5B0BA

Polyketide cyclase oac from cannabis sativa, i7f mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
92
Chain Sequence
b'AVKHLFVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 24
structure length 92
sequence length 100
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0bA00
1LQ9A 5A6PA 1X8DA 2ZDOA 1WD6A 2ACYA 2W4DA 2ROPA 1TUVA 5B08A 3IWXA 4Q2MA 1APSA 2KT2A 5B0GA 2XMUA 2AW0A 2XMVA 4OJ3A 2OFHX 2LQBA 4OJ1A 1Y9OA 2KT3A 4HI2A 4YEAA 1RJJA 4OJGA 3HFKA 1OPZA 2ASYA 3E8OA 2N4CA 1YJUA 1SB6A 1P8GA 4U9RA 2BUNA 3FMBA 2LXFA 3BF4A 2GFFA 2OD4A 2RU9A 3LGNA 1JK9B 3BB5A 3BM7A 2OP5A 1R6YA 2KKHA 4HH1A 4HH0A 2PGCA 1OSDA 2HLTA 2ROGA 2HIQA 1SI9A 2AJ0A 1QUPA 2GGPA 4Q2LA 2QYCA 3LO3A 2G9OA 3BDEA 1CC8A 4Y2IA 5B0CA 2HQIA 3IWLA 5A6WA 5KAKA 2GCFA 2HFOA 2PD1A 2BYCA 2GV1A 3HHLA 2XMJA 3DCAA 2OAUA 3MZIA 2RMLA 4FNIA 3CJKA 3HDSA 4OIXA 3FRYA 1Q8LA 1Y3JA 2W4CA 3HHLB 3CJKB 2HFNA 2L3MA 1P6TA 2K7KA 1TL4A 2QIFA 3QGPA 1CC7A 1FD8A 2QLWA 4F67A 1Q4RA 4NPOA 1VQSA 3KG0A 1KVJA 5K9FA 4A48A 2LDIA 2HLUA 1V3ZA 2IYIA 1MWYA 2AJ1A 2GA7A 1XBWA 2IFXA 1Q8BA 2JDJA 2K7JA 3KKFA 3TRGA 2VH7A 1N5QA 3LGMA 1AFIA 3I9ZA 4HI1A 5T7LA 1YJTA 1N5SA 1KQKA 1FVSA 1YJRA 2Q3PA 2OMOA 5T7LB 1S6UA 1FEEA 5B0FA 1YRXA 2N7YA 2K1RA 2GGPB 1OQ6A 4ZOSA 1AFJA 4EFAC 2K1RB 2KYZA 4Y2KA 4QOTA 2FB0A 4A46A 1GXUA 2FHMA 1FESA 3HF5A 1TR0A 2ZDPA 2EW9A 3HX9A 2OKQA 2XMTA 4FNHA 1CPZA 1VQYA 1S6OA 5B0BA 1FE4A 1FVQA 2FTRA 3HHLC 1W2IA 3QMQA 3FGVA 1ULRA 1X0PA 1MWZA 1GXTA 3BN7A 2OFGX 4Y2MA 3HHLD 4A4JA 3T9NA 3TOQA 1KVIA 2AP6A 1U7LA 2OD6A 1IUJA 2RSQA 3WDOA 3F44A 5B0AA 2IYGA 4OJHA 1YJVA 4HL9A 4YDXA 5B0EA 2N4DA 4ZA1A 1X7VA 1SQEA 2CRLA 2BBEA 3KG1A 1Q53A 2LQ9A 3UDCA 2ROEA 3DXSX 4DPOA 5IXUA 1K0VA 1N5TA 2XMWA 1AW0A 1TL5A 1URRA 5F0UA 1FE0A 1Y0HA 5F0WA 3KNGA 1N5VA 1Y3KA 2FIUA 2QLXA 2BJEA 2RILA 2XMKA 2XMMA 4NL5A 4A47A 2VV5A 5B09A 1YG0A 3VTIA 3BR8A 4DN9A 2GO8A 2K2PA 3K7RA 3MCSA 4DL0C 1JWWA 2W4PA 2BJDA 3BGUA 1OQ3A 5B0DA 3TNVA 1TZ0A 3GZ7A
chains in the Genus database with same CATH superfamily
2EWHA 2DY1A 4CLFA 4CNZA 2CAJA 4X4UA 2KHCA 5E3CA 5KFFA 1G6BA 4U96A 3QZ8A 3IRXA 2YY3A 3O2IA 4X65F 1NPRA 3LOUA 1P1TA 4F50A 5J2PB 2XHCA 3VR1A 2CJ9A 3FKBA 3CDWA 3HPOA 3KHGA 2RDJA 1GTEA 1M1KT 3LF0A 2MKCA 3GP9A 2BE7D 3C6UB 2IDEA 4CQ1A 3KUGA 3IP0A 1RAEB 1NK8A 1UAWA 3ULHA 3R7SB 3TJ9A 1J5EJ 2QJ3A 5HL7Q 2F63A 3FUYA 4ZP7A 3R5AA 1W2IA 4FBUA 3DNCA 1F1BB 5KT3A 3F44A 2ILYA 2C28A 1XQIA 5C25B 4CM2A 4D3HA 4DV6J 4LF9F 4J9MA 1LNQA 4EWTA 2MQNA 1IWAA 4O4GA 2M2BA 1RAGB 2MGZB 3BKTA 1S6PB 1E6VB 3W63A 4DX5A 4OJ3A 4HT5A 4DCPB 4LF7F 3KK3A 1HQ2A 2JVRA 1UWBB 2ZOMA 2OPSB 3G4SS 1R6YA 1HW9A 2HVIA 5AJ3F 4R8UA 4Y65A 1Q78A 2VC1A 4MIAA 3OL7A 4F3OA 4FNIA 2B5JB 4F4AA 2V8HA 1QE1A 4NPOA 1F9FA 1WTBA 1WDTA 1SH0A 3BGLA 1RT6A 4Q5VA 2Y1IA 3IS9A 1GTHA 3SQGB 2HNDB 5KT7A 3D5MA 3DN9A 3D0GE 5EWGA 4LF5F 3H0PA 3CCES 4ZKAA 2OELA 2W2NP 4DZDA 5IQQA 1NK0A 3BN7A 3MURP 2MY8A 3J7ZT 4EZ6A 1AZSA 1Q82T 1AUSL 5F8IA 5B0DA 5MAOA 1WELA 2GIQA 1WD6A 4HR2A 1S7HA 1UEUA 3HJFA 1XMOJ 4L3KA 3AD7C 1RHUB 3ZZRA 1HD1A 4OMFG 2BR0A 2HFZA 2LQBA 2DEJA 4QQBA 1X4DA 5JUMA 1CS4A 4LIWA 4DSJA 3D67A 3H5UA 3KUEA 3ENVA 3PM9A 2LA4A 3RR7A 2HLTA 4Y2IA 4F0KA 3VV2B 2ZH6A 2HFNA 3RAMA 4M5LA 3QGPA 3C6UA 1B4SA 4C3LA 5HP1B 4LFCF 3ZC4A 4B3SJ 4FXVA 4WFBQ 1FESA 1KVKA 1UJ5A 1OY8A 3BZQA 5CYMA 1MLAA 2E5LF 2W8LA 4AYBD 5EWEA 4DV2F 1WF1A 2GMLA 5KFQA 4XK8C 3HVTB 3RU0A 4OLOA 1B0VA 5C25A 1JLEB 4F2SA 5KFDA 1E6YB 1RBOB 2GX8A 4DR3J 4K8RA 2HKEA 4OYMA 2JOQA 4NLQA 1T0TV 1Z1ZA 2MZSA 3G6XA 2DB1A 4B9NA 1OS5A 2J0SD 3RB0A 2CPXA 4PYDA 1UWBA 4DSFA 1HBMB 2ABYA 4EU0A 4OZNA 4K2JA 3QFWA 3KHLA 2KJVA 2C3MA 2GGPA 2PO4A 1RWWB 2B5JA 4F26A 1TKTB 5KAKA 1HW8A 4FPIA 2F9JA 4ZVPB 2JVOA 2EC0A 1LWCB 4J9QA 2HNDA 4YUDA 1U48A 1BMQB 3TX8A 3S6EA 2MKKA 2MQPA 3D0HE 2BJ8A 4DPWA 1KLNA 2DXEA 1RWUA 2A0FB 5KFVA 3I55S 1RHMB 1PIEA 3C16A 2DHSA 4ZITA 3V81B 4OL8A 3OPKA 1FKOA 2O01C 4LRBA 2EKYA 3ZTSA 1U2FA 2GZOA 4K4VA 1TZ0A 5CZVA 2ACYA 1H2UX 3V4MA 5E41A 1S76D 2DR8A 5JVHQ 3MD1A 1ROFA 2KDOA 3ZTRA 5HMYA 1PKUA 2IVFB 3OUYA 4N8NA 5KT2A 1WHVA 3AOCA 3FCWA 3CD7A 1LFWA 3M05A 4URGA 4LBPA 1PJ5A 2MZQA 4CLYA 4Q8EA 2KM8C 5HP1A 2AJ1A 2MTLA 1W2BR 3EDRB 3UNGC 4NEYA 5ETOA 2CPZA 2HSEB 3DC2A 2PFFB 2K1RB 1SH2A 4QIGA 4IO1A 2NPFA 1VBKA 4RUCA 3SFGA 4Z37A 2UUAF 2UXBJ 3DHXA 4U67Q 5C42A 3H4BA 4PXCA 1VK8A 1K47A 3UD5A 2MHNA 5J2NA 1JLEA 4ZIVA 5AE2A 2BBEA 4DCJB 1X4AA 1N5VA 2GMHA 4RNNA 5GAGU 5LMUF 3H40A 2ZKUA 3IBFB 1R0AA 2XY7A 2L41A 4EI2A 1VRUA 3P5BP 1HBMA 2HS0A 3QIPA 1EJ7L 1NUEA 1TAUA 3OFHA 3QGGA 4QYRA 3ISND 1S10A 1RTDB 4JI4J 4B08A 1LWCA 4YB5A 4QW8A 2MSSA 4O3RA 2CJQA 2AEFA 2CPJA 3CDEA 4WK3A 2ZHAA 2G0IA 2BX6A 2HRYA 3SMZA 2W9BB 1QAIA 2OO4A 4OZ0A 4OYBA 4H4KC 2FJBB 3UW1A 4M5HA 2GIFA 3EGWB 3PFOA 1MROA 4CLTA 3MDFA 2OFGX 4A8YA 4OV1A 2BW2A 4ZMMA 1FXLA 2V8GA 1XC9A 3JTPA 3V81A 1RT1B 1X7VA 2OPPB 2DR7A 1OWXA 4JP8A 1R0BG 4IRKA 2XWYA 3M6WA 3QT8A 3PO4A 1PILA 3E3XA 3DM2A 4PEOA 7AT1B 1GAOA 5E3PA 3BO4A 4J5OA 2KFYA 2EK6A 3DRSA 1MU2B 2CQ2A 4ZPAA 2MMYA 4Z2XA 3ISNC 3MMAB 1HYSB 5KG6A 2PEBA 2AYMA 2XCAA 4J37A 3CUNA 4HHHA 1WI8A 5CAAA 