5B0BA

Polyketide cyclase oac from cannabis sativa, i7f mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
92
Chain Sequence
AVKHLFVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 24
structure length 92
sequence length 100
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0bA00
4A48A 2ROEA 5B08A 1AW0A 4Y2MA 2GA7A 2QIFA 5B0DA 1S6OA 3BGUA 1YRXA 2ROPA 5T7LA 2FTRA 3DCAA 2OMOA 5B09A 2HIQA 4QOTA 2XMUA 5B0GA 3LGNA 2OFHX 4OJGA 2QLWA 2AJ0A 4Y2KA 3IWXA 3TOQA 4A46A 1Q8LA 5KAKA 1FEEA 3HFKA 2OKQA 3FRYA 2AJ1A 2K1RA 1TR0A 4DPOA 3DXSX 1Y0HA 3HX9A 3HHLD 4FNIA 5A6PA 2LXFA 1X0PA 3T9NA 5IXUA 2KT3A 4HH1A 2HFOA 2AP6A 2GO8A 2OAUA 3BF4A 4DL0C 1K0VA 1FESA 2ZDOA 2Q3PA 4A4JA 2GGPB 2LQ9A 1KQKA 3UDCA 4ZOSA 2BUNA 1OQ6A 2BJEA 2RILA 2XMKA 1AFIA 4Y2IA 4YDXA 3K7RA 5F0UA 5B0EA 2HLTA 3KNGA 5B0BA 3LO3A 4OJHA 1FE4A 2RMLA 2ROGA 2OD4A 2QLXA 4HH0A 2XMMA 1P8GA 3MCSA 1P6TA 1URRA 1Y3KA 1CC8A 1U7LA 2JDJA 2XMVA 2IFXA 1SQEA 4HI2A 3TNVA 2G9OA 1TL4A 3CJKA 5T7LB 3WDOA 4YEAA 3HF5A 4OJ3A 4NPOA 4NL5A 1MWYA 4EFAC 1FVQA 2HFNA 2N4CA 2N7YA 2OP5A 2W4CA 1YJRA 1KVIA 1TUVA 2K1RB 1OQ3A 1Y9OA 3QMQA 2L3MA 1FVSA 2IYGA 2KYZA 2LDIA 5B0FA 1KVJA 1SB6A 3HHLA 1Y3JA 3VTIA 1XBWA 1GXUA 3GZ7A 3BN7A 2N4DA 1X7VA 4FNHA 1N5SA 2HQIA 3FMBA 4OJ1A 1JWWA 1RJJA 1OSDA 2LQBA 1SI9A 3BB5A 2W4PA 3KG0A 4HL9A 2QYCA 1YJVA 1MWZA 2BBEA 2BJDA 3BR8A 4DN9A 1LQ9A 2KT2A 3I9ZA 2K2PA 4Q2LA 2AW0A 2EW9A 1FE0A 2W4DA 2HLUA 2PGCA 3E8OA 5K9FA 2K7KA 3KKFA 1YG0A 2ACYA 2XMWA 2FIUA 1N5VA 3HHLC 4U9RA 3QGPA 2GFFA 3F44A 1W2IA 4A47A 5B0CA 1WD6A 3BM7A 2K7JA 4HI1A 4F67A 1VQYA 2GCFA 3MZIA 1QUPA 1OPZA 1S6UA 2GGPA 2ZDPA 1Q4RA 2BYCA 1X8DA 2FB0A 2GV1A 2OD6A 1JK9B 4OIXA 4Q2MA 1APSA 3HDSA 1YJUA 2FHMA 5F0WA 1IUJA 1YJTA 1GXTA 2VV5A 3LGMA 3CJKB 5B0AA 2ASYA 3BDEA 3KG1A 1Q8BA 1ULRA 2CRLA 5A6WA 2OFGX 2RU9A 2VH7A 1R6YA 1VQSA 2XMJA 3IWLA 1TZ0A 1CC7A 1FD8A 1N5TA 2XMTA 2RSQA 1Q53A 1V3ZA 2IYIA 3FGVA 2PD1A 3HHLB 4ZA1A 3TRGA 2KKHA 1AFJA 1CPZA 1N5QA 1TL5A
chains in the Genus database with same CATH superfamily
2CA9A 1ZTTA 4NXNJ 1RHMB 3GILA 1Q5YA 4F26A 5LJ3Y 3KOAA 1H2VZ 4LF9J 4LQ9A 1DARA 5U47A 1DHMA 2RILA 2YWHA 4LSLB 5KFRA 2IDLA 2XCAA 2H48B 3QWPA 5M2RA 5GADU 3R5GA 2HVZA 1RAAB 2J6SA 4USIA 3OUYA 2W9CB 1DTQB 4C6AA 4CT8A 3M2UA 1U0HB 3R2CJ 2VQFF 4ALZA 4FF4A 2QV6A 3PY8A 1TKTA 3MPWA 2DGUA 2V50A 2N4DA 1C0UA 3CDWA 4B3RF 4H54A 1FKPB 2M3DA 4C0HA 3MAAB 4FS2A 2MSSA 1N6QB 5J2MA 4KPCA 4ECVA 1F5BA 2J76E 2NZCA 1Z2LA 2H54B 4JI2F 4WZQA 5HP1B 1MU2B 3CJQA 2HBZB 2NYIA 5A8WB 1B64A 2GMHA 2HFZA 2DRAA 3LPYA 2HNYA 2QLWA 5ETQA 1VLYA 1NDKA 2FLOA 2EKNA 1Q7YT 4DSLA 4DR3J 3N6MA 2IJRA 4ATNA 4OJHA 3HLUA 4P2XA 2CFXA 3GIKA 2YKMB 1UVMA 3C15A 3JQJA 1FFSB 4UQTA 4J5OA 2ZVIA 4YY3F 3E01A 4QIGA 3MXHP 5HROB 1AUSL 2IA6A 4OX9J 4RBVA 2BBEA 1ZH5A 2HYIB 5CD4H 3K5OA 1GAOA 4A47A 4J91A 1DLOA 4RUAA 2CNOB 3MUVP 1UAWA 3UD4P 3MR3A 1RISA 2IYIA 1JB0C 3SXLA 3MOJB 1KN6A 1XMQF 1HQ2A 4TU9A 2W25A 3UFCX 4K4XA 1NSPA 1IKVB 4G6VB 3I87A 3W5YA 4LIWA 4WU3A 2B51A 4HH1A 2FVPA 4B9UA 2C3OA 4LJMA 4OZ0A 1JNRB 3BKTA 2CWXA 2KVIA 4LSNB 1K47A 3PJXA 3K8WA 3IBCB 3T5LA 4CLLA 5CYQA 5LL6d 4GVLA 3MOZA 3BDPA 1NH8A 4DUYF 1S4EA 1TAQA 1VGYA 3D66A 3T9ZA 2C2RA 5I3UA 3M2VA 3Q24A 1TUVA 4A8FA 1SJ4P 3VGSA 4DCPB 1RT3A 2RH3A 1HNXJ 1N5SA 3THTA 1GMVA 5A8RB 4DEZA 4ZPVR 1HD0A 1RA7A 1RTHA 4B3MF 2PGCA 5E3QA 3CUNA 1IXKA 3FUYA 4DL7A 3SZ2A 4X2BA 1NHVA 2QMWA 4URQU 1N4LA 3PW5A 1F6TA 1O6XA 1XMOJ 1J5OB 2L08A 3FZ2A 4F4KA 3IWLA 2DXFA 4KKOA 3HKZD 2WVFA 4M95A 5B0DA 2YNFB 4YHHF 1RDRA 4CYUB 2BX6A 4Q45A 4B3OA 3H2LA 4LFCJ 4F04B 3Q8SB 2FVQA 3DRRB 2B6AB 1HHSA 4LFAF 1VC6A 3MCOA 2KT3A 3EPIA 4RBUA 4NX9A 3PVXA 3R6LB 1SQGA 2Z2YB 3MDFA 1IKWA 2Q1LA 3B78A 4RJVA 2Q66A 2HSEB 2JFKA 2HAFA 2ROGA 4FXDA 3UD5A 3B54A 1Y11A 4MT1A 5L46A 2X1BA 3RR7A 1IBLJ 3TX8A 2AX1A 4NCGA 1RZMA 4F2RA 3DOLA 4EUVA 5D4OA 1HI8A 2EK6A 1HI1A 1YZ7A 4CNYA 3VVUA 1R89A 4DBQA 1PCAA 2VFVA 1EX8A 2RQMA 1LWEA 1S12A 2QE5A 4MMOA 2WSEC 3NCPA 4M5JA 1SC4B 4OYOA 1S0OA 4NMLA 1N5VA 2CDQA 4I2QB 2JZ5A 2DEJA 4DX8H 1XK8A 2H3EB 1RT7B 3KJNB 1S1UB 2HHTA 4PUOB 4OV6A 3IS9A 2KXFA 2VBWA 4RW8A 3KMQA 2NSBA 1FRLA 2VFRA 3FMWA 4ED0A 2HQGA 2WVEA 1FNOA 4DV7J 4ILMA 4A8MP 2DJWA 4YDXA 1FXRA 1UEUA 1VK8A 3GV7B 5M2PA 4WTYA 3EMTA 1S77D 4USUA 3OJSA 4NLSA 5T7LB 4DLGA 3WDOA 3D0HE 5H9EK 4JI3J 2WSFC 1FERA 4F50A 1YJRA 5HMZA 3CULA 3B8HA 1EARA 3PHEA 1A9NB 4OHZA 3AD9C 4HL9A 