3CXCR 1K1QA 4CCHA 3DOKA 3ZFVA 1FJCA 2L3MA 3NNHA 3PKYA 2BYCA 2DNKA 2ZC4A 4MK7A 1X4BA 4PQAA 4CTAB 3EUNA 2IMWP 2RNEA 2DK2A 5KFCA 4Q45A 3SMZA 3GILA 5SUHA 2NUHA 3Q2SC 1H7WA 2V8DA 2VG5B 3BGUA 2BE2B 2DCUB 4Y3CA 3T5JA 1TL3A 4AE5A 2OMOA 1QAYA 4IR1A 1X4DA 3E2EA 4BHQA 5A6PA 3R5BA 5K8NA 4DBQA 3IAM9 4ES1A 4U67Q 4J9LA 2B0GA 2KM8C 4FS1A 1URRA 3OUYB 4DSEA 3LAMA 1L5UA 4KHRA 3TO8A 3C6UB 2ZKTA 1T94A 5D4LA 5BR8F 1Q79A 1X5TA 3NP5A 2CQ3A 2XI2A 2KTQA 2MSTA 3D54A 4LVOP 3UWTA 1GH8A 4YQWA 2MXYA 1VRTB 2GQQA 3M8QA 2KXHA 2FJVA 3FJ2A 1U1NA 4LT6A 2MJUA 3M6WA 1P27B 1S10A 2R7UA 1S1TA 1QSSA