4A8XA 1CC7A 4HACA 3DMJB 4KB7A 1M5SA 1RGVA 1YJTA 1FJ7A 4F8RA 3GJTB 2HBYB 3MPYA 3UR3C 2FD2A 5DDPC 2K1RA 4HHUA 3W5XA 3SIPB 4IOAQ 1LKZA 1U6BA 2X3GA 3QMQA 2BKPA 5B0AA 3AFGA 5H9FK 2W7PA 2GC8A 1SL2A 4X4PA 4Y6IA 5M2UA 1C0UB 1RAJA 5ETTA 1B7FA 2KXNB 1NK4A 2B8PA 2FUG9 1AB8A 2HNZB 4LIRA 4MH8A 3NEKA 3TA1A 4C3KA 5IT0A 2BJ1A 3W60A 4JI0J 1SJ1A 1SV5B 1RTDA 3CCVS 5CD4A 2L9NA 2QE5A 3TJ8A 1DTQA 2K7KA 4DV4J 1WG5A 2PE8A 3AB2B 2PI4A 4DQRA 2VG5B 4P10A 2HQ3A 4QPXA 3KDNA 2Q3PA 2OMOA 3UN5A 2VA2A 3IGVA 2QL7B 3UN3A 4NXMJ 2MJUA 3BYRA 3BPSP 3I5AA 2RRBA 1ZAWA 4K4YA 4B9VA 3HHNB 3MTKA 3BKFA 3RW7A 2DR6A 2AIRB 2XS2A 1RKJA 3FBEA 1RT1A 2OPPA 2F8EX 5GVQA 4MTPA 1TL3B 1NSPA 1Q16B 5IWAJ 4DL4A 3CIMA 1EQMA 2NXJA 4DR6J 1KBRA 2FJAB 3FSYA 5IC6B 4NLVA 1OQ3A 4QYZJ 2XYPB 3EWGA 1LW0B 4EUVA 2KRBA 2V9WA 5A8WA 4KGZB 3MCNA 4RU2A 3ZZUA 2HRUA 2W2OP 2G13A 1QSSA 3KJVA 2NPIA 3JSBA 4WZQA 3QT5A 2FVSA 3KLFB 4U8YA 4DQSA 2I8EA 4C97A 2DNYA 3MXHP 4LSLB 5K8MA 1M5VC 5K8PA 2VBYA 3N6NA 5DDRC 2EI5A 3W9JA 3N5FA 3CCUS 2R7XA 1ZA2B 3M6VA 1I5OB 3OT9A 2N3OA 1N5SA 5D6GA 3ZO7A 4C0OC 2MKSA 3IM8A 2CDRB 3M9OB 3RG6A 2J76E 4A46A 4GMKA 3GTYX 2G1HA 1T9YA 2ZKTA 3CC7S 2ZD1A 4DV1J 2M5YA 4JYAJ 3K5OA 4MIWA 5KG7A 5C7PA 2Z8QA 1PYOB 3HKZD 3W65A 4RWWA 3US5A 3ETMA 4CT9A 4U7CA 1KQSR 4YOEA 4YS2A 1FWKA 1REVA 3WBZA 2VL1A 1S0VA 5J2MB 3JSRA 4CP5A 1C0UA 1N4LA 4ETZA 3MGJA 1DLOB 3BJYA 4I4BA 4JI8F 3QBCA 2HNZA 3D6MB 3DRRB 1HQEB 3K58A 4USIA 4TYBA 2KKHA 1F9HA 1NJXA 1NDLA 1SV5A 2XZDB 3ELHA 5D78A 3A8EA 4MK9A 5FJ4A 3QSYB 2DNRA 1AFIA 2VG5A 3TRGA 2XGQA 1XBWA 3HM9A 2HGNA 3S8SA 2YX1A 2YNFA 3DYAB 4USKA 2UXDJ 2DNLA 3ZZ0A 4FS2A 4A8QA 1WJ9A 3NLCA 1F5CA 3SYZA 2D3UA 4GC7A 1VQ8S 2QTWA 4RX6A 2ZH4A 3C8YA 1H38A 4DUYJ 2HG4A 1WOPA 1BE4A 2I1RA 2ZUGA 3PTWA 1LW0A 4DV7F 4O3PA 3T3FA 2YKMB 4OZ2A 2ZVIA 1N32J 2OFHX 5KG4A 1GNKA 1FERA 1I94F 1IBKF 4HI2A 2MQ8A 4IKAA 2XBPA 4FF3A 2XS5A 2DJWA 4NE9C 4CZCA 2IBKA 5LSOA 3MFIA 2DITA 4LSLA 2IJFA 3DKDA 5BR8F 2RMLA 4OYIA 4CO0A 1UVKA 1RAOA 2DIVA 1W25A 2P5VA 2M0GB 3U1MA 3M6XA 5GAGI 1XNRJ 1WUUA 4UT4A 4F36A 1YQHA 4WFZA 3BV8A 2GVZA 3FCVA 3HP6A 1X4HA 3P49B 9ATCB 3F41A 3LPEA 2GVDB 4DPXA 2B4VA 4JOUA 3LUYA 1N0UA 4EYHB 2ZZTA 4H4OB 1S9GA 5ETLA 5J2MA 3MEDB 1FE0A 3CJ3A 3TAMA 4AL7A 3TQ1A 2LMIA 1VBXA 1DLOA 3RB4A 1JNZB 5B08A 3AXKA 3M8PB 4R25A 1NK9A 2YNGB 3RB6A 3PCOB 1QAYA 1BUXA 1YJ7A 3KYLA 1HQEA 2ASYA 4JI2J 2NXNA 3F73A 4XAKA 5HK4A 2MEWA 4WP9A 3CJ2A 2LQ5A 2LU2A 3D4JA 1Y5NB 4DV3J 1U45A 3GG0A 3CIZA 2KL8A 4X4VA 2XSFA 2Q66A 1YSJA 1KP6A 3DYAA 4ZOSA 1PC4A 1F2HA 3H20A 1F60B 1WG4A 4CNYA 3R2CJ 3UWTA 1D9DA 1PYSB 1HWJA 1M1HA 3TJAA 3TUJC 2B4PA 3HMJG 2JZ5A 3CULA 1Q7YT 5G0RA 3H4DA 5GADI 4ZN3A 2LQ9A 3IR7B 1D1UA 1U1PA 2OLWA 3UD3P 1RLCL 1OJ4A 3MEKA 1HFEL 2K3IA 3K7RA 3OVBA 4NLUA 2YKMA 3GCWP 4ZPCA 5D77A 1V3SA 4CH0S 4P73A 5B0GA 1KHWA 3PEHA 2FC8A 2UXCF 3FBFA 5F9NA 4QR1A 4DV5J 3LW5C 2AT1B 3BO3A 1TELA 3GE9A 4OX7A 5A8RB 3IWLA 5G4DA 4O3OA 4WU3A 1K8AT 3MPVA 1YIJS 1S49A 4ED2A 1R8HA 1KVJA 2J5AA 3JSMB 2QFIA 4OZJA 4B3TF 2KZMA 2E5GA 2Y9HA 1D8YA 1U0HB 3RTVA 3HVRA 2RD5C 3QAEA 1EKRA 3MEEB 3K0JA 1AUDA 3KHHA 2DRDA 7FDRA 4ENOA 3SDEB 3M9MB 1T11A 3SV4A 3WDOA 3QZ7A 1UEKA 4RNMA 4H4OA 4RKUC 3MEDA 3SEOA 4K4TA 3BSOA 1RAFB 4DDFA 1UVJA 3DCAA 2V8VA 2QMWA 3M8PA 3HHEA 3BBFA 2YNGA 4B17A 1MSWD 1TU0B 1CJVB 3KUHA 3TR5A 3P45B 3NOCA 3RUBL 4NLXA 3UCGA 4PUOA 2C2EA 2LKZA 5T14A 3BR9A 4WP8A 3BEGB 2OAUA 1NZ8A 2Z56B 1FTRA 4CWBA 3I9ZA 4EMDA 1S0OA 3ILLA 2U2FA 4C8NA 1JLGB 4K4UA 2DH8A 4NZ7A 5K20B 3EVOA 4ZP6A 3R5JB 2ZM6J 3CCMS 2D9OA 5AXKA 1CJKB 3QGHA 6AT1B 2OPQA 4C11B 3PIOQ 1X5OA 1KFSA 3PR4A 2CNKB 5JVGQ 4OI1A 4NLWA 4Y28C 1B7YB 2BW7A 3L7PA 4UOHA 4FXWA 1X9SA 4J9NA 2I5JA 1U49A 1YI2S 2WSEC 4ALZA 3T1AA 1NPKA 4IR9A 4JI6J 2BM0A 3T1YJ 2AU0A 2F8MA 3TUPA 3JSYA 1FRLA 1KSPA 3W9IA 4P74A 2DGVA 1SB6A 2J9CA 4ES1A 1VHIA 2W24A 4TNOA 5DRKA 4YY3F 5A8RA 5DQHA 3F56A 1Z2ZA 3HD1A 1N6QA 5A2QU 4WXOA 1BQMB 5A2QY 4L72B 1ZOTA 2QLWA 4EBCA 1VQ5S 3G8QA 3LWLA 3ILIA 3CD6S 1U0HA 1GMUA 4KPCA 3JQMA 2CQCA 1FRMA 1P9YA 4LF2A 1ZPVA 4DU7A 1MWZA 3OQ2A 1S4FA 4DR4F 4GO5X 4AQYF 4NXNF 3O1LA 4P2SA 2XLIA 4KH0B 3QAUA 3T1HJ 3L7OA 9RUBA 4KO0B 3PYFA 4RW4B 3TANA 5L1JA 1QJHA 4WE1B 3VGTA 3W7BA 2C2DA 2P6TA 3MM7A 3ADAC 3OJUA 2OTJS 2ZFHA 2FZKB 1CJVA 4M5GA 1BY9A 3OTBA 5LL6d 2WSFC 4OZ5A 2RU9A 5D0EA 3LA0A 2G9OA 3CJ4A 2VU5A 2DHAA 3W2WB 3GFHA 4NCBA 3GONA 1L5UA 1DRZA 1G4CA 3PG9A 4BWMA 1H73A 2RQ4A 2Y1LB 4W90B 2VH7A 4RPFA 1FJGF 1FVSA 3GMGA 2I38A 1VIOA 1JLGA 3VAIA 1L3TA 3MTJA 4PWDA 2DGUA 2G0JA 4U7UK 2BANB 2ZVSA 4M95A 2HZCA 4RW6B 4DV0J 1CJKA 2IIHA 1C2PA 4N41A 4DZ6A 1IUJA 2RF2A 2PMZD 4C11A 4IFYB 5KFBA 2VQEF 4OZLA 1GH8A 4ECTA 5J2QB 1K0VA 4WFXA 2WW8A 3BPDA 4QCLA 2E29A 4KE5A 1FWLA 5L38A 4YR3A 5ETVA 4ED1A 1JJCB 1FRHA 1SJRA 3H90A 3CW2C 5EX3A 3DDKA 2YNIB 4ED8A 2WTFA 4C8KA 5D0HA 2M3DA 2XHWA 2F1FA 1JLQB 3CCSS 2D3OR 5GMKa 3V4IB 1KLMB 1OSDA 1VMBA 1K0TA 2R2TA 1SH3A 1TL1B 2XMJA 1VQ6S 2VPXB 4RBTA 2F65A 4YB7A 4OYXA 2BKNA 4ECWA 3N6LA 1SKWA 2HLUA 3J81j 2B9EA 1YJRA 5J1EB 1SC6A 1A9NB 4JI3J 4JV1A 1VQ9S 2OI2A 4DHVA 1T3NA 1FDDA 1B0PA 2U1AA 4NLTA 4IO9Q 4ANEA 3L9ZA 3QWUA 4KO0A 