4J7CA 1JJ4A 3ILJA 4IFYB 2K2PA 5LSLA 5AJ3J 2JLFA 1QJHA 2H4WB 4ECRA 2OI2A 2AJ4A 2KFYA 1HHTP 4J9QA 2PT0A 1UKUA 4OIXA 1PBAA 3UNGC 2L9NA 5B0AA 1HD1A 4N8NA 2O1PA 3WZ0A 1ZAXA 2E7XA 1GTHA 3BREA 1SL2A 3K0JA 1HARA 4O3QA 2CIMA 2CWKA 3LH2S 3KK3A 3O3LA 4G65A 4IOAQ 1OPIA 3AXKA 1UFWA 4KC5A 2N7CA 3IBWA 3HK2A 5B0EA 2YBVA 2CPZA 1QSLA 3C14B 5IT9Y 1YTYA 3WC2A 1VHFA 4KYZA 5HL7Q 2VPXB 2C2EA 3TUJC 3GONA 4MYUA 2LEPA 4NA2A 3T6JA 3H4BA 3PM9A 3DXBA 1SL0A 3RB6A 1HW8A 4ZVUB 3SDEA 2IY5B 1WC4A 3AQPA 4B3RJ 5KFJA 2DK2A 5B0CA 3GIRA 2DIVA 4EO6A 2IMWP 3UDVA 3G6ES 1Y5LB 2F4VF 2G0JA 2VF3A 3OXLA 2Q43A 4FKXA 1NB7A 2HHXA 2EFOA 5KFOA 2CPEA 2XSJB 2VUGA 4A46A 4EZ6A 2M2BA 1XQIA 2ZZTA 1LEOA 1REGX 3MM9B 3T9NA 3EWGA 3BF4A 4QWAA 1N5YB 2HS0A 4K50A 7FDRA 2QFIA 2RMLA 3IGVA 1P8GA 1NPPA 3D1QA 3HZEA 2EC2A 4LBIA 1D0EA 5LT5A 2F63A 3QO9B 3QLHA 2J8AA 2VJUA 4PWDA 2HQ3A 3IMQJ 2Y1JA 2IM3A 4O44B 5BYSA 4JI0F 5L39A 1YJWS 1K9MT 4IQXA 4DXLA 1HIYA 3SIPB 2LEAA 2NLWA 2EFGA 4MAKA 5KT5A 2BE7D 3CCSS 1HA1A 1VQNS 2LDYA 3PR4A 4R0JA 3KLIA 3IFEA 3SQGA 2FJWA 1RBLA 4NZ7A 2V9WA 2VQEF 5IT0A 5CH7B 4XO0A 3A8EA 3L7OA 3KK1A 3BKFA 3MD3A 3ULHA 3G8SA 3FZBA 3ITHA 2B5JB 3DRSB 3K5LA 3MEDA 5DLGA 2C2NA 4IOBA 4N41A 3VHQA 3EYZA 3FDSA 4KHMA 2IM1A 3G4SS 4NZ6A 2W9BB 2EG2A 4DFMA 3GV8B 3MCSA 4H4MA 5F8HA 3US5A 4DCJB 1S1WA 2AGPA 1OY8A 1QUVA 2ZHOA 4OI3A 1FDNA 4NLPA 4ILLA 4ZCIA 1I3OB 2E66A 2DNQA 4Y2CA 4PWWA 1RWOB 2VKRA 1OSDA 1RGVA 3H59A 3CTRA 4QYRA 4PR6A 3M30A 2D3ZA 3Q86A 3HJVA 2ZITA 1UWBA 4E2FB 2FLNA 4E8UA 1YJNS 2OD6A 2FJXA 1REVA 4O23A 1G4CA 4M5HA 2XI2A 3TRGA 1N48A 5KG5A 1QTMA 4F2SA 3KDOA 4FBTA 3QZ7A 1T02A 3Q8VA 5B0GA 4DOZA 3FBEA 1SUQB 4HT5A 4EMDA 1IKXA 3OXGA 4DF4A 4ER8A 1JLQB 3L7UA 4YOEA 4LFAJ 2RKIA 3MM8B 1UEVA 3I4HX 2GJFA 3EX7B 3LO3A 5AXMA 5KFHA 3MM5B 3V6HA 4P2FA 3M9OB 3NNHA 1JKHA 2VG7B 1T11A 4L3NA 3LQVA 1NHUA 4LRBA 1MG7A 2CKWA 3V5RA 2D1CA 1Y3JA 1A6LA 3PEJA 2M7SA 2WAQD 4JBCA 1IWAA 2CJBA 3C19A 4U9RA 2DR5A 1V6HA 2K7JA 3S1TA 5ADZA 1JLBA 1JK9B 1XR5A 4CZCA 3QJJA 2DPJA 4U7UK 4LFBF 4UUWA 1KQFB 3UR3C 4ZA1A 1N34F 1K8AT 5BJRA 4DV3F 4PPDA 1DRZA 1CBKA 1E6YB 5GMEA 3X1LB 1YJ7A 1FFWB 5KFAA 1TK5A 4J90A 1U2CA 2DCLA 4JV2A 1NHKL 4S0MA 2YWGA 2YNIA 4DUTA 2Q6BA 1KP6A 1UZHA 3AJDA 2JDJA 1RP5A 1JLGA 1GEHA 1IBMF 2N7YA 2F8HA 2UUBJ 2R7TA 4DHVA 3UD3P 3C2PA 3WX8A 3IRWP 3NGTA 4MKYA 2Y1RI 2ZM6J 4GO7X 1BHNA 2ZBIA 4NYPA 4OHXA 3NOCA 1WG5A 1NPKA 4RPFA 3G71S 3M9MB 2ZUAA 4FVCA 2DGOA 5GAGU 1NJXA 1LW0A 1M1GA 4ZVEA 4WFXA 1TP7A 4X4TA 2JC1A 2PN6A 3W2WB 2CVEA 2DO4A 2KHCA 4DV6F 3C3LA 1U8SA 4QBUA 2R3VA 4U95A 2EBEA 1S1VB 2F7VA 2HGLA 4O3OA 2UXBF 2MDAA 1URNA 2ZHBA 2IJNA 5KT6A 4CLSA 1JLCA 4I4BA 2DTJA 4KGZB 1UJ5A 4DR4F 3H2UB 2RQ4A 5EWEA 1AYEA 2UXDJ 1YITS 2DNLA 4LF1A 1I51B 1UMJA 3I6PA 5KFDA 2XYHB 4WIQA 2P2CB 2HQCA 4JV5F 3ETOA 2MY7A 2FUG9 1GMWA 1O8BA 1AZSA 4RWXA 2AEMA 3DM2B 3UVJB 1EETA 3I9ZA 2CQ1A 5GVQA 4OX8A 1CJTA 3AJ2A 2DY9A 4HACA 3PYGA 2OEMA 2R7QA 3G6YA 2WBRA 1NKEA 3NCQA 4EEYA 4PQUB 4CRJA 1VOMA 5HSPA 3DLGA 2VC0A 1EP4B 2V69A 3MMAA 3A4TA 3IAM9 4PXBA 3CXCR 2CVIA 1U1MA 1WC6A 1N33J 2M70A 3MEEA 4FXWA 2U1AA 3RJMB 3K5NA 1WKJA 3OL9A 2QL5B 3AA8A 4ZVOB 1X31C 2KU7A 2HRTA 3BGLA 3D28A 3VAMA 1TUWA 5ITHA 2YKQA 3PEHA 4K4VA 2HW3A 4MJKA 3LP2A 4ZVQB 4Q8EA 2KB2A 3G82B 3D0GE 1FJEB 4WKRA 5A0YA 3IXQA 4DR2J 1MROB 1FDAA 4DV2J 3EXYA 2KT2A 3T1YJ 3O1LA 4DDFA 3Q8PB 3KKFA 5T41A 3IRXA 5EHHA 1TL1B 1HLWA 1FCAA 3FSIA 4DV4F 5IM0B 1NXIA 2RF2B 2BJ1A 4E0DA 2QMUB 1ZM3A 3KK2B 2FTRA 3GIJA 1ZETA 2VBZA 1F5CA 2MB0B 3NMAA 1U4BA 2DGVA 1H74A 2B9WA 4PWUA 1CS4A 2R2TA 3EM1A 3EGVA 2F9JA 3LF0A 1N36F 4NMXA 2BDPA 2KRRA 3W7BA 3IA0A 3D1OA 2XG8A 1D1UA 2BE2A 3R7SB 3PJ9A 1M90T 1TL7A 2VPWB 3GFXA 1IQTA 1YKWA 2HWHA 3DMJA 3D6FB 2EWHA 1TFWA 3NOGA 1RUSA 6FDRA 5CYMB 1OQ3A 2BVZA 4X62F 5IQQA 3R5DA 1VDHA 2MQQA 5L9XA 5KFSA 1SH3A 4Y65A 1LW2B 1K0TA 1S5ZA 2NSCA 1RT6A 2FZGB 4WCEQ 3H5YA 2DXDA 3M32A 4U7CA 2LYVA 1GXLA 1OPZA 4ES2A 4FYWB 2RS2A 4NLGA 4DR7F 5KFEA 4O4GA 1Y00A 4C8LA 1TFYA 1X5PA 4OLOA 4W92B 3TA2A 4ANEA 3IR7B 4CO3A 5AT1B 2K8GA 3QT5A 3DRPB 3NGSA 1YDLA 4DI6A 1RWVB 4X66J 2HHVA 4X4OA 4AFFA 4P2SA 3CD7A 2CJQA 5IS2A 1NK0A 3RUBL 1PILA 4ECTA 2EKYA 3M6XA 3KLHB 3R5BA 2OH2A 1ZM4A 2VBXA 4PXEA 1WEXA 2J9EA 4WXOA 5LMNJ 1T8EA 5FDLB 2VA2A 4Y2AA 3DN9A 1AUDA 3MEGB 1DZ5A 1OIAA 1RWXB 5JVHQ 3TEGA 5HN0A 1U26A 5GADI 1ZAWA 3BBFA 4ZPAA 5KG7A 3RB3A 2NXCA 2YNGA 2B4OA 1VISA 4UY8T 1Z4UA 1TU0B 