4OZ1A 2WRMA 4RW4A 1S79A 1RAIB 3TI0A 1U1MA 2Z2MA 1ZZFA 2YH1A 4F3QA 1T9TA 3VZHA 3I56S 4NMXA 2FLOA 4B9UA 3PJXA 3FMWA 2V63A 2P6SA 3CEDA 3DLHA 4W4MA 2AV5A 3DXBA 2CA9A 4RLEA 3ZFVA 4TU9A 3T5JA 1U1QA 2EFVA 4Y3CA 1T03A 4TKTA 4ER8A 2WONB 1ZPWX 3W2WA 1V9OA 4F4XA 4G1PA 2GJFA 2FJXA 4A8WA 1UJ4A 2N82B 5CD4H 1U8WA 2UUBF 3MMCB 5K14B 2MY7A 2VBWA 2EKNA 3R7BB 4X84A 2AGPA 5D4LA 5H9FJ 1RB0A 4OQJA 1VQYA 1R27B 3FJ2A 1FD2A 3S1TA 3D6FB 4OJHA 4X62F 3PXGa 2R8GA 3DXSX 3R97A 4N5SA 4K59A 4LSZB 4JI1J 3LAMA 2BJDA 3UCUP 4KY3A 3C46A 4H54A 4K0KJ 4PG7A 4PQUB 3RB3A 3Q89A 1KC8T 3V4IA 3ZTQA 3BBBA 2JSXA 4AT1B 5KFXA 2Q43A 3EYZA 2HAIA 4DPTA 2J8AA 1UWAA 2IJRA 1LWXA 5EDWA 3MR7A 3OTCA 1EX8A 5AE3A 4OHVA 5E3RA 5HJYA 2C1EB 3GJRB 1JJ4A 2OEKA 4OFZA 2VOPA 4L75A 3FCHA 3TZYA 1L3VA 3KK2A 4YB6A 4O0NA 5ADZA 5HO4A 4ZPVR 3QJJA 4B3OB 1EP4B 2J0QD 2H3EB 4LJMA 5CCMA 5LMNF 2VBXA 5LJ3Y 3NGKA 2KXFA 5KFUA 4KHRA 1RT2B 2C2ZB 4USTA 3I87A 1O0PA 5KG2A 1SL0A 5BYQA 3W66A 3G6VA 2F4VJ 4K5SA 3V6DB 2DD8S 2UU9J 1PBUA 3CCZA 3K17A 2H9ZA 2EXUA 5HJXA 2GAGC 5C5JA 3LGHA 1NSQA 3LO3A 1MN9A 2AD9A 1HPZB 2J6TA 3OV7A 2JEIA 2QSFA 2R4FA 2JDJA 3BSAA 5EHHA 2AQ4A 1UMJA 3LGMA 4OV6A 1NRKA 5LM7E 2M70A 2NS1B 2CPHA 2AWZA 2Y1JA 1RT7B 2CQ0A 1TK8A 1Y00A 4X65J 2P2CB 3NS5A 3DFEA 1D9AA 2K8GA 2BDPA 1CEZA 4URSA 2YQ1A 2AGQA 1OPIA 1RUSA 2WBRA 3CO9A 1EETB 2VFUA 4HEA9 3IM9A 4JI5J 4Q2MA 2Z2ZA 2QRRA 2GQCA 2L48A 3M4XA 3TZZA 2QLBB 3H2UB 2VODA 2DR5A 4LFAJ 3L4BC 5IZHA 4GKJJ 2E9RX 4CO5A 4YN3B 1S1TA 3FEZA 2W25A 3HDSA 2ASDA 4LF9J 2GS8A 5KFRA 1CLFA 4OI0A 3VAJA 3BYPA 4RJVA 1NH7A 1RTJB 4I68A 4UZBA 2BJ3A 2R7TA 2QSWA 1N88A 4CM0A 2YWGA 5KT4A 3B4MA 2HFVA 2MKJA 1FE4A 4PWUA 2VBZA 4DFMA 5AJ3J 2E5JA 3MHYA 1NKBA 3GQCA 2YWHA 2VUGA 4DR3F 3HD2A 3HFZB 1X4BA 2DXDA 2XSJB 3J7Z5 2O3DA 3HVWA 3DLEB 3DGPB 1URRA 1KDNA 4M5JA 5DG8A 4FYWB 2KN4A 4O44B 2W4PA 1FKPA 3P4UB 1SJQA 2UVUA 2MZJA 3B4DA 2XYGB 2QLFB 3IR6B 4L6V3 4OJ1A 1N0VC 3TVZA 5F8JA 5HVFA 1HBNA 2H4YB 2DCUB 2IAJA 3U1NA 2MQLA 2RHQB 1RYSA 4QIEA 3VAFA 3IAS9 1MMDA 1HPZA 2QO3A 3EM1A 1UPMB 3GCXP 1T9UA 3I6PA 1U1NA 1URNA 2XMAA 3KXDA 2RDIA 4HHJA 2JH3A 3MM9B 5HANA 3HVAA 5FLXU 4FPRA 5JMNA 2HNYB 3P5TL 5FLXY 2RS2A 4NLSA 4LQ9A 2BRLA 5KFTA 1RT5B 4AL6A 4DUTA 2V50A 2E9TA 2FY8A 3AOAA 1U02A 3IBWA 1X0PA 2VG6B 4R5PB 3E01A 1IKVB 2V34A 4C98A 3R5DA 2JL9A 2IM1A 1SQEA 4CLLA 3EPGA 3SSRA 1EB0A 1IKWB 1EETA 3QO9A 3SBMA 1KONA 2CXEA 4IG0B 2ZH2A 1UJ6A 2VA3A 3M2RB 3EX7B 1KNZA 3HHDA 5LSRA 3CDAA 3OL9A 2DKOB 2E5LJ 4J9VA 3NY0A 5L1KA 3BH6B 3DDIA 4DV2J 2FZGB 1JLFA 1NAQA 2IVYA 4X64F 1JLBB 3M8RA 2OIHA 4ELUA 4Q2LA 4MAKA 5L1LA 1VGYA 2GV1A 3HHLB 4J90A 1XMQF 3LANA 5IC4B 2CFXA 2XNRA 4ZPBA 1IBMJ 2D3O1 3CTRA 2NQPA 3UNYA 2CDQA 1RTJA 2MKIA 2WVBA 2R7RA 3WX8A 4EFAC 3D1QA 4GVLA 3JB9k 2HEKA 3CPWR 1UW9A 4ZLPA 3R9LA 1D8ZA 4ZJLA 5ETKA 1S12A 4RW9B 3O8WA 4QW9A 4O3QA 2DGQA 1XN9A 3JAMU 2ZOGA 1DAXA 4O23A 3AD8C 3GPAA 1HHQA 5F3ZA 3DLEA 2N4DA 1CQNA 1G3OA 1HQUB 1VHFA 4O44A 3K5PA 4USMA 3QLHB 1S7IA 2HAFA 1LQ9A 2UZAA 5B7WA 4LMZA 5KFGA 1WC6A 4IDKB 2EFQA 1JQGA 1S0NA 1NEEA 4JI4F 3BKUA 2OSRA 4FKXA 3SXLA 4FF4A 2E7XA 3AA9A 2E5HA 4URQU 4LF1A 4TU7A 3TA0A 2W7AA 3VAGA 4ZHRB 4J91A 1UKUA 4B02A 3PEJA 4EZ9A 3TWZA 2ZBIA 1NKCA 3NMAA 2NSCA 2LVWA 2YKNB 3GSIA 2V2VA 1HBOB 2DK2A 3NWRA 3R5BA 2LECA 1FFGB 3O6QA 1RT5A 3B6BA 5HVGA 4WIQA 1IWGA 3X3UA 3PX6A 1PJ6A 1YKWA 4R5PA 1FXRA 3LAKA 3LP1B 2O5DA 2GAHC 3KLEB 3DU5A 4CIOA 1VC0A 1Q8IA 4NCGB 4NRUA 3PRDA 2B9XA 2HWTA 2KJWA 3TUZC 1OIAA 1HI8A 5CA5A 4PCQA 2K2PA 4IG0A 2BMBA 3FQKA 2HMIA 2BZ2A 1HNXJ 3M2RA 3K5LA 4QWDA 4ZLNA 4YEAA 4NASA 4V19X 2GFFA 4KV8A 4UF4A 4NLDA 1SKRA 4MK8A 4OI2A 3LQVA 1M0SA 1YK9A 4K2XA 3HHLA 3PKYA 2HBRB 2E1AA 1SC1B 1Q1KA 1HI0P 1P6TA 4F67A 1VQSA 4AXJA 1LWFA 4EBEA 3MAAB 1NMEB 4OI3A 2F3JA 5LMUJ 1SJFA 3GFXA 1VQPS 2W2PP 2N7YA 3R27A 4ZJQA 5DQGA 4DR7J 1F9EB 2ZH3A 2VC0A 2AZ3A 2R7QA 1S59A 3I5BA 3RR8A 2AEJA 2GQ2A 2E1PA 4N7TA 4I6AA 2KB2A 2ZC3A 2DNMA 1HARA 1U7LA 1HBUB 2KG1A 3NGTA 4I2PA 2FJWA 2YTCA 4EK2A 4E0DA 4H4MA 6FD1A 4ZLLA 2FC9A 3KNAA 4RBVA 2VKRA 3AODA 3M8QB 5K8NA 5CZXA 1SIWB 3AHPA 1GX6A 3LWMA 4IDKA 2C42A 2YWFA 1YJNS 1SXLA 1HNZF 4JI0F 3R1HA 2DNOA 1QSLA 3P96A 2PI5A 1S1XA 2ZBPA 4ICLB 4C8MA 2P9CA 3MMJA 4HH0A 4MIBA 3TZXA 4MT1A 3BDEA 2P8IA 1XMBA 2HS3A 4DWIA 2MXYA 3PIPQ 1NKEA 3PHEA 2YKNA 2HBQB 4QWBA 1NCLA 1VYAA 1B99A 1JLAB 3O44A 1R8BA 2FDNA 2DTJA 1TV6B 4B9TA 3RZAA 4KKOB 1N34J 4GRSA 4MYUA 4KR0B 4C8ZA 2NCKL 3LP1A 2DHXA 1ZETA 3KLEA 2BOPA 4NZ0A 3W1YC 4NCGA 1QY7A 1IJEB 4IFVB 4QPTA 2Z30B 1SQFA 3SSSA 3MEGB 2XO7A 3SCKE 4ATNA 1NSAA 3JTOA 2UVRA 5E5NA 3BBCA 4CDIA 4TU8A 3PW2A 1PBAA 3BO2A 2IA0A 3LGNA 4TYAA 2ZH5A 3NS6A 4ERDA 3UFCX 4UY85 1RP5A 5D15A 4LVNP 2IM2A 3MZIA 2ASLA 3G8TA 4RNFA 2AKWB 4NYOA 2DRBA 2BVZA 3MAAA 4KAIA 4KH1B 1SIZA 3W5ZA 3PYEA 4JYAF 3DOKB 3A8JA 3IAM9 2DXFA 1YRXA 2B4OA 2ZC4A 2WVFA 3M8SA 1T94A 2DO0A 3BQ0A 2OH2A 2XCPA 3FZBA 4CLPA 1R6VA 2ATCB 2KRRA 3OTOF 1QAXA 2ADBA 4UOFA 1DJ0A 3W3SA 1HBUA 1AROP 1GMVA 2A1BA 1VQ4S 1S1UB 1U09A 2E1RA 4CYUB 2BJEA 4DEZA 1UVMA 1CBKA 1Q8KA 1WC0A 2F5GA 2APOA 3K59A 3EZOA 1AYEA 4PQAA 3JTNA 3AJ2A 5KT6A 2CZ9A 4USHA 2KT3A 1RKIA 2GMJA 5LXRA 4ICLA 3GJQB 2W7OA 4PG6A 4NX9A 3DGVA 3PJ9A 1QTMA 1MN7A 1MG7A 1A7GE 2VDHA 2B3TB 2XULA 2ZJQQ 4LFBF 4DFJA 3K57A 1KQFB 3CE8A 1UTAA 5H9EK 2RS8A 1C1CA 2OTLS 1Q8LA 5L46A 1QVFR 3OBIA 4HLBA 4HVZA 2UXDF 2FY1A 2W2QP 1FF2A 2V8DA 2RKIB 3ZZPA 3AY0A 2MLXA 1NPPA 3MM6B 1IR1A 4KKOA 4OX8A 5E2QA 4JV5F 4PG5A 4OX6A 2V4JA 1CPZA 4I69A 3R6LB 4ID8A 3UDEA 4M5MA 2IYGA 1RBLA 2HS4A 2OJ3A 5IXUA 1NBEB 4X66J 1N32F 4P2MA 4ZVUB 2EVZA 2V4QA 2L9WA 1WEYA 4CLSA 4BS2A 1YJWS 2AJQA 2FPHX 2PEHA 2ZWOA 1U2CA 2C3PA 4HT7A 1JKHB 4P2XA 2YKOA 1QUVA 1Z4UA 4M5IA 4F4YA 4J9SA 1UVLA 1YJUA 2OD4A 4DS4A 1XR5A 3W9HA 1YBUA 3D6TB 2QFJA 2X51A 4IUFA 4RUAA 1Y3JA 5BXIA 1R43A 3EXYA 2WW4A 4KGMA 2CVEA 2VHGA 3DOKA 4G1QB 4ANCA 4MKBA 4DFKA 4USWA 5IV3A 1KTVA 4JI8J 2OPRB 1CG2A 1TMJA 1H6KX 1L3UA 4ILRA 1AFJA 5AXNA 3TAPA 3EE3A 1ZTWA 4AUKA 2VFSA 3UD4P 2C2MB 3A4TA 2CADA 4L76A 4WFYA 4Y34A 4OHZA 3P3DA 4CYUA 1DQAA 3DLKB 3N28A 2N7CA 5LOQA 1ZZNA 4JI2F 3OXGA 2JC0A 5J2PA 2JX2A 2DT9A 2V8PA 5MLCV 5DETA 2WVCA 1B3TA 4DV3F 1WC3A 3IRWP 1EARA 1UVNA 3EZUA 1N33F 1IJFB 2PC6A 4YFUA 3VZIA 2BV3A 4DFPA 4ILMA 3AH6A 2HFOA 5KT5A 3AT1B 2CQDA 2YWWA 2XG8A 1IVZA 3Q86A 1LK5A 5CQGA 3A3PB 2F4FA 3C66A 1JB0C 1TKXB 5IT9U 1Y10A 2GJIA 2RKIA 3IR5B 5ETPA 1QSYA 4HYKA 2HHSA 4YQWA 3FBCA 1TFWA 1IKXB 3MM6A 1IBKJ 4Q0BB 3JS9A 4FXDA 2J9EA 3Q8RB 2I2YA 3A12A 3I4PA 2MGZA 5KFLA 2JNJA 1S6PA 1E6VA 4EO6A 3NCRA 5IV4A 1RWVB 3FSXA 5D0RA 3TARA 2YH0A 3Q22A 2XEXA 2OPSA 3OFFA 1ZS6A 1JIHA 2XM3A 1XNQF 1W26A 2QEXS 3H5SA 3K2YA 3QPIA 3MUMP 1TL7B 4MKAA 1U6FA 1T9WA 4GKKJ 3GYGA 1EIYB 3SQGA 2JRSA 2ZJRQ 4C8LA 4QZVB 2ATLA 4NWBA 2A10A 5I3UB 4FN5A 3T19A 3KK1B 2MSTA 2QV6A 4QIVA 3H8YA 2FJDB 3OSPA 5DJBA 3CJTA 2UUCJ 4F25A 1CULB 3ILOA 1ZAVA 4G1QA 3PDNA 1MWYA 2IM3A 3IGNA 5LXYA 2OPRA 4OZ3A 2PA8D 3TA2A 4M94A 3D28A 3V2UC 1GXUA 5GAHU 3S01A 5ETSA 5AXLA 2IMWP 2NREA 2EEYA 3HHLD 1CJUB 3EVWA 4MK7A 1S1VB 4IOCQ 5KFMA 2HWIA 4DJBA 2VJUA 2M9KA 2CNLB 2ZUAA 2QLXA 1OYDA 4K4SA 4A8KA 2MLYA 5IM0B 3MR5A 5BYSA 3MD3A 3Q23A 2G1DA 2HZVA 4I2QB 2Z2YB 1FJCA 3FEYB 1KD1T 2AW0A 4LR9A 5KFJA 1A6LA 4EYIB 3OHAA 2ERRA 2LCWA 2CQIA 2XZWA 3IWNC 2Y0BB 5DLGA 1HWUA 4K7QA 1X5PA 3IBCB 1ICEB 2ZHOA 5F8HA 3THPA 1NLKL 4O3NA 3CCRS 4U7UD 3M2UB 4E8UA 1IKXA 3JQJA 3ONQA 3HVTA 1UL3A 2UXCJ 2R8KA 4IH5A 3W64A 4ZVHA 1KTQA 1E6YA 2AJFE 3R5GA 3M7VA 2O67A 3NS7B 3HHLC 2WBMA 3PV8A 2CQ4A 4PRFA 4FBTA 2F9DA 1C1BB 3D7SB 4CO3A 4ELVA 2B51A 1QLNA 4FYXB 1X4EA 2XTJP 2VONA 2D9PA 3T1YF 4CCHA 3TVYA 2D41A 1FJEB 4B3TJ 3Q2TC 2WOMB 1R8CA 4DN9A 4GC6A 2M8HA 2EBEA 1TKTA 2FVRA 1RCOB 2IRXA 4FF1A 3NGUA 5KFZA 1WI6A 3HFKA 1OPZA 4RUHA 2YWEA 3FC9A 1ITPA 2OSQA 1DARA 4WYWA 1CULA 4I56A 1C4CA 1K73T 3SFUA 4U8VA 4I0WA 4FVCA 1FT8A 3RJMB 3KJQB 1PJ7A 3ICLA 1YZ6A 4FYYB 2E7VA 1LFPA 1CJUA 3A3OB 1WKJA 5H1SV 3T6JA 2DVIA 4KHMA 1U6ZA 1FWPA 2MQOA 1OMSA 1Q53A 2H4WB 2CKWA 2DO4A 1AW0A 2DH9A 5IM0A 1R3NA 5B09A 5DQIA 2HFUA 1RADB 2VJVA 2LQJA 4TLRA 5GADU 4WTYA 4LF8F 2D7SA 3MI7X 4LT6A 4C3MA 2QYGA 3DDNA 5CYQB 3ZZOA 4TQSA 4NEZA 3OVAA 2KXHA 3NNAA 4OX9F 2BKOA 4HH1A 1GFWB 3O3LA 1F5BA 2GHVC 2C3OA 5LJ5Y 1UFKA 3OR1B 4NCAA 4QU6A 2EK1A 5CABA 5KFIA 4DUZF 2B6AB 2W01A 3NCQA 1NHUA 4P7TA 1IBCB 1X5SA 3MPWA 5DG9A 1KQGB 1X5TA 1BGXT 4ANDA 1RBAA 4WPAA 5ITHA 4QR2A 3DLBA 1RZMA 4YY3J 5D3GB 1FVQA 5DGAA 1C1BA 5KFKA 2R9LA 1W7WA 5BYRA 2HVEA 1CJTB 3KWMA 5A8KB 1UP1A 3PRBA 4DPOA 2ROEA 2X1AA 4CLKA 2WOMA 4F4ZA 2E66A 2RRNA 2W8KA 4UY8T 4IRDA 4CRJA 4TY8B 1NU4A 3DHWC 4FZVA 3PO5A 3K8VA 3E2EA 2DR9A 2YNHB 1OY9A 2DISA 4DR4J 4AXIA 2KFNA 4AQYJ 2YPZA 4FKYA 1XR6A 3CGIA 3GIKA 1S0MA 1DFDA 2W9BA 5T41A 5I3PA 3R7NB 4KBIA 3F0NA 2NXEA 2C2OB 2XC9A 1VQMS 2HHXA 2EFOA 2HQDA 2K7JA 2PIIA 3GB0A 4NYPA 1FRXA 1RWOB 4PPDA 5KFHA 1NJYA 4PR6A 4NA1A 2B7BB 1G7CB 4WIIA 1VQLS 2XLKA 2IDLA 4L73A 5KG3A 1B0TA 3TVKA 2FTRA 3MOZA 4DX7A 2VB6A 4K5RA 4TY9A 4WK1A 2ASJA 4ECZA 4QWCA 4I67A 1MU2A 2XGPA 2PN6A 2XB2D 2A18A 5HLFB 3FNNA 2XMKA 3MMAA 4RW7B 3M30B 1HYSA 4DR2J 3RGIA 4DF4A 2RJZA 5CYQA 2R8IA 3DMJA 2MLZA 5KFOA 2DNKA 3UE2A 1BC6A 4NA2A 5KFSA 2VQEJ 2H51B 1RWXB 1X31C 2JEFA 1SJ4P 2H1YA 1RT4B 1NB7A 2IRUA 2ZBRA 3OR1A 2R8HA 3BGOP 3CMES 2CJBA 3IRXB 3OLBA 3H2VE 3MECB 4RZRA 2CVIA 4O0IA 5A0YB 4F4WA 1KWMA 2FLPA 3M6UA 1N8RT 1UCNA 2FHMA 1PYTA 4FNHA 5D3GA 1J27A 1I3OB 2DGWA 3JXOA 4OI6A 4HDGA 5A8KA 1MMNA 4IR1A 1RHKB 3ZZYA 2GJ2A 5DO2A 4TY8A 1ZH5A 1H0HB 3EGNA 4C0BA 3OL6A 1K44A 1T3OA 2YNHA 3T41A 2BUNA 5GAHI 2XQCA 2V6AA 1N36F 2FHOB 2JEGA 2PD1A 5DM7Q 1VK3A 1TK0A 4DL2A 4PZVA 3M9NB 1JLCB 3KK3B 3RBZA 3IXQA 1WC4A 2J9DE 4JUZA 3NOGA 1C4AA 1S6UA 2EG1A 4WYLA 4HTJA 1TL3A 2XI3A 2AYGA 4C8OA 2IBOA 1G1XA 1KVIA 5IT4A 4C0HA 1RXOB 4MMOA 1IBLJ 1YZ7A 4HL9A 2W1BA 2KFZA 3IG1B 4MFBB 2XMWA 2RT3A 3CJRA 2MQQA 2LEBA 3KNGA 2FIUA 1T8EA 2UU9F 2RB7A 3KLFA 3M30A 2UUBJ 4EGLA 1LV5A 4Y2AA 3HKWA 1FX2A 2NR0A 4ZPDA 4ZK7M 2GHWA 2IM0A 1I6JA 2Y0SD 3ETOA 3TW0A 3KLHB 1RWNB 3BGRB 4X62J 3LTOA 3TZWA 3CJ5A 2RVJA 1RT4A 3CJKB 1TMMA 1OSCA 1H2VZ 3RAQA 2HVHA 3KG0A 3MECA 2LDIA 1CS4B 3QJLA 2DGOA 1U8SA 4HI1A 5A0YA 1OY6A 2MZTA 4ED7A 1V3RA 4YMEA 2KYZA 2ZDPA 1OO0B 3BN4A 2QL9B 3QFHA 3MUVP 2FLLA 1DHMA 4PWWA 5GAEI 