1BMQB 4DX5A 1QY7A 2HMIA 3GYNA 2OPRA 1ICEB 1VMBA 3KUHA 2DHXA 2AJ1A 2NXUA 3DLBA 2DITA 1YZ6A 3CCTA 4ILRA 5C24B 2W2QP 4U8VA 2RUGA 3NP5A 4JI1F 5JMNA 5DRKA 4N76A 1IVZA 3ICLA 3P8BB 2WVCA 3EVMA 2E5LF 4Q5VA 1RCOB 3W5ZA 3RBEA 2LU1A 3RW7A 1UW9A 4OJ3A 4FDFA 1NM2A 3I0SA 3PYDA 4ZN3A 3FBCA 4IDKA 2HNDA 4Y00A 2E5IA 1UPMB 2XGQA 3I82A 2OUGA 2XZDB 1RTIA 1TVRB 2BYCA 2JOQA 3HDSA 4M5GA 2YX1A 1RWNB 2I5JA 3MPYA 3KLGB 5J1EB 1TZ0A 4WJBA 3PHTA 4K0KF 1RHUB 2BQRA 2W2NP 3GPAA 5IZHA 4G1IA 9ATCB 2XBPA 3BGFA 5BYRA 2VFSA 5KG3A 1PJ7A 4W4MA 1ACMB 1TL3A 1Q86T 4NCBA 1C1CA 3ZZPA 4X64J 2W2PP 4C9DA 1KOOA 3BYRA 4JI5J 3LALA 2FLLA 1X4EA 2ATCB 4LF4F 4OZ5A 2MQNA 1IKYB 2KO1A 2HLTA 1SV5A 4DPUA 2DGTA 1GX5A 4EYIB 1L3UA 4ZVGA 4X4QA 2AIRB 1JXLA 2XHWA 1UVLA 3VGUA 2DBBA 4X4NA 3C16B 1M1HA 3K5PA 2JVOA 3KJQB 1XBWA 3QFHA 2CG8A 5J2QA 1T05A 2GO9A 2J0SD 1HMVB 4I2PB 1TMJA 5LSOA 1WUUA 1RAEB 2J0WA 1XNQF 2CAJA 4KAIA 3J81U 1VQMS 2KTQA 1HQEB 5C42B 1RE1B 3PG9A 4KV8A 3HHLB 3V81A 5E3AA 1Q8IA 3D3BJ 4NLYA 2V9KA 3W5XA 4QOTA 1UL3A 4FYXB 4WYLA 4C7QA 1CJVA 3UN5A 2EXUA 3RB4A 4PG7A 2ZD1A 3BSAA 5L1LA 2O5DA 2EFQA 2MGZB 2DH9A 3GU0A 1CJKB 2GVDA 3HVTA 1L3KA 3C6UB 5HMWA 2XZTB 2APOA 4LF8F 4BHQA 5DLFA 2HIYA 2GQCA 3F56A 5CCMA 4LF2A 3D0IE 3ZTOA 3VV2B 3R9LA 2LA6A 2DO0A 2V8PA 3MMCB 3TA0A 1X7VA 1F9FA 2WOMB 4B3SJ 4JI7F 2HVDA 3U02A 1LK7A 1DFDA 1RKJA 1BC6A 3HXMA 2G2YA 2EVZA 1H72C 4EYHB 2AYBA 3M8SA 1FX4A 1KOHA 1RLCL 3UDLA 4ED2A 3CCJS 3RU0A 1NK8A 1T9XA 2ADBA 2UXCF 4ES1A 3SCLE 3QRQA 2FY8A 3CJ5A 2EK1A 3EVWA 5K20B 3W65A 2QO3A 1GMUA 3G87A 3TVYA 1LWCB 2CADA 4YB1P 2ZEJA 1VRUB 1K1QA 3A3PB 4QWEA 3W2VB 2CQCA 1R27B 5JXSA 1V5VA 3ENVA 5KFCA 4GKJF 4QWBA 4DZDA 2HFVA 3UN3A 1R8CA 2NPIA 3SFGA 3CCES 1JLEB 3JSYA 1N36J 4NLTA 3N5FA 2OPPB 1CULA 1SQEA 3M1VB 1YX2A 3OT9A 3OV7A 4DV1J 3FEZA 1UP1A 1QAXA 3W9JA 1U47A 8RUCA 3F73A 2YH1A 4PEOA 1KVIA 5HLFB 5HVFA 3BQ2A 1LFWA 3CDEA 1SC3B 3GTYX 1TQLA 4BC7A 1RTDA 3G6XA 2BANA 4FNHA 4B3TF 5HQ8A 3H42A 4X62J 5ETRA 2XC9A 2KVQE 3L4BC 4DFPA 1RA6A 2R8KA 1I5OB 5J2PB 3F44A 1RBOB 2HAIA 1PGZA 2N82B 3RYLA 3N0VA 2UU9J 3L95X 4QU6A 1L3TA 4QR0A 2X3DA 4F0KA 2EFVA 2W1BA 3BSOA 2M0GB 1S6OA 4IOCQ 3T6BA 1HNZF 3U1LA 3CJ4A 1OJ4A 4IRKA 2DNRA 4F8RA 4CLUA 2ALYB 1R8PA 1OY6A 3KLEB 3KLFA 1F5AA 2FQQB 4IG3A 3OVSA 4X65F 4KO0B 3HD1A 3OL6A 2XY6A 2AU0A 4XIUA 4IH7A 1VRQC 2CPFA 1RTJB 1E6VA 2V8HA 4DU7A 3C6TA 2XS7A 1RWKB 2W7PA 3IN5A 1FTCA 1S72S 4O3PA 4NLRA 4UT4A 1IJEB 3CDBA 1P1TA 2D3O1 4ZVHA 2CQBA 1RHJB 2E1PA 1WC5A 2V8VA 4BCAA 2G0IA 4IG0B 1FJGJ 2XLJA 4UW2A 2HVIA 1HBUB 5IC6B 4WXWA 2EW9A 2DD8S 3HMJG 1FHTA 4NEYA 3PZPA 4NLVA 2FYXA 2E9TA 4L76A 4F25A 3IAS9 1ZBTA 3RW6A 2GHPA 5D3GB 4QW9A 4OI2A 1EQMA 3FFIB 3DKDA 2ROEA 2J6UA 2G2ZA 2XY5A 5DQGA 3PTWA 3KJFB 3T41A 5BYQA 2CJYB 1HNVB 2Y0SD 1FKAF 3IBFB 3FK4A 2DT9A 4L73A 2P9GA 2OAUA 2ZJRQ 2KT5A 1XWLA 1BXNA 2BUNA 4LVOP 1HQUA 3GWCA 5J2NB 2KH9A 2MXYA 4ZK7M 5AXLA 1VQ5S 3K8VA 3DLEA 5DDOC 2MY8A 5DQHA 4IR9A 2PMHA 4K8RA 2IM0A 2Z2MA 2ADCA 2AJ2A 1VRTB 1JJCB 3TA1A 2CQ4A 2C22A 2K1RB 2LDIA 1SB6A 1G7CB 3BEGB 2W2OP 2RHSB 4QCLA 2WCXA 2O67A 4BS2A 1SIWB 3BBCA 4K7QA 4KGKA 2QT7A 3E8OA 5LM7E 3PO4A 2W8LA 2I6WA 3P49B 3GB0A 1U24A 2MQ8A 4HI1A 1WDDA 3OW2R 2LU2A 1XNRF 3JAMU 2BACA 1HBOA 2ASYA 2Y1IA 1RQ0A 2XMJA 1K1SA 1OYDA 2JLEA 5M2UA 4RUHA 3PR5B 4NLQA 3GJSB 5KFIA 3HO1A 5CABA 1RSCA 1BQMB 3MMJA 4ZVPB 2HIQA 1WTBA 1D8YA 3CCVS 1YGYA 1BQNA 3W8GA 2Z58B 2VG5A 1KWMA 2JL9A 1N8RT 3FCWA 4BDPA 4TVAB 4LF7F 4J9PA 5DDRC 4RLEA 1S9FA 2ZH9A 1H6KX 1H7WA 3UPFA 3NGUA 1R0BG 3IO1A 1JIHA 5KFPA 5A8KA 4C48A 5K9FA 1I1GA 3MM7B 3QGPA 3R6GB 3EPGA 2EC0A 4MKAA 3VF0B 1FKOB 1T3OA 4F02A 1RT1B 2KHDA 2XMTA 2EG1A 4OI4A 4ELTA 3KXDA 4X4UA 4ETZA 1VC0A 3SYZA 4A48A 4DSIA 3TJAA 1KEKA 1MN7A 2WONA 4RW9B 4Y2KA 2ZE2A 1XC9A 4J9SA 2ZZNA 1WHWA 1NBEB 1FT8A 2F1FA 2K3IA 3HM9A 2BJ9A 1VR6A 4CH7A 4G1QA 4ID8A 2M9KA 3KYLA 3CDUA 4Y2IA 4URSA 5F0UA 3SSRA 3GMGA 2I38A 2BE9B 2ZBQA 3LWMA 1XIQA 1SQFA 4U96A 1N56A 2FHJA 4FYDA 1FVSA 2B9EA 1U6ZA 1GXUA 1WHXA 4WU2A 3FMBA 1RJJA 2ZH1A 5CCLA 3JB9k 3T19A 2Z8QA 4DN9A 4JI6F 2EBGA 2NXJA 3K89A 3DLHA 3MCNA 3M7VA 2FZKB 3TR5A 4RW7A 1VBXA 1VJWA 3IC1A 3D7SB 5HMYA 3MZIA 4MIWA 2C2MB 3OUYB 3M2UB 5AE2A 2DHHA 3MTKA 1TKTB 5I42A 1WORA 2HEKA 1HR0F 1C0UB 2J7KA 1U02A 4OJGA 4ED3A 4KB7A 3BYPA 1XERA 1A7GE 4OYWA 5J2MB 3IM9A 5T14A 4IUFA 2IRXA 2V2ZA 1RAFB 2XTJP 2R9LA 3P6YC 3EGNA 3DHXA 3Q8RB 4B9MA 1TV6A 1T0TV 