1GXTA 3NP5A 3AJDA 2OUGA 3M8ZA 4XDCA 1N5YB 2ILZA 1Q86T 4Y0FA 1XWLA 1R8AA 4UZCA 3I5CA 4JI5F 3UDCA 3DRRA 1HI1A 3PY8A 1C0TB 3PRVA 2VV5A 4LR7A 1UA1A 4X4SA 2VZ9A 5CYMB 4DL0C 3BGUA 1S5ZA 4LFAF 4GKJF 4YR2A 3AB4B 2C22A 2HFSA 2C2KB 5H9EJ 3MWBA 3CCQS 2CJXB 5HROB 3AD9C 3SCJE 2KVIA 2I0XA 3HK2A 3CO0P 5LMNJ 1RYRA 4KIAA 3CXCR 3CC2S 1RWPB 2VFVA 4LF6F 4YHHF 4WFAQ 1JLCA 1D3WA 4WKRA 3DLJA 8RUCA 4N47A 4DBQA 2GGPB 2R3VA 1DURA 1R8PA 2HYIB 5KG5A 3KOAA 4F2RA 5F9LA 5DG7A 1TTHB 2RNEA 3FGVA 4YDDB 1YHQS 2V4RA 2VQFJ 1RHJB 5KFYA 3HLUA 1WKLA 2CQ3A 1ZTTA 4LF4J 3G6YA 2MYFA 3IG1A 3D6HB 4MFBA 1Y3KA 2JFKA 3O5TB 3VTIA 4EO8A 5A6PA 1M90T 1KOOA 2GQQA 1FEHA 3C16B 2HK3A 2E5IA 2R7UA 4BWJA 4KHPF 3PKMA 2EG2A 2G2ZA 1LOUA 3CD0A 3KLHA 4E98A 5DZ7A 3U02A 3HT3A 1JK9B 1FKOB 4RUBA 3PX0A 3BGRA 2E7WA 2M8DB 3MOJB 2EBGA 2HWHA 4B3MF 5E33A 3CJKA 1RI7A 4NLRA 1WNEA 3FFIB 3K5MA 3NGRA 2LQ8A 2H5EA 3RRKA 1WHXA 2GVDA 2UP1A 4XTTA 1KQKA 3OUYB 2OGUA 4Y2KA 4NYZA 5LSLA 4DL3A 5A76A 3GFZA 1S77D 1HWKA 3CB4A 1ULRA 4OYZA 1WORA 1N5YA 5HSPA 1NB2A 3R1LA 5EX0A 1UEVA 4ZA1A 4YB1P 3NWGA 1C0TA 3CNQP 3C2PA 2FVQA 5J1NA 4ZVFA 4FVMA 1HNWF 2ZOFA 4CO1A 5C42B 3SCIE 1XERA 4PG4A 1T9VA 1NJZA 1T7PA 2HHHF 1FDBA 5J2NB 4WXWA 2CQHA 1BWEA 2LFVA 2N4CA 3MAHA 2B43A 3CJQA 3CMAS 5HROA 1IBMF 3NMRA 1ZAXA 3EVMA 2YBVA 4Q44A 2HQGA 2B8QA 3BQ1A 2GCFA 4A8OA 3H25A 2MZRA 1R0AB 5BJRA 3PYDA 2V9KA 3FQLA 3UI3A 2BJ9A 5FDLB 1VRUB 3KKFA 3QIPB 1FI4A 3G87A 4DQIA 2QGFB 1TQLA 1SUQB 4C2MA 3QWPA 2R2SA 1Q0NA 2WSCC 1WC1A 3V6JA 4DR5F 3W8PA 4NLYA 2DY9A 4LRAA 1SKUB 3ET6B 4M63A 5IQ6A 4G65A 2PA3A 4UOGA 3QIDA 5IS2A 2QN6B 1MROB 2BQ3A 2W4DA 2CZ4A 4B3RF 3Q24A 4DMZA 4U95A 5ETNA 3JSMA 5HMWA 2DHHA 5GMDA 3L7UA 3D9BA 6FDRA 2ZH1A 5HMZA 2JEJA 3VGSA 3TAQA 1T9XA 1Y11A 2AMCB 4M5KA 3DM2B 1BWVA 3FFIA 3MEEA 4ZVOB 2R2UA 3MR2A 4HTIA 4O3SA 2H5IB 4IG3B 5CH7B 3DRSB 5FIIA 4B9MA 3SDEA 1ZA1B 4X4OA 4B9LA 1D0EA 2RQCA 3ENWA 4BCAA 3A8IA 3CWJA 3KHRA 4LRFA 2EW9A 2DCLA 1XK8A 2HRTA 4WCEQ 4X64J 4J9OA 1DQ8A 2AZ1A 4HACB 4A4JA 1U1LA 1U1OA 3HT0A 3QT7A 1HHSA 2HHPA 3VHQA 1XMQJ 1UFWA 3THVA 3VVTA 1T05B 4X4TA 2BM1A 1HNXF 1J2VA 4J9RA 1Y0HA 3QRRA 2XMMA 3EJMA 2GO8A 4LR8A 1YJ9S 2GW8A 1Y5IB 3QGIA 1YRUA 3PACA 1KN6A 4MYTA 1X9WA 2FHJA 3H7HB 2DBBA 5SZTA 2WZ1A 5KFAA 3CCLS 3KMQA 2VKZG 4WTOB 2JWNA 2R42A 2QL5B 2LXFA 2RDDA 3Q8QB 5U47A 1PAEX 3CJSA 1H7XA 2F40A 1HMVB 1DQ9A 3QATA 1U0SA 2YKQA 3GSDA 2BXJA 2P9GA 1PGZA 4TLQA 5FDLA 3V6KA 5C24B 4DR7F 1TAQA 2ZITA 3NBPB 1FHTA 3MUTP 4UQTA 2GIRA 3Q8SB 3RAXA 1SUQA 1HNVB 4ZJOA 1RQ0A 3GIJA 3HF5A 1TKZB 4M1KA 1DTQB 2NXCA 1GT8A 1WSVA 5HVHA 2E1MC 2I9SA 3ET6A 2DHGA 1RSCA 4Z7YA 3AA8A 3GLJA 3BR8A 1FO1A 2AX1A 3I31A 4X4NA 4USJC 3GG1A 1BQMA 1N52B 3FVYA 1U1KA 5IOLA 3J7A1 3ZXWA 3JYTB 1LW2B 3PZPA 1NDKA 4ZCKA 4R0JA 3UN2A 2GNKA 4AE5A 5K5MA 1HHTP 4JI7J 2E44A 3FRYA 1EZZB 3MM5B 5A8WB 5KOXA 4IG3A 1N34F 2YPYA 2Q79A 3KJVB 2M7SA 1YWXA 1TP7A 5M2PA 3R3TA 1QM9A 3TO8A 3VWSA 4BC7A 4WE1A 1S6OA 4Q8FA 4CTAB 2A2DA 2P9EA 1K1SA 4DX8H 1VQNS 2HW3A 5DZ6A 1T05A 2Z58B 4DXLA 5CYJA 4KRWA 1U2RA 4G1IA 5EWFA 2ZD1B 2B9WA 1RDRA 4OHXA 4DR1J 4MJKA 2H65B 3I4HX 3C19A 2Y8WA 1HLWA 1Y4ZB 4ED4A 2B7CB 1LXJA 2VD3A 3KJFB 1REVB 1EKSA 3A3NB 1D9FA 3VGVA 1SPBP 3SQOP 1NHKL 1HMVA 1NDPA 2HIQA 3L3CA 1QUPA 2CWXA 1FXDA 2XNQA 2YX4A 3D54A 5F3TA 2BANA 2FHKA 5C24A 2DYAA 4RW6A 3NBPA 3G96A 4L3NA 1PO6A 3P6YC 1NDCA 5D4PA 3EGVA 4C7QA 1HNZJ 4IFYA 4M8LA 3QRPA 3G8SA 3UVJB 1HNVA 5LT5A 1TUWA 3SSQA 5J2QA 5L39A 2FB0A 1TKZA 2V0NA 2QA4G 4CLUA 3MF5A 3AAWB 1M5PC 2JLGA 1NJIT 3CCTA 2NSBA 3NL0A 2YNIA 1KFDA 2YKAA 2HQCA 3P8BB 3U27A 2QA2A 4WWSA 5F8LA 2YNFB 3RYLA 1JLQA 4ED5A 2E9ZA 2KG0A 4EEYA 5F0UA 1SC3B 2Y3YA 3HO1A 1KLMA 4M5NA 3MFHA 4DN0A 1RTIB 1M5KC 3UR0A 1S57A 3UDVA 1X8DA 1TL1A 1FNOA 1HR0J 3Q2SC 4ZVTB 2ALYB 1R89A 3JYTA 1LW2A 4ES2A 4DS5A 4TVAB 1SCJB 1S9FA 1PSDA 1J5EF 2OEMA 4TXSA 5J1EA 2M4MA 4CH1A 4G3IA 2CPFA 1SI9A 5C2GA 2BYCA 3A1YG 3MM5A 3PFEA 4KGXB 2H48B 4PABA 3SV3A 3GV8B 2FZCB 4DV6F 3G6ES 4OYPA 3IA0A 5ETMA 4WU2A 3KLGB 4OYAA 4OYOA 3DU6A 4OHWA 2YVSA 4UOCA 1TR0A 1WKKA 2HHQA 1NK6A 4X66F 4CTAA 1H72C 4WFNQ 2QZ8A 3TOQA 2ZNZA 4NLPA 3EDQB 4N56A 4RNOA 3K5NA 3Q0AA 5B0EA 2CRLA 1VBYA 5AE1A 3I32A 3NKYA 2HZAA 2GVZB 3H42A 1ELOA 2RE1A 2BQUA 3QRQA 3HSZA 3HXMA 2QA1A 4PKDB 2WONA 4RBUA 3TQEA 3KJNB 4QIFA 1NK5A 3EGZA 3RBDA 1ZM2A 3OTOJ 2F7VA 3DI6B 1S9GB 1QVGR 2KU7A 4QWAA 2DIUA 1IQTA 1U1RA 1H74A 4FDFA 2DH7A 4DOZA 3TAMB 3MMCA 5K14A 1WC5A 4PAAA 3GFYA 4LQ3A 1ZM9A 4BBYA 3U7JA 2ZZNA 2Q6CA 2VFTA 5K8OA 2Z4PA 2UUTA 5K9FA 3A8KA 3H5XA 3HSDA 3VGUA 2ZJPQ 2G0CA 2NUHA 3UVJA 1FEEA 1N56A 2POKA 1YITS 3DRYA 4IQXA 2AJ4A 1XMOF 1PCAA 2MHEA 3N9UC 5B0BA 1YLXA 4P2FA 1YDLA 3HI9A 1UA0A 2PSZA 5D8HB 2KH9A 4LFBJ 3H2LA 3LALA 4USUA 4PQUA 4OHYA 3NAIA 1T02A 3OSNA 5DS7A 1R31A 4NMLA 1I51B 3OLAA 2RH3A 1N5TA 1FNXH 4NLGA 3NCPA 1RTIA 3GIIA 4ZS6A 4ZPTR 1REGX 3VVUA 2Z2LA 4JV5J 3VAMA 1VDHA 2HGLA 5G0RB 4B3SF 4F02A 3M8WA 3CSKA 1GMWA 1NHVA 2IY5B 2IRYA 2G4BA 2C3UA 1DZ5A 1VRTB 2HIYA 3PX4A 3BSCA 4ZCMA 4LF7J 4IH7A 3EICA 1FKAF 4DI6A 3FEXB 5F8GA 2J6SA 4PG8A 1Q8BA 1Q95G 3RW6A 3KLGA 3OTDA 4B3OA 1EP4A 4WJBA 1FRJA 2DNQA 2RUGA 