2MKKA 4NA3A 3NGKA 3H5SA 4AYBD 2QSWA 4ID5A 3UQSA 1B0PA 2MKYA 2HNYB 1EQ0A 2HQFA 2RDDA 2QG9B 4QZVB 1IQZA 2CZ4A 2GJIA 3DOKA 5IT9U 1FDDA 2J9CA 1LKZA 5L9NA 4WF9Q 3TQEA 4X84A 4RO0A 4LF6F 3CCZA 1F3FA 3J7YI 4BBYA 2QGFB 2R7SA 1FDBA 4A8SA 2KM8C 2RVJA 3C15B 2HHQA 2RSQA 2G1DA 3LW5C 4GVBA 1AFJA 1ZPVA 3NEKA 3ENQA 3E01B 4TQSA 1Q82T 4O0NA 4C8YA 2MZJA 1VYAA 1BD6A 2V5HG 1HNZJ 1TR0A 4DUZF 3GJRB 4RNFA 1OY9A 4KBIA 1Q7LB 1PC5A 3R97A 1T03B 2E5HA 5GAGI 2AF6A 3UCUP 1F0XA 2CNNB 2ZDOA 3FCHA 1ZZNA 3QQCD 4TXSA 3GFZA 1DLOB 2GNKA 1QVGR 2NPFA 5I3PA 2R2RA 1NO8A 3H40A 2DNMA 4C11A 4WWSA 2CXEA 1RT4A 1MWQA 1FNXH 1KHWA 1S76D 1KTVA 2D69A 2HWTA 2ATLA 6FD1A 2C3YA 5CYQB 4HEA9 3SSQA 1AT1B 1YJUA 4DR1F 4OI0A 4K4SA 2BRLA 2U2FA 5K8MA 1BE4A 2FJAB 5I3UB 1UETA 1LWFA 3M2VB 2DR6A 2QTWA 1RT3B 2VKZG 2XMUA 5KAKA 3POTA 1NZ8A 3LP1A 1RTHB 2DGSA 4JP8A 3GFYA 2ZNZA 3AB2B 2AYGA 1TKDA 2RIJA 2HFSA 3J7AN 4WBFA 4WP8A 4OV1A 1R8HA 2HNZA 1O5JA 5LJ5Y 3D5MA 4KKOB 1RACB 3LANA 1YRUA 4PCQA 3AT1B 3UNYA 4B3OB 3HP6A 2RNEA 2YNHA 5KT2A 2H4YB 4OZNA 1U45A 1NJWA 1FJ7A 3CD0A 3DDIA 4K4YA 5A76A 2F40A 1IKWB 1WELA 3H90A 5J1PA 2BV3A 3OQ2A 1NK5A 2UVRA 3OBIA 2FHMA 5F0WA 1DQ8A 4HHHA 1XNRJ 4NCGB 3OSNA 5CAAA 3DOLB 3I0RA 3NNAA 4I69A 5DDQC 2ZH4A 3BGUA 3JTOA 3OTCA 1SJ3P 1NJZA 3ET6A 3MPDA 1LWEB 3D6MB 4ZVSB 5E3CA 4M1KA 3HT3A 5ETSA 5KFFA 2IMOA 1DJ0A 1WDTA 2HFOA 1NKCA 4FF2A 3KHRA 4CLTA 2BQ3A 3MF5A 4IYQA 3HVWA 1M5SA 3IS9B 4KGVB 2E7WA 3DGPA 4BC9A 4RW8B 2F8EX 2R7XA 4BLGA 3KJVA 4K4ZA 4DV5F 4USVA 2MHEA 1U49A 4KSEB 4M5LA 4TU8A 2ZH3A 4ZVFA 3IWNC 2DHGA 4IRCA 2Z57B 2DGWA 1KONA 4KHRA 4TY8A 2WB4A 1S57A 1IR1A 5D8HB 5EDWA 3N28A 5K8NA 1B70B 1GMWD 3DNCA 2JC0A 4LBPA 3I96A 2DR7A 3PV8A 3U27A 3Q8YA 2HBRB 4DL5A 3TQ1A 2W7AA 3JQKA 4KR0B 4ECSA 1S1TA 5B09A 1KLMA 4USWA 1IM4A 4IO1A 5DS7A 5IOLA 3NKYA 4OX6A 1SC1B 2XNRA 3DXSX 1NZAA 1YRTA 1R7IA 2HHHF 3AB4B 3AXMA 4PZVA 2VZ9A 4DR6F 1HL6A 4B9NA 4ETXA 2CZVC 2LXIA 3NLCA 2XHCA 2OPSA 4XPCA 3MI7X 1RAGB 4LR7A 3M8QA 4NLDA 3VAKA 2YKNA 1EZZB 4ZMMA 2IIHA 2BJ7A 1IBKJ 3KK3B 3V4IA 2NXNA 1RABB 4ES3A 3NY0A 1RT2A 1B99A 2Q79A 2HK3A 2HRUA 3DC2A 3M6VA 2DRDA 5K14A 3AY0A 2GFFA 4N8OA 1X5OA 3R2DJ 5JVGQ 2C1EB 4C3LA 2ZH8A 1F2GA 1UVKA 3M05A 4OHVA 4NWBA 4DG1A 3AJ1A 1ZZFA 2ROPA 4ANCA 1U1OA 3SDEB 3QGGA 4AL5A 2AJQA 4WP9A 5H9FK 2A1BA 4PQAA 7FD1A 2DNKA 2XS5A 2QA1A 2GS8A 3E3XA 2BKPA 2NQPA 3GP9A 4ED5A 2VU5A 3CB4A 3NG8A 3QT6A 2XMMA 2Y8WA 2WTFA 2C2DA 4HI2A 1TL4A 2YKAA 1S0VA 5EWGA 1FD2A 2DH8A 1MWYA 2OP5A 2J0XA 3SV3A 4DR5F 4PG6A 4R8UA 2HZAA 3HSGA 1SH0A 2WBMA 3CJSA 1OO0B 3CCUS 2P9EA 3ELHA 1H0HB 3NGRA 3CD5A 4F67A 3QLHB 1KC8T 4ICLA 3Q83A 4PWDB 4LF6J 3IR5B 4CLZA 1RB0A 4PG5A 3EUNA 4CCHA 3D6HB 4X4VA 2VDIA 4DL2A 1S6PA 3DDNA 3TO8A 3CGIA 4DUZJ 5F8GA 3RBXA 1RLDA 2FVCA 3TVZA 3KLIB 2ZJPQ 2ZOGA 3SQGB 2B3TB 4CLPA 2WW8A 4LR8A 4LUBA 5CYJA 3KK1B 4CI0B 3ITHB 1JJ2R 3NBPA 1T03A 2D41A 4DZ6A 3MEDB 5KFWA 5KT7A 4YMEA 4IFVA 2L48A 2DGQA 1RI7A 2E9ZA 2XLKA 4ZP6A 1U1PA 4P75A 1S79A 2FY1A 1NLKL 1YG0A 3GQCA 4DWIA 4NI2A 5KFBA 1QUPA 4ZP7A 1R6VA 4H4MB 4N77A 4QU7A 3TUZC 1RWWB 4AXIA 3DLJA 2ZHAA 2UUAF 1S1WB 2R8HA 5ETMA 3N01A 5A6WA 2KJWA 2AZ3A 2W24A 4NOHA 3PX6A 1ITPA 5ETPA 3OXFA 3R1LA 4NYZA 4X4RA 3HPOA 4O3SA 2O01C 3MTJA 3M8PA 3M30B 4FPRA 1YBTA 2W2MP 2JEIA 2R7OA 1UWBB 1VQ6S 1OSCA 3CPWR 2UV8G 2AHOB 5KFMA 4K5RA 4O3RA 1REVB 1RHQB 3BGRA 2IDEA 2QLFB 2FDNA 3NCRA 3AAWB 2ZBPA 4OX7A 3FBBA 1Q16B 3QT7A 1UPPA 1K44A 5CZXA 4ZDNA 1V5IB 4C3MA 5F9NA 2W7OA 1IKXB 1RYSA 3LUYA 5D4NA 4ED1A 2VL1A 3BN7A 3CJ0A 2Z0GA 4I1TA 3AFGA 2RKIB 2PA3A 3ADAC 3A1YG 2KZMA 2G2OA 3VVTA 1VQYA 4DL4A 2I2YA 3CMQA 1NNDA 2C28A 1JKHB 2CQGA 2UUCF 3CC4S 1S4FA 4TY9A 1M1KT 3T1HF 1LK5A 3CIZA 2RJZA 4RUCA 5LXRA 5LMUF 3H4DA 4H4KA 3D4JA 2MYFA 3QT8A 3NS7B 3KUGA 4USKA 1DURA 2K06A 2QLBB 4OFZA 2DNOA 2B0GA 3GIIA 1QD1A 3RRGA 3BQ1A 4P7VA 5HBMA 4I7FA 1JLBB 1NDLA 3AD7C 2BKNA 2FGCA 1AFIA 1S9GA 3CC2S 3ENWA 5HI7A 2CPIA 1HWLA 4WTOB 5E3PA 3NXZA 1CC8A 3OLAA 3H2VE 4GKKJ 3CJKA 4CH0S 4P72A 4RKUC 2ZC3A 1AB8A 4K4UA 4L74A 1S0NA 1X9SA 3EDQB 3BS9A 4F7VA 4HTJA 4DV5J 2CPHA 3RZAA 3D1HA 2K3KA 4P52A 1ZPWX 1YHQS 2YNIB 1FEHA 1WHVA 2RHQB 2HHWA 2Z56B 3AA9A 2XMWA 3HHEA 5DZ6A 4AL7A 2E44A 1F9HA 3UR0A 4PYDA 2J0QD 1JLGB 4LRCA 1NK7A 1VFJA 1H2TZ 4YUDA 3CCLS 1N54B 1KHVA 3H98A 4XAKA 4TKTA 1TKZA 1RU2A 3QNWB 5JUMA 4ZPTR 4EK2A 5CXTA 1T9UA 5E5NA 3LOUA 2ZH6A 4LMZA 1LW0B 4WFYA 3TJ9A 4FKYA 5G0RA 4J37A 