2OHDA 2K3KA 5DM6Q 4IQMA 1RAHB 3BSNA 1RT2A 1N48A 4WZMA 4MKYA 1Q79A 2DGXA 3SZ2A 1RTZA 3V6DA 4LF5J 2Z0GA 1PG5B 2VDIA 2NZ4A 4J9LA 3IFEA 4A47A 3PR5B 2HGMA 1IR2A 2J7UA 4V1Ak 4KT0C 4GVBB 2GHPA 4GKKF 3M32B 4KC5A 1APSA 3GIMA 4ZVGA 4J9UE 1WF0A 4LSNB 3DI6A 2EFPA 5L8RC 3M2VB 3K89A 4DF8A 1X0FA 1F5AA 1JX4A 2UUCF 1P27B 3NAHA 1RT7A 2OMLA 3H5YA 2DEIA 3V5RA 2KYXA 3H59A 4NA3A 3PW7A 3W2VB 2CJYB 2C3YA 5JXSA 1U26A 1V3ZA 1OYEA 4RW8B 2FHJD 1UETA 4Z7CA 2Q6BA 4M5DB 2IVMA 4CT8A 4PUOB 3GV7B 1N33J 3MM8B 4C6AA 2CQ1A 4LFCJ 2LXUA 2PDAA 1MWQA 2J8SA 2PMHA 4AFFA 2V69A 2DNGA 4ECVA 5KG0A 2D3ZA 1B70B 4YP3A 2L08A 5I42B 5EN1A 2BRKA 3V6HA 3MCSA 1S48A 4K50A 2ACMA 3HSJA 1VLOA 2VG7B 4LBIA 1S99A 3DRXA 2OPQB 1JJ2R 3MCMA 4XIUA 1WF2A 2VPWB 1NK7A 2UXBF 1XR7A 2YQ0A 1ZM4A 2ZBCA 1RWKB 1VRTA 2I5JB 1CC8A 1RWMB 1NJWA 4V19J 4OIXA 3PNIA 4QU7A 2ZEJA 3EMTA 4KGVB 1PAUB 1VLYA 1HNIB 4CLZA 3UQSA 1XIQA 3ZNJ1 1HIYA 1I1GA 1XNQJ 2V2ZA 2XSJA 2IMOA 5L9XA 3CMQA 2LLZA 3DGPA 2Q1LA 1N6QB 3JAMY 1K1QA 2OKQA 3L95X 5KFWA 1DBDA 1KKHA 1HA1A 2CQPA 3PHTA 2OD6A 2RSQA 3CDUA 3Q8PB 4YDXA 2WB4A 1Q5VA 1J5OB 1D09B 3C14B 1UFLA 3NNCA 3WC2A 3NGDA 4GVBA 3M32A 2R7WA 1AXQA 3VQSA 4OI4A 4UUWA 2D69A 2WB1D 5DLFA 4ZPWR 1TUVA 3Q8UA 3TP2A 8ATCB 4LSNA 2CQGA 2MDAA 3M2VA 1AA1B 1RTHB 3MM9A 1U25A 3GIRA 2QA4S 2J7WA 2HNYA 2ADCA 3T5KA 1S4EA 1LWEB 1RT3B 2VOOA 2AHOB 2IJNA 3WQPA 3MM7B 2HQIA 2FJEB 2B9YA 1NSKL 2YKPA 3HSGA 3W2VA 4K4XA 2D1CA 2A6OA 2B56A 5M2RA 4RW8A 2VG6A 3G2XA 4F3MA 1IKVA 4M5DA 4RU9A 1FA0A 1S6QB 1U47A 3W5YA 2ZE2B 1HWLA 1IKWA 3MM8A 3DLGB 1DY3A 2XMTA 4J9KA 4ZVRB 4DPYA 4O4RA 4Y2MA 4WP3A 4ID5B 3T5LA 2MPUA 1SC4B 4FS1A 1VCTA 3OTEA 3ENQA 3K8WA 2UUAJ 2CNOB 2KI2A 5I42A 4S0MA 3E51A 4P71A 1XEZA 1LEOA 2NLWA 2ZZMA 1Z2LA 4PWDB 1JLBA 2ZH7A 4CO4A 2VG7A 2ZDOA 4J9PA 3DLLQ 2IA6A 3OR2B 1VISA 1KHVA 2RF2B 1NNDA 3NXZA 3TEHB 2VICA 5C2CA 4TQRA 2RAQA 4N76A 1KOHA 2HBZB 3EZ5A 4DSEA 2HHTA 2AJ0A 3IC1A 2UVWA 5THWA 5GMEA 1HNIA 2PT0A 1XTZA 4RW9A 2OEJA 5HMXA 2BE2B 5CCLA 4DG1B 1QTNB 3QJPA 4PXDA 3W61A 3B54A 3N4WA 4A8SA 4ZVEA 1HQUA 4F4KA 4WF9Q 3QLHA 4RL1A 3RBEA 3VAHA 2DPIA 3Q8YA 3LP2B 2DGTA 4DLGA 2V67A 4DSKA 3FRZA 1J5OA 3C14A 4GO7X 2DNPA 2I6WA 4N77A 1VS3A 3FDSA 3TYTA 3HZEA 4NL5A 4DV4F 3H98A 1VC5A 3OXLA 3TNVA 2HPUA 1V6HA 4ZHRA 3GR1A 5I4MA 1WOOA 2DRAA 4ZCLA 1RTHA 3CF5Q 3CJ8A 1MW7A 5KOWA 3MR3A 4NXMF 2JLFA 3SCLE 3N01A 2CIMA 1LWEA 1RT3A 3OFGA 4MKVA 1HBOA 2SXLA 1FX4A 4ECSA 4LVOP 2XI2A 1T95A 3I96A 3J81U 1TL4A 5D4NA 4XDDA 5IWAF 3J81Y 4DR6F 4LF8J 4NLOA 4LBHA 3JQKA 4C8YA 3EPIA 1S6QA 3HFVA 3WIUA 1T03B 2ZE2A 3DLGA 3WHIA 2V2QA 5KTQA 2CG8A 3KFWX 4IOBA 4OX9J 2IC3B 1KR4A 3C3LA 3T6BA 2FLNA 1GK8A 1NXIA 4DL7A 4KFBB 4ID5A 2XWXA 2M52A 2JFDA 1WG1A 4WKYA 2FQQB 4L74A 3FSIA 3EUNA 1S1WB 1GQEA 1YJVA 4DR2F 3ENAA 5IFMA 3PW5A 2QC3A 4DUZJ 2CPDA 2V5HG 1BD6A 1WOSA 2FJVA 4PYAA 1H7WA 3OR2A 2CNNB 2X1BA 4ECRA 5HAOA 2NXUA 2XO6A 4DV1F 4HKQA 3N6MA 2BABA 1TVRB 3KLVA 4RWXA 4R0EA 2LDYA 1ZM3A 4QWEA 3D1HA 3X1LB 1Q4RA 1HD0A 2IFXA 2QMXA 3ZTPA 1U4BA 1BXNA 2BE2A 2AX0A 4DG1A 4E2FB 2XYHB 4ECQA 3MAQA 4KYZA 1QDUB 4CO2A 4LRCA 2A6MA 1V5IB 3AQOA 5DDQC 3MCOA 1GMWD 2ZWPA 1P1LA 4DPUA 2R8JA 3M8QA 1SKSA 5EUHA 5ETRA 3LP2A 2W9AA 4ZVQB 1VRQC 3ISZA 2D74B 4BDPA 2Y1RI 3WZ0A 1G2EA 2LU1A 1JNRB 1BQNB 1BQXA 1WACA 3GZ7A 3KK2B 2CPIA 2ZBQA 2YQ3A 1IM6A 1RJJA 4PPZA 4KSEB 4ECUA 1F2GA 1JLAA 3BB5A 4X4QA 1HKAA 1NH8A 1TV6A 3POTB 1RCXB 2XY5A 2CG4A 3W62A 4C9DA 1EHWA 5CXTA 4ECXA 2W4CA 2YWKA 3NRBA 5E3QA 2A3JA 2V94A 3A13A 4DUYF 4TN2A 2ZNYA 3OD2A 3CVKA 3D1OA 1OQ6A 1WEZA 3L09A 4IFVA 1L3SA 2IC3A 1F0XA 1IBLF 2E1CA 1DTTB 3MEGA 1N54B 4QR0A 5L9NA 4KFBA 1FK9B 2KO1A 2VPZB 3J7YU 1Q7LB 2G2OA 3M8YA 5HBMB 4W92B 2O1PA 1S1WA 4X4RA 2ZHBA 3M1VB 4A8FA 4YR0A 2ALZA 5SUHA 2MKYA 5KFCA 3C15B 1JWWA 2EPIA 1JMTA 2VPYB 3CDBA 3RRHA 1SVDA 4ECYA 2KT2A 2XMUA 2XMVA 1HL6A 2Z57B 4KQZA 1XNRF 1RHRB 1RHQB 4ZN1A 1TVRA 1TKDA 2AYBA 3B8HA 3D68A 1WSRA 2COLA 5HATA 2ROGA 2KVQE 4I7FB 3ITHB 3NG8A 1FFWB 4NZ6A 4KJIA 3J80U 5F8NA 2EFNA 3J80Y 4LUBA 1FNMA 2LEAA 2NUUG 4DCOB 3KG4A 2HHWA 1S1UA 2X1GA 5CHCB 4BLGA 3PJWA 5J1PA 1S1TB 2HQFA 8AT1B 5EGYA 1N36J 1SQGA 2MB0B 4PXBA 3T9NA 4AD6A 4DQQA 1UZHA 5DDOC 2RQKA 2DNHA 3G82B 4I6WA 2LEPA 4I1TA 2IHR1 2AGOA 1TL5A 3R5CA 1CSJA 4K4ZA 4KPYA 3Q8VA 4ZDNA 1M5HA 1BQNA 4Q45A 2CYYA 3D66A 3CC4S 2ROPA 3AQPA 3D3BJ 1FDAA 5FD1A 4DLEA 3FBBA 2BACA 4U6PA 3E8OA 4DV7J 3WIVA 5IT9Y 3POTA 4ZIWA 1FKPB 1RA7A 1I94J 5A6WA 2WVDA 4Q7AA 1VQKS 1VJQA 3PYGA 2CPEA 4JV0A 3MR6A 3R8YA 4C4WA 2HURA 2BJ7A 5BR8J 1VQ7S 1HBNB 2IAJB 2LA6A 5T7LB 3QQCD 2VQFF 3J7AN 4DSIA 2X3DA 1DTTA 4DQPA 4UUXA 4JV2A 4LF4F 1FK9A 4DV5F 1YRTA 2EC2A 2VF3A 3W8GA 5HBMA 1JKHA 4DU8A 2WVEA 1X9MA 1YBAA 2CWKA 3PW4A 3D2WA 3M1VA 4CLWA 2NYIA 4FYVB 3UO0A 2MKHA 1KS2A 2NZCA 3C15A 4ETXA 1M1GA 2C2NA 1A0OB 2RRAA 5AXMA 1VQOS 2CQBA 3IMQJ 1FTCA 1UW4A 3BQ2A 3E01B 1L3KA 4PXEA 4UQGA 2CPYA 3BF4A 4ES3A 2X7IA 3GR0A 4P72A 3QO9B 7FD1A 1WDDA 1Q81T 3I9V9 4I7FA 5D0GA 3ITHA 3HHKA 3QYYA 1LK7A 1RU2A 2WK4A 5E3AA 1X4FA 1GEHA 4ZCIA 4IH6A 3DRPB 1WEXA 1RLDA 4FYDA 1N5QA 3ZNUA 2UV8G 3I0SB 1JLFB 5HQ8A 5B0FA 2JC1A 3THTA 1RISA 3KLIB 4P75A 