2H51B 3TZWA 1DTTA 2WRMA 2GAHC 4JYAF 3TARA 1ZYQA 3PACA 4WP3A 1T95A 1HNWJ 1SJRA 1VBKA 4LRDA 2R8IA 1X4DA 3T5HA 1NEEA 4W98A 1V3RA 2MQOA 4ZIWA 2VFUA 3MHYA 2CUYA 4ENOA 1JLCB 3R1HA 3RG6A 2QYCA 2DIUA 2VC1A 4UTGA 4OYIA 5IC4B 1MMDA 1EKSA 3HVRA 4RW4A 3K17A 1R31A 5HAOA 2MKIA 1MMNA 5D78A 1AZSB 5KG6A 5IFMA 2IRYA 1WG1A 1AA1B 4RNNA 2IBOA 4LQ3A 1EETB 4KHPF 1Y0HA 4TYBA 1CJTB 5A6PA 2M4MA 4HACB 2FZCB 4ZHRA 3UWTA 4NXNF 3ONQA 3MAQA 3RR8A 4A8WA 2B4PA 3DLGB 4EGLA 2VQFJ 2OMLA 3CCRS 3IM8A 1CQNA 5IV4A 4CH1A 4AQYF 3BBBA 3MMAB 4RNMA 1FRHA 2KFNA 3NWGA 4C3KA 2C3PA 4TYAA 4QR2A 3LAKA 4O0IA 4ZCMA 4DPYA 2E7VA 3MEEB 5IWAF 3PX4A 4DF8A 2DR9A 2QX0A 2QA4G 4JI2J 2CPJA 2BJDA 4FS1A 3OHAA 3QRRA 5HMXA 3O44A 2KG0A 2P6TA 1WOPA 3DFEA 1IUJA 1YJTA 3RRKA 3TYTA 3LP2B 3CT9A 2XY7A 3ZC4A 3RAXA 2RU9A 2PFFB 3JQMA 4YP3A 3GCXP 1QAIA 2OEJA 1V3ZA 4IH5A 4GC7A 1YI2S 2OO4A 3R3TA 4N5SA 2GA7A 5A0YB 1G3OA 2CJAA 1PJ6A 1V3SA 2ZZMA 1FEEA 3FRYA 1RT5A 4CO4A 2HZCA 4R25A 1N0UA 1F9EB 3IRXB 4YR2A 4DU8A 2JNJA 3QGHA 3BO2A 3ETMA 2ABYA 1UEKA 3D9BA 5KOXA 5DGAA 2E29A 4Y3CA 2QLXA 2ZWPA 4YY3J 4USHA 3CEDA 1TKXA 2BR0A 1TTHB 3QAUA 2EI5A 4YEAA 2DNYA 1WHYA 1QDUB 4DR3F 1VQ9S 1R0CB 2FVRA 1JLFA 1KVJA 4IO9Q 4K2JA 3GZ7A 1CS4B 3CE8A 5KT3A 2RS8A 2QJ3A 2JX2A 2Z2ZA 4MK7A 2BE2B 1SKWA 3K2YA 1XMQJ 1TL7B 2B9YA 2XNQA 4OX9F 2QSFA 3DMJB 5GAHU 1YJ9S 4DL6A 2UUAJ 2UUTA 2E1MC 4PG4A 3KUEA 3UE2A 3ZFVA 2B7BB 3MR6A 1IBCB 3MR7A 3SEOA 2WZ1A 4L72B 1HBMA 3A13A 1HWJA 1RT6B 2BJ3A 2CQPA 4RW6A 2H5IB 2XCPA 2V94A 1DAXA 4DSKA 2BEFA 4USTA 1VQ4S 3M32B 2AP6A 3FBFA 1FESA 2IA0A 3QFWA 4H4KC 4ZOSA 4DUYJ 3NS6A 3OJUA 3KMSA 4O4GB 2HG4A 3JSRA 1XR6A 4F3QA 1VLOA 1WI6A 2GZOA 4QWCA 3OL7A 1QSSA 2JJ4D 2D3OR 1RAOA 3GLJA 2L9DA 4YS2A 4YN3B 1L5UA 1C0TA 3PCOB 3OR2A 5E41A 4B3MJ 2KYZA 2CJXB 2WK4A 3PW4A 5KFQA 3ZZYA 3KG0A 4LRFA 4C0BA 2NCKL 3HVAA 4CLFA 1S48A 4I67A 3FRZA 3BM7A 1HNXF 2GIQA 4G3IA 5KFVA 4DX6A 4J9MA 2RDIA 1NPRA 2EPIA 4YHHJ 3DI6A 2A0FB 3CD6S 2KZZA 1YLXA 3GR1A 5D0RA 3SQOP 1S59A 5I4MA 3CCWA 5JJBA 4O3NA 3T1HJ 1T9TA 2AT1B 2F3JA 4XPEA 3DCAA 4YR0A 1XMOF 3LP0A 1Q8LA 3BSCA 4M5KA 4PG8A 2O66A 4CT9A 1TK8A 1QAYA 1M5VC 2ILZA 4DJBA 3JYTA 2LA4A 5IT4A 4DPTA 4LFCF 2YNGB 3OFGA 4OZ3A 4QPXA 4HLBA 2JEJA 4NLOA 2I9SA 3DLKA 3I32A 1LXNA 2HMIB 2PIIA 2DKOB 4F4AA 3PRBA 3M2RA 2OPRB 1EB0A 3QSYB 1FWPA 4A8YA 4ED8A 2MLYA 3ZTPA 1FRXA 4EBEA 3WX4A 2CNKB 5H1SV 4YR3A 3K5MA 3OFHA 1N88A 1DQAA 3BB5A 1IBLF 1U6BA 4Q2LA 3W66A 2HURA 2V4JA 3JTPA 2L9WA 4NXMF 5F3TA 1G6BA 4R5PA 1GFWB 2NR0A 4HDHA 1XR7A 1Z1ZA 3I0SB 1T9YA 4KFBA 4IDKB 2HNDB 1C1BA 4G1PA 4UQGA 2MZSA 1CLFA 1JX4A 1L3SA 2VG6A 3R27A 4C8MA 2JEFA 4TLRA 5H9EJ 3IG1A 4LT6A 4PAAA 1RTIB 4DV0F 3DYAA 3J7YU 4CLKA 4DSEA 2DXEA 2I5JB 2HWIA 4FZVA 4MFBA 4U6PA 4EO8A 1I6JA 4C2MA 3I5AA 1URRA 1B0VA 2H1YA 2MMYA 2FGOA 4DV7F 3JSMA 3MMBA 3U7JA 3BO3A 2F65A 1TL3B 1U1NA 2QYGA 1C1CB 2D74B 2XZWA 8ATCB 1FK9A 1FWLA 2CYYA 5DG9A 2VD3A 1H2UX 2YVSA 5B7WA 3HD2A 1JLAB 1SV5B 3BV8A 1H73A 4YQWA 3L9ZA 4B9TA 2FHJD 1JQGA 2MKCA 4QR1A 2NZ4A 4J9UE 2OJ3A 5J2QB 3DGVA 1T05B 4YFUA 4NASA 2GJ2A 3OR1A 1CJUA 2HVEA 1LWXA 2NUUG 3M8RA 2GQ2A 2GVZA 1K73T 4DSFA 2HHPA 4KV8B 3O5TB 2OD4A 1WF0A 3V81B 5DZ7A 4AQYJ 1ZM2A 3AD8C 2LEBA 2HFNA 4FYYB 1EHWA 1CJVB 3AODA 4ED6A 1KSPA 4Q43A 1FX2A 3CJTA 1J27A 3MD1A 2ZD1B 5IWAJ 1FWKA 4DLEA 3QJPA 1J2VA 4NA1A 5E3RA 2F4VJ 2GVDB 5E0OA 3P45B 2G13A 3HVTB 1ZA2B 2IBKA 2JH3A 3LA0A 2KDOA 2GV1A 4DQQA 2BOAA 3JSBA 3V6KA 1WWHA 3TAPA 2DRBA 4A8KA 1HYSA 2V6AA 1WG4A 2XQCA 1WEYA 4WZMA 2BW2A 2MQPA 2A2CA 4CQ1A 3L3CA 4U67Q 2YY3A 3M6UA 4F0MA 1S49A 3FNNA 4YDDB 4B02A 1S1XA 4PXDA 1GH8A 1NMEB 5AXNA 4P10A 2YKOA 3M8YA 4NYOA 4NRUA 4WPAA 3VAGA 4HH0A 4JI0J 1UJ6A 2JEGA 3OVBA 2QL9B 1GTEA 2QEXS 1CVJA 4DPXA 3BZQA 3KWMA 3WIVA 3V6DA 2B4UA 3HHNB 4JV0A 5KFXA 2FVSA 2HQDA 1TUGB 3DOMA 3PRDA 1F3VA 5FLXY 2VICA 2VQEJ 1NRKA 2GX8A 4DQSA 1CULB 3ZZZA 2R4FA 3DRXA 2VH7A 3BSNA 3CCQS 4FF1A 2KRBA 1RTDB 2BANB 2ZH5A 4NEZA 2R42A 4P74A 1RYRA 4ZKAA 4OZ1A 1Q8KA 2J6TA 4RWWA 3A12A 5C25A 1R0AA 4NLXA 4KJIA 2HS4A 3VGTA 2MHNA 2A2DA 3MPVA 1Q78A 2M52A 1QVFR 2HK2A 2GIRA 1WJ9A 4QYZK 2ASDA 3HF5A 5DG8A 3I5BA 2GMJA 2XMAA 1KTQA 3GG1A 3CJ3A 2G1HA 1JNZB 3MECA 3G8QA 1TMMA 3GR0A 2P8IA 1T9VA 3KLFB 4IG3B 3EZUA 3QIPA 2IVFB 4Y34A 3TVKA 1E6VB 2K7KA 3HHKA 3C6TB 5EX0A 5KT4A 2GGPA 1OWXA 3JAMY 1ELOA 2MZQA 3R7NB 1VQOS 3BPDA 5D0GA 1Q53A 1RKIA 4Y0FA 4Q0BA 1I94F 3PDNA 1A0OB 2D9OA 1U2RA 3LGNA 