3DLKA 5KFPA 2LXIA 3N0VA 4NI2B 3C6TB 1V5VA 2AP6A 2VASA 1H2TZ 2BQRA 4LF6J 3G86A 4ZP8A 4YHHJ 3G82A 1X4GA 3KDOA 2GO9A 1X4CA 1P9QC 3VAKA 5F0WA 4NOHA 2RUSA 4W98A 5RUBA 3ZTOA 1O8BA 2WHOA 3IWXA 4RO0A 3QT6A 3AJ1A 1IM4A 1O6XA 2IPOB 5DGBA 4NRTA 1TKXA 1SL1A 1GXLA 3PVXA 1ACMB 1IR0A 4OLPA 3BREA 1SBRA 2ZM6F 4Q0BA 2L3MA 4F0MA 1FD8A 2GA7A 3BH7B 2FYXA 2ZH9A 5T7LA 3HJVA 3OW2R 4KHPJ 2LP4A 2Y8YA 4JI6F 4ZP9A 2FVPA 4OYWA 1MNEA 1FDNA 5F41A 3BDPA 1VIXA 2KTQA 4B3MJ 4QIWD 3LP0B 1S72S 1FCAA 2XS7A 1IKYB 1TL7A 2DGSA 1HWIA 1KRPA 3T9ZA 2R2RA 1QAJA 5GAEU 3OL8A 2NYHA 1IXKA 3UDLA 2CJKA 5I3UA 1H98A 1GX5A 3KK1A 2O66A 3N5BA 2W9CB 2KM8B 1R7IA 1Y9OA 2CUYA 2J0WA 4OJGA 4U9RA 3MPDA 1YVFA 2QYCA 2HMIB 2UUWA 2C2RA 4A8MP 2MQMA 2A2CA 3BGFA 1BHNA 3DRPA 3T1HF 4A48A 1HNWJ 2VIHA 1Y7PA 4KV8B 4F04B 3I0SA 1YX2A 1S1VA 3HCXA 2HHHJ 3D0IE 3FZ2A 3UCZP 1RAAB 4P9SA 3KLIA 2J9DA 3R2DJ 4QOTA 4ED6A 4G6VB 2J6UA 4NI2A 1CQMA 2AJ2A 2CZVC 5HQMA 3NNHA 2V2KA 3C6TA 4IRCA 2UV8A 1O51A 1LWFB 2BEFA 1S97A 4I2QA 4F0HA 2XZTB 2AF6A 4ED0A 3MMBB 2FGOA 3PW0A 2KZZA 3GILA 3U1LA 1SJ3P 4ELTA 1S9EB 3AXMA 1JXVA 3VCDA 3TX0A 3CCWA 2FGCA 3OHBA 3T5HA 2B4UA 3FK4A 3BS9A 4HDHA 5HQLA 4I2PB 1UZDA 1VI7A 3EXCX 4DR5J 3M2UA 4Y2CA 2MZ1A 1KEKA 4AL5A 4D3GA 3IO1A 4H4MB 5AT1B 4BHQA 3BM7A 2HVZA 2PGCA 3J7YI 1TUGB 1B64A 1WHWA 1VFJA 1JJHA 4USVA 4DV0F 2YXLA 4BC9A 3OXFA 5F8MA 1LXNA 3DOLB 4JB8B 2ZH8A 3RBXA 1Y5LB 2RQMA 2AYEA 1S1XB 3GYXB 4B3RJ 2PMWA 2QT7A 4DSLA 1WTFA 2DNZA 1IQZA 1PC5A 3GYNA 1YTYA 2CJAA 3I0RB 3LP0A 5I3QA 4B9SA 1TK5A 1IKYA 4UW2A 2B0GA 1MMLA 1F3FA 1NZAA 2F8HA 3ILJA 4UTGA 2G2YA 1YG0A 3IN5A 4FF2A 4NXNJ 2WAQD 3CCJS 1Q5YA 1RU1A 2W9CA 2M88A 2QLJB 4ZVSB 3GU0A 1H3DA 4JI7F 3KMSA 2V68A 1AT1B 1P8GA 2L9DA 2KT5A 4JI3F 2R7VA 5E7OB 4QYZK 2R7OA 2VFRA 2OP5A 4N8OA 1EQ0A 3NGSA 3UPFA 3OJSA 4F7VA 2UVVA 4FP9A 1VR6A 2XY6A 5HI7A 3TUIC 3B82A 2W2MP 2IYIA 1EAYC 4QBUA 3HULA 3CD5A 4CH7A 2LYVA 2KHDA 1RABB 3KTQA 2RIJA 2J7KA 1F6TA 4RR5A 1FJGJ 3D3CJ 3LH2S 3WX4A 2X1FA 5L1IA 3WC0A 4I64A 4DR1F 1YGYA 3MMBA 2H54B 3MPUB 2PFDA 3HZGA 2BE9B 1VC6A 1JXLA 3DOMB 3AOBA 1S9EA 2HHVA 1UPPA 1M5OC 3RRGA 2JLEA 4ED3A 2DNNA 3QNWB 1QD1A 4ZLJA 4Q43A 3CT9A 4XO0A 4XPCA 4QJVA 1F3VA 1RK8A 1X60A 2RHSB 1O5JA 1NM2A 1FRKA 3FMBA 3OVSA 4X2BA 3VQTA 2B6AA 1VJWA 4H4KA 1U24A 3Q83A 2RU3A 3G9CA 1BLUA 1WHYA 3I82A 1FFSB 4K4WA 3LPYA 2QIFA 3DOLA 2BOAA 2HVDA 1XJWB 2AEMA 1CJTA 4XPEA 4JI1F 3VALA 3R6GB 4K0KF 3SI8A 1C1CB 4ITSA 4I6YA 3I0RA 5JJBA 2JJ4D 3VF0B 3S7RA 4C48A 4DX6A 1UVIA 4Y00A 3GJSB 1NO8A 3CJ0A 1HR0F 2BA9A 3KG1A 1VOMA 1CVJA 2HHUA 2V4JB 4P6QA 3TEGA 2QMUB 1FRIA 3GWCA 5E0OA 2QX0A 4O4GB 1RACB 5KFEA 3OFEA 2N3LA 2H5JB 2EFGA 4LREA 2DPJA 5D4OA 3G71S 4ILLA 5HN0A 2J0XA 4EBDA 5B0CA 1WWHA 4LRDA 4R8UB 1R0CB 4KGKA 4JBCA 1QE1B 3ZZTA 4KTQA 1ZBTA 2MJNA 4J7CA 1RT6B 4WBFA 3N79A 1RE1B 3IS9B 3GV5B 2F4VF 1JXEA 2QG9B 4P52A 1K9MT 1TFYA 3B78A 5HLFA 3HX9A 2XLJA 2WCXA 4CI0B 1RA6A 2K06A 5KG1A 1VBZA 4RW7A 4DL5A 3ZZZA 4RNHA 2JHEA 5ETQA 2R7SA 2FVCA 1YBTA 1IN0A 3DOMA 1ZYQA 4P7VA 1AZSB 4IYQA 3QSIA 2YX7A 2RILA 5KFNA 4DL6A 2HK2A
chains in the Genus database with same CATH topology
2EWHA 1FRHA 1SJRA 4GKKF 1TKTA 3M32B 2FVRA 4KC5A 4CNZA 1APSA 3GIMA 5EX3A 3DDKA 4X4UA 2IRXA 2YNIB 2KHCA 4ZVGA 4ED8A 4FF1A 5KFZA 1WF0A 5E3CA 2WTFA 5KFFA 4LSNB 4C8KA 1WI6A 3DI6A 1G6BA 3HFKA 2EFPA 1OPZA 2M3DA 2XHWA 2F1FA 5L8RC 1JLQB 3IRXA 4RUHA 3QZ8A 3CCSS 3M2VB 2YY3A 3O2IA 2YWEA 2D3OR 5GMKa 3V4IB 4DF8A 1X0FA 1F5AA 1JX4A 4X65F 1KLMB 3LOUA 2UUCF 1P27B 1OSDA 3NAHA 1RT7A 1P1TA 4F50A 1VMBA 5J2PB 2OMLA 1K0TA 2R2TA 1SH3A 1TL1B 3H5YA 2OSQA 2XMJA 3VR1A 1VQ6S 1DARA 2VPXB 3V5RA 2KYXA 3H59A 4RBTA 4NA3A 4WYWA 3PW7A 4YB7A 2CJ9A 3CDWA 3W2VB 3HPOA 4ECWA 2C3YA 5JXSA 3KHGA 2RDJA 3N6LA 1SKWA 4I56A 1GTEA 1U26A 1C4CA 1V3ZA 2HLUA 1M1KT 3LF0A 2MKCA 4RW8B 1K73T 3C6UB 2FHJD 1UETA 3SFUA 4CQ1A 2Q6BA 4I0WA 1YJRA 4M5DB 5J1EB 4FVCA 1FT8A 2IVMA 4CT8A 1SC6A 3ICLA 4PUOB 1A9NB 1NK8A 1UAWA 3ULHA 3GV7B 4JV1A 5HL7Q 3MM8B 4ZP7A 2CQ1A 1VQ9S 1LFPA 4DHVA 3R5AA 1T3NA 1W2IA 2LXUA 1FDDA 2PDAA 1B0PA 4FBUA 2U1AA 4NLTA 4IO9Q 4AFFA 2PMHA 5H1SV 3DNCA 2DNGA 5KT3A 3F44A 3T6JA 4ECVA 2DVIA 2ILYA 3QWUA 4KHMA 1U6ZA 5KG0A 2MQOA 4KO0A 4OZ1A 2WRMA 2D3ZA 2C28A 1Q53A 4YP3A 5C25B 2CKWA 2DO4A 4RW4A 1AW0A 2DH9A 1S79A 4D3HA 2L08A 5I42B 5IM0A 1R3NA 3TI0A 1U1MA 5B09A 4LF9F 5EN1A 2BRKA 4J9MA 3V6HA 2Z2MA 3MCSA 1ZZFA 4EWTA 2MQNA 5DQIA 2YH1A 4F3QA 1S48A 2LQJA 4TLRA 5GADU 4K50A 3VZHA 4O4GA 2VG7B 4WTYA 2M2BA 2MGZB 1S99A 4LF8F 2D7SA 3I56S 1S6PB 3MI7X 1E6VB 2FLOA 4LT6A 4OJ3A 4B9UA 4C3MA 3DRXA 2OPQB 3DDNA 3PJXA 3FMWA 4HT5A 2P6SA 5CYQB 3ZZOA 1JJ2R 4TQSA 4LF7F 3OVAA 2KXHA 4XIUA 3KK3A 3NNAA 3CEDA 3DLHA 2AV5A 1UWBB 1WF2A 2JVRA 2VPWB 2ZOMA 3DXBA 4OX9F 4RLEA 3ZFVA 2OPSB 4TU9A 3G4SS 1XR7A 2EFVA 3T5JA 1U1QA 2UXBF 1R6YA 1HW9A 4Y3CA 4HH1A 2HVIA 1ZM4A 5AJ3F 4R8UA 2ZBCA 4Y65A 1VRTA 1T03A 1Q78A 2I5JB 2VC1A 4MIAA 1CC8A 4TKTA 3O3LA 1F5BA 2GHVC 3OL7A 4F3OA 2WONB 4FNIA 1ZPWX 2B5JB 3W2WA 1NJWA 2C3OA 5LJ5Y 4OIXA 4V19J 4J9QA 1V9OA 2V8HA 3PNIA 4QU7A 1QE1A 4F4XA 4G1PA 2FJXA 1VLYA 1HNIB 4NPOA 1F9FA 3UQSA 4A8WA 1WTBA 3OR1B 1SH0A 3BGLA 