2XYPB 3Q8QB 2KM8B 1P1LA 3FSXA 5ETLA 5DQIA 2GO8A 4ECZA 4J9KA 2FC8A 2IVYA 2RRAA 1PAUB 2QMXA 2FC9A 3KNGA 1UW4A 2V68A 1HPZA 4W90B 2FD2A 2XMVA 4OI6A 5GAEI 2IC3A 4F0HA 4JB8B 4ERDA 1HNIA 3A3NB 2B43A 2LKZA 1NAQA 2IYGA 5HVHA 4KTQA 1SKSA 1IN0A 4JUZA 2LQBA 1HQUB 1NKBA 4CLYA 4V19X 4LFBJ 2I1RA 1HBNA 5C2CA 1N34J 4NLWA 3DLEB 1APSA 2CJ9A 3U1MA 4DV3J 2MLXA 1QE1A 4NXMJ 3PW7A 2C42A 4FP9A 3JTNA 4FF3A 5HK4A 3MGJA 1FA0A 4DFJA 2PC6A 3ZTSA 2OKQA 1PKUA 3CJ8A 2LXUA 4FBUA 3B4DA 4TNOA 3CJ2A 2KJVA 4C8KA 1IBMJ 1HBOB 4KE5A 4DV0J 1LFPA 2RDJA 3UN2A 1SCJB 1IR0A 2RRBA 3ZNJ1 4WE1A 3D2WA 2Y9HA 2J7WA 3E51A 2MQLA 3DDKA 1NH7A 4J9LA 1Y9OA 1BQNB 3VTIA 2W9AA 4M63A 3NS5A 1VC5A 1SI9A 2VG5B 3WC0A 1MWZA 1Y7PA 1FO1A 4UOCA 3MM6A 2UUBF 1FRMA 3HSJA 4DV6J 4CTAA 4LIRA 5D15A 1WNEA 4F3OA 2ZM6F 1VQ8S 4FN5A 2UXBJ 3CIMA 3BH7B 2BM0A 1ZA1B 5KFKA 2V2KA 1TL5A 4ELVA 4H4OA 1M5HA 3DRYA 3H25A 1JLAA 3AQOA 5A8KB 4DR4J 3HFKA 4CNZA 3MFIA 4JV1A 4DPOA 2N3OA 4B9LA 2V63A 4FYVB 2X7IA 3PIOQ 4UZCA 1S9EA 7AT1B 2IAJA 4PRFA 4C98A 1WKKA 2ZBCA 3P3DA 4ELUA 4NZ0A 1WC0A 1F2HA 4JV5J 1U1KA 3H7HB 2KL8A 3TAMA 4Q8FA 4EBDA 1NB2A 4CM0A 1LV5A 2B7CB 2POKA 1KQSR 4L75A 4V1Ak 3RTVA 2VONA 5G4DA 2N4CA 2WONB 2ZE2B 2UXDF 3GJQB 3PYFA 2QL7B 1BQXA 2X3GA 3RB0A 3OLBA 2CPDA 3D6TB 1PYTA 3TEHB 4G1QB 2V34A 4OZ2A 3D54A 1J5EF 5IV3A 3FSYA 4ZN1A 2WVBA 3BH6B 2W4DA 1WF2A 3OVAA 3R5JB 2DPIA 4OLPA 3QBCA 3FEYB 3E2EA 1BWVA 2MPUA 4LSLA 4CO1A 1Y10A 3MCMA 3DU5A 4DMZA 4CO0A 4F3MA 2G4BA 5KFGA 1AW0A 4RNHA 3CNQP 4WK1A 3J80U 1B3TA 2W9CA 5I3QA 1DTQA 3NWRA 3ZZUA 3SCIE 4ZIVA 5GMKa 1U0HA 4LF5F 2MLZA 2BQUA 2XO7A 3F0NA 4RW7B 2HVHA 1FKPA 3NGDA 1U1RA 4B9SA 4ZP9A 3MAAA 4X4SA 4DS5A 1N33F 1N6QA 4BWJA 3JXOA 1KVKA 5I42B 2Y8YA 1QLNA 3TNVA 2FHOB 3N6LA 2LVWA 5HP1A 1MU2A 3FQKA 2OHDA 5A8WA 1NK9A 5KG0A 1HHQA 4UOHA 5E33A 2XWYA 1SJQA 3LGHA 2WHOA 1S10A 4MKVA 3PNIA 3W60A 4QPTA 4DV4J 1KQGB 2DNPA 4LSZB 3VQTA 1TV6B 4L6V3 3LPEA 3BPSP 1H3DA 2PFDA 4DR2F 4ID5B 3A3OB 4LR9A 4NRTA 3C8YA 3T5JA 5K5MA 4DV2F 3T1YF 3SSSA 3RBZA 5A2QY 2HGMA 2BW7A 5ETTA 4EZ9A 3H8YA 4I68A 4A8QA 3UI3A 2YKMA 1EJ7L 2WW4A 3DOKB 1X4BA 3MUTP 3LTOA 2YKPA 2UUWA 1PBUA 2X1GA 4UY85 5HROA 2VDHA 2AGQA 1WEZA 5IQ6A 5D77A 3TJ8A 4QYZJ 3OL8A 4GVBB 1Y3KA 3W8PA 2CJKA 2HFUA 4JOUA 2A6OA 2F4FA 1OMSA 1BUXA 3NAHA 2KXHA 3ISND 3THVA 3CO9A 4E98A 1YQHA 2MZRA 1AROP 4YB6A 2KI2A 4DR7J 1GK8A 1IKVA 4KGXB 3S6EA 2WVDA 1VCTA 2BA9A 4K4TA 3MR2A 1X4AA 2VODA 5CHCB 4C11B 2E5GA 3NL0A 1RT4B 4LSNA 2H65B 1NSQA 2NXEA 5BXIA 3ZZTA 2OPQB 3QIDA 2PD1A 4Y2MA 1D9AA 5D0EA 2OGUA 1I94J 5D4LA 4ECYA 3D68A 2LECA 1HWUA 2IM2A 4J9VA 3EVOA 4Y6IA 1SKRA 4C8OA 5A8RA 1FJCA 1SL1A 2AKWB 2VFTA 4X66F 1LWFB 4TN2A 2MQMA 4IRDA 3EICA 5C7PA 1UVJA 1VIOA 4ZVRB 1J5OA 3POTB 3WIUA 2GIFA 3LP1B 1VJQA 1WTFA 2CZ9A 4XTTA 3IGNA 3ILLA 3NRBA 1ZM9A 2YNFA 3FQLA 4CYUA 2KN4A 2HGNA 3HJFA 3MFHA 3J7Z5 5LMNF 4KH0B 3DRRA 1Y4ZB 2B6AA 4WKYA 4HYKA 3W9HA 4QW8A 2DVIA 2HNZB 4LBHA 4CO2A 2VV5A 1Q8BA 2Y3YA 2XYGB 2YNHB 3HCXA 1RWPB 1S7IA 4F4XA 4CDIA 1CPZA 3QJLA 1G2EA 3G96A 1CSJA 3SCKE 3PXGa 2R2UA 3UDEA 4JI1J 4IR1A 5THWA 5LOQA 2E5LJ 1GQEA 1S6QB 2UVVA 5F8IA 2RB7A 4UOFA 3GJTB 2DNGA 3GG0A 4I2QA 1RXOB 2ZOFA 3I0RB 2R8JA 5F3ZA 2B9XA 2AYMA 4O4RA 1RT7A 3A8JA 5D4PA 1S1UA 3ET6B 4PUOA 1OS5A 5EGYA 2UVWA 3M6WA 3FC9A 3CDAA 3W64A 3I9V9 3TI0A 3N4WA 2AD9A 1BWEA 5FIIA 1WACA 2H5EA 2FIUA 2OTJS 1W2IA 4ZP8A 4K0KJ 1WOSA 2V8DA 3DGPB 2ZDPA 4ECWA 3Q8UA 2N3LA 2B8QA 2B8PA 2I0XA 4HKQA 2ZH7A 2P5VA 2JFDA 3KJVB 1OYEA 3OD2A 3PYEA 5J1NA 4ZLJA 2OELA 3GFHA 3I31A 4RBTA 5T7LA 1U8WA 4GRSA 2FHKA 3X3UA 4LF4J 4U7UD 4R0EA 3HKWA 5KG2A 4HT7A 4TY8B 2XI3A 3GSDA 3HHLD 5C5JA 1XN9A 3OFEA 3QAEA 2XM3A 2ALZA 2LQ8A 4JI8F 2BJEA 5GAHI 3EGWB 4IFYA 4M5NA 3KHLA 2LP4A 3KDNA 4X64F 3OFFA 1P6TA 2XO6A 3VAIA 1ROFA 4JI5F 3DU6A 1KD1T 2DCUB 3R8YA 1FXLA 1X5SA 4PABA 1S1TB 3UO0A 1KLMB 4AT1B 2ZKUA 2W4CA 1M5PC 3AOBA 2DR8A 4K4WA 4WFZA 4YB5A 1D09B 3I4PA 2WB1D 1XNQJ 4KRWA 2CQDA 1YK9A 1T3NA 2J8SA 3O8WA 3MR5A 2KG1A 2OPSB 1J5EJ 1D9DA 3M8QB 1D9FA 2YKNB 3V4IB 4MTPA 3CC7S 3C14A 2R8GA 1PJ5A 1RT2B 2MEWA 2XS2A 2PO4A 5K14B 4LF5J 3TUIC 5HJYA 4LF8J 4HR2A 2C3UA 4ITSA 4DQRA 2YPZA 1T94A 1B7YB 4DG1B 3R5CA 3OSPA 3ZTQA 3KG4A 4M5MA 5HATA 1VQ7S 1PSDA 1W7WA 1Y5IB 4JI7J 4JI4F 5MLCV 1UFKA 2CPXA 4B17A 2EEYA 1CG2A 1Q5VA 2VPYB 4EWTA 1X5TA 1UVIA 2XSJA 4M5IA 2Z4PA 2W4PA 4P73A 4WFNQ 1YJVA 3MM9A 2UXCJ 3CCMS 2QA4S 2UVUA 5HANA 4B3SF 3KHGA 1NDCA 1N5YA 4F4ZA 3H5XA 5F8JA 1N5TA 1MNEA 2RE1A 4R8UB 2KKHA 3QO9A 5FD1A 4CP5A 2DEIA 4QQBA 1KFSA 1EKRA 2PE8A 3QRPA 4GKJJ 2OSRA 4O44A 5ETOA 4KQZA 1RK8A 3PKYA 3AOAA 1M5OC 1S99A 1GNKA 5KFLA 4ICLB 3GCWP 3BKUA 1O0PA 1FE4A 1LXJA 2KFZA 1H38A 4ED4A 3SI8A 3H20A 3LAMA 3VR1A 4B3TJ 1SPBP 3OTEA 4CLWA 4LVNP 4NPOA 5L1IA 4C8ZA 5D6GA 2IVMA 1S6PB 3VQSA 3OTBA 5KOWA 4RL1A 2HQIA 2JSXA 1SVDA 4DV1F 3P4UB 4K2XA 1TK0A 2QN6B 3F41A 3HFZB 2B5JA 3DRSA 1RAHB 1KLNA 1UA0A 2AJFE 1KNZA 1WI8A 1D8ZA 2YXLA 3V2UC 4L3KA 2W9BA 4ZLPA 2DGXA 3W3SA 2KXNB 3NBPB 2GHVC 1PYOB 3QGIA 2CQ3A 5K8PA 2HBQB 3UW1A 4RU2A 4IFVB 2UU9F 2LQ5A 3TX0A 1N0VC 4X65J 1RHKB 4IH6A 4OI1A 3M4XA 4ZLNA 4OYMA 1X0PA 2P6SA 4NI2B 1CEZA 2ZBRA 4K5SA 2PI4A 1U25A 1KS2A 1NJYA 2OPQA 4OHWA 1NSKL 4QIFA 2HKEA 4ZCKA 4DSJA 3S7RA 4USJC 3HHDA 1M5KC 3M8PB 3P5TL 2CQIA 3B6BA 2JHEA 2XB2D 3BGRB 1SUQA 5GMDA 3CMAS 2QFJA 1VIXA 1WC1A 4DPWA 1VQLS 3TW0A 1JLQA 3V6JA 1NSAA 1SXLA 1FJGF 3CF5Q 3ISZA 3MM8A 2D9PA 1RHRB 5AXKA 4DN0A 4DQIA 3MM5A 5AE1A 5EWFA 2J9DA 2VG7A 1JMTA 1P9QC 2DHSA 2VOOA 4F4YA 1ZAVA 1YIJS 2GMLA 4M5DB 1LNQA 2F5GA 1PIEA 4Y28C 4C4WA 3SFUA 3O6QA 2A10A 5F8NA 3FJ2A 4LREA 2Z2LA 4ZPDA 1VI7A 1QM9A 3WHIA 1HWKA 1U7LA 1NK6A 3GIMA 2HBYB 2XSFA 4FPIA 4A8XA 3VAFA 4RUBA 1X4FA 1R43A 4MYTA 2ZVSA 1S6QA 1NUEA 2ZFHA 1JWWA 5HBMB 4I7FB 2FJVA 1S9GB 1XMBA 4M8LA 1E6YA 2AGOA 3DHWC 4MK8A 4TLQA 1KKHA 1SJFA 4USMA 3CJKB 2PMWA 3CSKA 3Q89A 1R6YA 2YWFA 1KBRA 1CC7A 4KPYA 2LCWA 1WC3A 1R8AA 2JLGA 1SBRA 4PXCA 1HI0P 2DHAA 3GSIA 1YRXA 5DETA 3I56S 3TOQA 4P6QA 2P9CA 3H5UA 3PFEA 3SCJE 2RUSA 9RUBA 4LF7J 1IR2A 4ECQA 1PYSB 2OSQA 5L38A 3D67A 4JI8J 5B0BA 2CQ2A 1PAEX 4F4WA 3C46A 2MKJA 3WBZA 4I64A 1RAJA 5FJ4A 3VAHA 3RRHA 4ANDA 1TKZB 1P9YA 2DISA 1U1QA 5KTQA 1FTRA 3W2WA 2XULA 1ZS6A 4OYZA 5B0FA 2X1FA 4I0WA 4URGA 4XDDA 3J7ZT 2RRNA 2ZOMA 4ZPCA 3FEXB 1S1VA 1YVFA 3BR8A 1U2FA 3HULA 5G0RB 3G2XA 3PW0A 1DTTB 4C8NA 2V67A 1VBYA 1RBAA 4MIAA 1CQMA 2KYXA 5D0HA 1B7FA 3RAQA 4IQMA 3J7A1 2E1AA 3GYGA 1ZOTA 1XTZA 1VQSA 3HI9A 2IHR1 3PW2A 2NREA 1Q79A 2GAGC 2MZTA 2JRSA 2BM1A 2OMOA 2ERRA 3IWXA 1Z2ZA 2V8GA 2BOPA 2YX7A 2COLA 1KQKA 4P9SA 3DM2A 4RW4B 5LXYA 3UVJA 8AT1B 2J9DE 4AUKA 4QIWD 4PQUA 3TZYA 3QZ8A 1YWXA 2E9RX 1JJHA 2MJUA 3N79A 2XGPA 1FNMA 4JI6J 4JI4J 1PC4A 4K59A 1EP4A 3TZXA 4FVMA 1T9WA 4C97A 3QYYA 2OLWA 3TANA 4ZHRB 4UOGA 1MLAA 2BRKA 2EFNA 1L3VA 4KH1B 3NNCA 2W8KA 1YBAA 5SUHA 2LQJA 2ACYA 3OTOF 2RT3A 4QIEA 4D3GA 5GAEU 4J9RA 1HR0J 1P27B 2M5YA 1GXTA 4I56A 2A3JA 1DY3A 3PIPQ 1M0SA 3U1NA 1NU4A 4KIAA 4I6YA 3ZZOA 3G82A 4ECUA 3A8KA 3MAHA 2B4VA 4AD6A 3EZ5A 2LQ9A 1FFGB 1MROA 3JS9A 1T7PA 2MKSA 2ASLA 1N32F 1TL1A 1HW9A 4N47A 5CZVA 2AYEA 1Y5NB 4Q44A 3BJYA 4DL3A 5DO2A 1WKLA 3T1AA 2R7VA 5IM0A 1JXEA 3ZXWA 1Q1KA 1RT5B 4HHUA 2RF2A 3ILOA 2FLPA 3NMRA 3KK2A 1FRJA 4DS4A 5L1JA 2VJVA 4XK8C 3PKMA 1EIYB 2RQCA 3VZHA 3B4MA 4B9VA 3DLLQ 1Q4RA 2FB0A 1TKXB 1UZDA 2O3DA 2J5AA 4P2MA 2OFGX 1Q81T 3MWBA 1JLFB 5L1KA 2GHWA 5CYMA 1B4SA 2IJFA 2XWXA 3G9CA 3HSDA 1UVNA 1LW2A 1X0FA 2X1AA 2Q6CA 5C2GA 1HWIA 3W9IA 3BGOP 3PRVA 1H98A 1WOOA 2PDAA 1HBMB 3AH6A 1VBZA 3OHBA 1FVQA 3O2IA 3HZGA 4RW6B 3BR9A 3EXCX 1HFEL 2BZ2A 1WSVA 3OPKA 3PFOA 3DRPA 4DR1J 1BGXT 3M9NB 2GW8A 3SMZA 4Q2MA 2M88A 2Y1LB 4C0OC 1DBDA 4U8YA 1C0TB 4CIOA 3ZO7A 3OR2B 3HFVA 1FD8A 3J81j 2AX0A 3PJWA 3KLHA 1MW7A 3EJMA 5HJXA 5FLXU 2BMBA 1SJ1A 4PKDB 2OFHX 5ETNA 3L7PA 5FDLA 3S01A 4FNIA 2AEJA 2UV8A 4Z2XA 3KNAA 1PO6A 1NK4A 3MEGA 2DY1A 3BN4A 3UDCA 1MN9A 1X4CA 3DI6B 4NLUA 3PO5A 4ED7A 2E1CA 3ZZRA 2L41A 4ZLLA 1MMLA 2QRRA 4M5DA 2ZNYA 4I6WA 1X60A 2OTLS 3LP0B 2AV5A 2C2OB 3G8TA 1TELA 3CMES 1R8BA 3QMQA 3M8WA 3RBDA 3TWZA 2RD5C 3JYTB 2J7UA 3CW2C 1VK3A 4UZBA 1XJWB 2H5JB 4QJVA 2RU3A 2IRUA 5F8MA 3DLKB 5C24A 5DJBA 5KFYA 1KR4A 1SKUB 3K59A 2NUHA 3M2RB 2MSTA 5BR8F 2VPZB 1Q0NA 2A18A 5B08A 3OTDA 1RTZA 4OZJA 4J9NA 1RADB 2HPUA 1SH2A 2VBYA 2YWWA 4AXJA 4OYXA 1U0SA 4MIBA 5AE3A 2C2ZB 1RWMB 1YBUA 2DNHA 1UCNA 1UWAA 1BY9A 1B0TA 2YTCA 2V4JB 2ZC4A 2BJ8A 2F9DA 1NDPA 4R5PB 3ZTRA 4QWDA 3EZOA 4KFBB 1TVRA 4HDGA 4RU9A 1C1BB 4NE9C 4ZJOA 4NL5A 5F8LA 5J1EA 3KLGA 1VQPS 2VG6B 2YWEA 3V4MA 2L3MA 4DX7A 1IM6A 3W62A 2WSCC 3K57A 3IG1B 2NYHA 2BXJA 1PG5B 4MH8A 1AXQA 3DYAB 1QTNB 2CQ0A 2FJEB 1XEZA 1FE0A 2QC3A 2MZ1A 4MFBB 2R7WA 1C4AA 2X51A 3THPA 3TZZA 3LGMA 5DGBA 3JSMB 1IKYA 3MMBB 3WQPA 2IPOB 4ZS6A 3R7BB 3HSZA 4DQPA 3UCGA 2HHHJ 1FK9B 4DR6J 5EN1A 1DQ9A 3QATA 