1I1GA 1RT6A 4NCAA 4QU6A 4Q5VA 2EK1A 1UJ4A 2Y1IA 5KFIA 2N82B 4DUZF 3IS9A 1GTHA 2B6AB 3SQGB 2HNDB 5CD4H 2XSJA 3NCQA 1NHUA 4P7TA 2IMOA 2UUBF 5L9XA 3MMCB 5K14B 5KT7A 2MY7A 2VBWA 1X5SA 2LLZA 3D5MA 4X84A 3DN9A 2AGPA 3DGPA 3MPWA 5DG9A 3D0GE 1NK7A 1KQGB 5D4LA 2Q1LA 1N6QB 3JAMY 1X5TA 1BGXT 1K1QA 5EWGA 5H9FJ 4LF5F 4OQJA 5ITHA 2OKQA 3L95X 4QR2A 1DBDA 5KFWA 3CCES 4ZKAA 1VQYA 3DLBA 5D3GB 1FVQA 1HA1A 2CQPA 1R27B 5DGAA 1NK0A 3FJ2A 1C1BA 5IQQA 5KFKA 3BN7A 2R9LA 3MURP 2MY8A 2OD6A 5BYRA 3J7ZT 1FD2A 3S1TA 2RSQA 4OJHA 3CDUA 3KWMA 3Q8PB 4EZ6A 4X62F 4YDXA 5A8KB 3PXGa 1UP1A 2WB4A 3PRBA 2R8GA 4DPOA 1Q82T 2ROEA 3DXSX 2X1AA 1J5OB 1UFLA 4N5SA 3NNCA 4K59A 2WOMA 3WC2A 4F4ZA 2E66A 2RRNA 3NGDA 2W8KA 4UY8T 4IRDA 3LAMA 5F8IA 2BJDA 3M32A 5B0DA 5MAOA 2R7WA 1WELA 3UCUP 1AXQA 3VQSA 2GIQA 4OI4A 4UUWA 1WD6A 4TY8B 1S7HA 2WB1D 5DLFA 1UEUA 1NU4A 1TUVA 3DHWC 4H54A 4ZPWR 3C46A 3ZZRA 3HJFA 1HD1A 3TP2A 4OMFG 4PG7A 4PQUB 4FZVA 3PO5A 2BR0A 3K8VA 3RB3A 4LSNA 2HFZA 3E2EA 2LQBA 2CQGA 2DR9A 1KC8T 4QQBA 1X4DA 2MDAA 5JUMA 3M2VA 2YNHB 1RTHB 3MM9A 1U25A 2DISA 3V4IA 4LIWA 4DSJA 2QA4S 2J7WA 2HNYA 2ADCA 3H5UA 3T5KA 3ENVA 4AXIA 3PM9A 2LA4A 2JSXA 2KFNA 1LWEB 3RR7A 2HLTA 1XR6A 1RT3B 3CGIA 3GIKA 1S0MA 2VOOA 1DFDA 2IJNA 3MM7B 4Y2IA 2W9BA 5T41A 2HQIA 5I3PA 2FJEB 5KFXA 2Q43A 2B9YA 3EYZA 4KBIA 2HAIA 2ZH6A 2YKPA 2HFNA 2J8AA 3W2VA 4K4XA 3RAMA 2D1CA 3QGPA 2B56A 5M2RA 2XC9A 4RW8A 1VQMS 2EFOA 2HHXA 3C6UA 2VG6A 2K7JA 4F3MA 4C3LA 1IKVA 2PIIA 5EDWA 5HP1B 3GB0A 4M5DA 4NYPA 1FRXA 4RU9A 3OTCA 4LFCF 3ZC4A 1FA0A 4PPDA 5KFHA 5AE3A 1NJYA 4FXVA 4PR6A 4OHVA 5E3RA 1S6QB 1U47A 4NA1A 2B7BB 1G7CB 4WIIA 4WFBQ 2ZE2B 1VQLS 1HWLA 1IKWA 3MM8A 1FESA 3DLGB 2XLKA 2XMTA 4J9KA 5KG3A 1B0TA 1UJ5A 3BZQA 5CYMA 1JJ4A 3Q2TC 2E5LF 4OFZA 3TVKA 2FTRA 2W8LA 2VOPA 3FCHA 4AYBD 1L3VA 3KK2A 4YB6A 4O4RA 4Y2MA 3MOZA 5EWEA 5ADZA 5HO4A 4DV2F 1WF1A 2GMLA 5KFQA 4XK8C 4ID5B 4ZPVR 2VB6A 3T5LA 2MPUA 4K5RA 4TY9A 3QJJA 4B3OB 4WK1A 4FS1A 1EP4B 3HVTB 3ENQA 3K8WA 3OTEA 2ASJA 2J0QD 3RU0A 4OLOA 1B0VA 5C25A 1JLEB 4ECZA 4F2SA 4LJMA 4QWCA 4I67A 5CCMA 1MU2A 2KI2A 5KFDA 2XGPA 5LMNF 5I42A 3E51A 1XEZA 2PN6A 2VBXA 2XB2D 5LJ3Y 1E6YB 2GX8A 2A18A 2NLWA 3FNNA 5HLFB 2ZZMA 2XMKA 1Z2LA 3NGKA 4PWDB 2KXFA 5KFUA 1JLBA 4KHRA 1RT2B 2ZH7A 3MMAA 2JOQA 3I87A 3M30B 1O0PA 4NLQA 4RW7B 4CO4A 2VG7A 5BYQA 2ZDOA 5KG2A 4J9PA 3G6VA 4DF4A 1SL0A 2RJZA 3DLLQ 1Z1ZA 4K5SA 2IA6A 3OR2B 2MZSA 3G6XA 2DB1A 2RF2B 1KHVA 4B9NA 3V6DB 1OS5A 2DD8S 5CYQA 2J0SD 1NNDA 3RB0A 3CCZA 2R8IA 3DMJA 2CPXA 1UWBA 2H9ZA 4DSFA 4TQRA 1HBMB 2ABYA 4EU0A 4OZNA 5KFOA 2DNKA 2AGOA 5C5JA 4N76A 3KHLA 2KJVA 1KOHA 3UE2A 3EZ5A 1BC6A 2C3MA 4NA2A 4DSEA 2AJ0A 3IC1A 2GGPA 2HHTA 2PO4A 2UVWA 3LO3A 5KFSA 2AD9A 5THWA 2B5JA 4F26A 1TKTB 5KAKA 1HW8A 1HPZB 2F9JA 2J6TA 2JEFA 2JVOA 1SJ4P 3OV7A 2JEIA 1RT4B 1HNIA 1NB7A 2IRUA 2EC0A 3OR1A 2R8HA 3CMES 2PT0A 2CJBA 2QSFA 1LWCB 1XTZA 3IRXB 2R4FA 2JDJA 4RW9A 3BSAA 3H2VE 5EHHA 3MECB 5HMXA 3OLBA 4RZRA 2AQ4A 1UMJA 2CVIA 2HNDA 4YUDA 3LGMA 1NRKA 1U48A 2M70A 2BE2B 2NS1B 5CCLA 4O0IA 3TX8A 2CPHA 3S6EA 4DG1B 2MKKA 2AWZA 5A0YB 2Y1JA 1RT7B 4F4WA 2CQ0A 2MQPA 3QJPA 4PXDA 3D0HE 2FLPA 3M6UA 3N4WA 4A8SA 4ZVEA 1N8RT 1HQUA 2FHMA 1TK8A 1KLNA 4F4KA 4WF9Q 1Y00A 4FNHA 5D3GA 3QLHA 2DGWA 1RWUA 3RBEA 5KFVA 3VAHA 3NS5A 3DFEA 3I55S 2DPIA 1D9AA 4OI6A 3LP2B 2DGTA 2DHSA 2K8GA 2BDPA 4DLGA 4HDGA 5A8KA 1CEZA 4URSA 4DSKA 2AGQA 3FRZA 1J5OA 4GO7X 3V81B 4OL8A 2DNPA 3OPKA 1MMNA 1OPIA 4IR1A 1FKOA 2O01C 2WBRA 2EKYA 1VS3A 4N77A 3FDSA 1U2FA 3TYTA 3CO9A 3HZEA 4NL5A 3ZZYA 2GJ2A 4DV4F 1EETB 3H98A 5DO2A 1VC5A 3OXLA 2VFUA 1TZ0A 4TY8A 3TNVA 4HEA9 1ZH5A 1H0HB 3EGNA 2HPUA 5CZVA 1V6HA 2ACYA 4C0BA 3OL6A 1H2UX 4ZHRA 4Q2MA 3V4MA 5E41A 2QRRA 3GR1A 2GQCA 1S76D 2L48A 2DR8A 5JVHQ 1T3OA 3M4XA 5I4MA 2DRAA 3MD1A 2YNHA 4ZCLA 1RTHA 3CF5Q 1ROFA 1MW7A 5KOWA 2KDOA 3MR3A 2BUNA 3H2UB 2VODA 5GAHI 5HMYA 4NXMF 2JLFA 2DR5A 3SCLE 3N01A 2CIMA 2IVFB 5IZHA 1LWEA 1RT3A 4N8NA 3OUYA 2E9RX 3OFGA 1N36F 1HBOA 5KT2A 2FHOB 1WHVA 4CO5A 2JEGA 2PD1A 2SXLA 5DM7Q 3CD7A 1S1TA 3FEZA 1VK3A 2W25A 3HDSA 1TK0A 1LFWA 3M05A 4URGA 4LVOP 4ECSA 2XI2A 1T95A 3I96A 2ASDA 1TL4A 5D4NA 5KFRA 4XDDA 4DL2A 1CLFA 2MZQA 4Q8EA 2KM8C 5HP1A 2AJ1A 5IWAF 3M9NB 4OI0A 1W2BR 3J81Y 1JLCB 3KK3B 3VAJA 3IXQA 3UNGC 4DR6F 4NLOA 1NH7A 2J9DE 4JUZA 4C8YA 1RTJB 2CPZA 3EPIA 1S6QA 4I68A 1C4AA 1S6UA 3DC2A 2EG1A 4WYLA 1T03B 2ZE2A 4HTJA 2R7TA 1TL3A 2PFFB 2K1RB 1SH2A 2QSWA 1N88A 3DLGA 4QIGA 4IO1A 2NPFA 4RUCA 2YWGA 2XI3A 5KTQA 3KFWX 4IOBA 5KT4A 3B4MA 3SFGA 2IC3B 2MKJA 1KR4A 4Z37A 2UUAF 3C3LA 2AYGA 1FE4A 4PWUA 2VBZA 3T6BA 3DHXA 2FLNA 4C8OA 4U67Q 4DFMA 2IBOA 5C42A 2E5JA 3MHYA 4DL7A 3GQCA 1NKBA 2YWHA 3H4BA 2VUGA 4PXCA 4DR3F 4KFBB 1VK8A 1G1XA 4ID5A 1KVIA 5IT4A 2XWXA 4C0HA 2M52A 2JFDA 1WG1A 4WKYA 2MHNA 3FSIA 5J2NA 1X4BA 3EUNA 1S1WB 1GQEA 4MMOA 2XSJB 1JLEA 1YJVA 3J7Z5 4HL9A 4DR2F 5AE2A 2O3DA 3HVWA 3DLEB 2BBEA 2KFZA 5IFMA 3IG1B 4MFBB 2XMWA 1URRA 1X4AA 2RT3A 2MQQA 2LEBA 3KNGA 1N5VA 3PW5A 2FIUA 1T8EA 2UU9F 5DG8A 2CPDA 2GMHA 2RB7A 2V5HG 2KN4A 4O44B 2W4PA 1BD6A 1FKPA 1SJQA 3M30A 4RNNA 3KLFA 4EGLA 2UVUA 1LV5A 5GAGU 4Y2AA