1LOUA 3C16A 3AOCA 5CA5A 2ASJA 1WF1A 2MKHA 1OQ6A 3TP2A 3EE3A 3SV4A 3T5KA 1HMVA 2C3MA 4I2PA 2D7SA 4LRAA 2PEHA 3G86A 3N6NA 4OMFG 1FXDA 2G9OA 1HQEA 5C42A 1FF2A 3IR6B 2D3UA 3HHLA 3VALA 5E7OB 3M8ZA 5RUBA 3OR1B 1CJUB 1IBKF 4FXVA 4D3HA 2ZH2A 3RAMA 1LQ9A 2GVZB 5KFNA 2E1RA 1FI4A 3N5BA 2LLZA 3TAQA 3K58A 1UTAA 5H9FJ 2MGZA 4RNOA 3UCZP 3OTOJ 2V2QA 1CJKA 4WFBQ 3Q0AA 3CO0P 2XLIA 2HZVA 4CM2A 5KFUA 3C6UA 2CPYA 4J9OA 3BQ0A 2V4RA 1W26A 2JVRA 3VZIA 4HHJA 4KGMA 2QIFA 1F60B 2QLJB 3ILIA 4LF9F 2HHSA 2PEBA 3TUPA 4CO5A 4ZITA 2LXFA 3FCVA 3MMCA 5HO4A 2WOMA 3KTQA 4DL0C 3CWJA 4ZJQA 1EAYC 3D3CJ 5DM6Q 1UFLA 4N7TA 5SZTA 5F9LA 4DR5J 1U48A 1HYSB 2FJBB 2VASA 3MPUB 2HHUA 5MAOA 1X9MA 3FVYA 2V2VA 5CQGA 4RZRA 1N32J 4KY3A 4OYPA 2DB1A 5DG7A 5HQMA 4CWBA 1C2PA 3I5CA 4UF4A 5KFTA 4QIVA 5CD4A 1S1XB 2E5JA 4ZPBA 4ZCLA 3ENAA 1LWCA 4Z37A 1VRUA 4WIIA 3W2VA 3CVKA 4ZJLA 4N56A 2VHGA 4M94A 3AHPA 1ULRA 5KG1A 1JLEA 2ILYA 1MSWD 3V6DB 2OPPA 3M1VA 2VIHA 2AJ0A 1U6FA 2UZAA 2RQKA 3DOMB 2VA3A 5HLFA 4RR5A 3ISNC 4UUXA 1K0VA 4YB7A 2Q3PA 2R7RA 3GV5B 3MURP 3K7RA 5J2PA 1W25A 2B56A 4Z7CA 1KDNA 2F8MA 4A8OA 3S8SA 2IFXA 2CG4A 4DFKA 4MK9A 3W63A 2OIHA 2EFPA 2LFVA 5C25B 1R0AB 2LMIA 4MKBA 5EUHA 3I55S 2M8HA 2R7UA 2YWKA 3P5BP 4ZPWR 4TU7A 3EGZA 5DDPC 4OJ1A 2ZJQQ 3W61A 3H0PA 3PX0A 2AMCB 3R5AA 4GMKA 1QSYA 2HRYA 1VHIA 2VOPA 3KLEA 6AT1B 2MTLA 4KO0A 2Z30B 3BDEA 1RTJA 3ZNUA 3FGVA 1O51A 2DH7A 1N5QA 2ACMA 3MECB 4HVZA 1TAUA 1X9WA 2DYAA 4ECXA 3CJRA 3QPIA 5KFZA 3QIPB 2Y0BB 5HVGA 2GC8A 3KHHA 1GT8A 5A2QU 3Q2SC 4IG0A 2GGPB 4A4JA 2XMKA 2C2KB 1HBUA 3BO4A 1VS3A 4P71A 2AWZA 1S97A 2ZKTA 4Q0BB 2H9ZA 4AL6A 2DNZA 3MUMP 3Q22A 1X4HA 5D3GA 3FFIA 3FKBA 4XDCA 3HT0A 2UP1A 4Q7AA 4GO5X 1R3NA 2UUCJ 2YPYA 1HNVA 2AW0A 2AZ1A 4PYAA 1IWGA 4ZVTB 1HPZB 2V0NA 1S6UA 5LMUJ 1X8DA 1RU1A 3W1YC 1GX6A 4AE5A 1RAIB 2VB6A 2IC3B 5J2NA 1FRIA 2CNLB 1HNIB 5KG4A 1FRKA 3Q23A 4KT0C 1WSRA 5ETKA 5BR8J 3NAIA 2NS1B 2PMZD 1D3WA 1Q95G 4GC6A 5ETVA 2YQ0A 5L8RC 1VRTA 1V9OA 1UA1A 2K1RA 3HX9A 3KFWX 1HBNB 4TQRA 1IJFB 5IXUA 2JWNA 2XEXA 1JXVA 1SIZA 5DM7Q 1ZTWA 2PSZA 4X4PA 2CQHA 1U1LA 3SBMA 1QE1B 4RX6A 4B08A 3QWUA 2CDRB 1KRPA 5K8OA 1SC6A 4WFAQ 2OEKA 4OYBA 4NCAA 4OZLA 1HKAA 5LSRA 3GYXB 3J81Y 3P96A 4DCOB 1BQMA 4GKKF 2MJNA 4WYWA 2YQ3A 3C66A 2I8EA 2PA8D 3HHLC 3N9UC 1KFDA 1YSJA 3IP0A 3Q2TC 4WE1B 3EDRB 4IKAA 1X4GA 2FPHX 2RAQA 2G0CA 1VQKS 2AQ4A 4BWMA 5HQLA 2DNNA 3J80Y 2A6MA 2ZUGA 1U09A 1S7HA 1W2BR 2HS3A 4Z7YA 3MEKA 3MM6B 4PPZA 3LWLA 3L09A 4OYAA 4CTAB 4JYAJ 4F36A 3B82A 2YX4A 1RWUA 4HTIA 3QSIA 2R2SA 3MM7A 2V4QA 1NCLA 2AEFA 3GE9A 4JI3F 1UJ4A 4H4OB 4V19J 2GQQA 1FKOA 1H7XA 4EFAC 2PI5A 1RT1A 4EU0A 1BLUA 4OQJA 3RGIA 4I6AA 1G1XA 1N52B 3T3FA 2FJDB 5F41A 1S9EB 1C4CA 2IAJB 5EX3A 1HNWF 2M8DB 4WK3A 3ZZ0A 5AJ3F 4OL8A 4RW9A 3KLVA 3VGVA 4EI2A 2BKOA 2ZWOA 5E2QA 1S0MA 2W01A 2HLUA 3TAMB 1WD6A 4EBCA 2QA2A 2GCFA 3A8IA 1RCXB 4OHYA 3VWSA 1NJIT 3G6VA 3VAJA 2BABA 3KG1A 2CRLA 2YH0A 3VCDA 1F1BB 4KHPJ 1QAJA 2QZ8A 2YQ1A 4P7TA 2SXLA
chains in the Genus database with same CATH topology
5IFMA 2IRYA 1ZTTA 1RT2B 1WG1A 4NLYA 2V9KA 2XS2A 3GILA 4RNNA 4QOTA 1UL3A 2IBOA 4LQ3A 4WYLA 4C7QA 2PO4A 1EETB 4F26A 4KHPF 5LJ3Y 3KOAA 1Y0HA 4TYBA 5A6PA 5K14B 1H2VZ 2M4MA 4LQ9A 3TUIC 3RB4A 4PG7A 4ZHRA 2ZD1A 3UWTA 3BSAA 5L1LA 2O5DA 1DARA 2EFQA 4NXNF 2MGZB 2DH9A 5U47A 2C3UA 4ITSA 1DHMA 2RILA 2YWHA 3ONQA 4DQRA 3MAQA 4LSLB 3RR8A 5KFRA 4A8WA 2B4PA 3DLGB 4EGLA 3HVTA 2XCAA 3QWPA 1L3KA 1T94A 2OMLA 3C6UB 5HMWA 3CCRS 4DG1B 3OSPA 3R5CA 1CQNA 3KG4A 5M2RA 5GADU 2APOA 4CH1A 4AQYF 4LF8F 3MMAB 4RNMA 1FRHA 4BHQA 5DLFA 2HVZA 1VQ7S 2KFNA 1PSDA 1Y5IB 3NWGA 4C3KA 2J6SA 2GQCA 2C3PA 4TYAA 4USIA 3F56A 4JI4F 5CCMA 3OUYA 2W9CB 4QR2A 1DTQB 4CT8A 3LAKA 4O0IA 3M2UA 3D0IE 4ZCMA 5MLCV 2VQFF 4ALZA 2CPXA 4FF4A 2QV6A 4B17A 3MEEB 5IWAF 1CG2A 2LA6A 2VPYB 2DO0A 3PX4A 1TKTA 4DF8A 4EWTA 2DR9A 3PY8A 3MPWA 1X5TA 2DGUA 3MMCB 2N4DA 3TA0A 1X7VA 1F9FA 2WOMB 1C0UA 4JI7F 2XSJA 1UVIA 2QA4G 3CDWA 4B3RF 3U02A 4H54A 1FKPB 2M3DA 2Z4PA 2W4PA 4WFNQ 1LK7A 1YJVA 2CPJA 2BJDA 4C0HA 1DFDA 1RKJA 1BC6A 4FS1A 3OHAA 3HXMA 4FS2A 2MSSA 1N6QB 3MM9A 5HMXA 3O44A 5J2MA 3CCMS 2EVZA 2QA4S 2KG0A 1F5BA 4ECVA 2J76E 2UVUA 4EYHB 2AYBA 3M8SA 4B3SF 3KHGA 2P6TA 1N5YA 1Z2LA 4F4ZA 1KOHA 3DFEA 3UDLA 1IUJA 1YJTA 4JI2F 3RRKA 4ED2A 3H5XA 4WZQA 3TYTA 3CCJS 3LP2B 3CT9A 2XY7A 3RU0A 3ZC4A 5F8JA 5HP1B 3RAXA 2RU9A 1NK8A 2PFFB 1MU2B 2ADBA 2UXCF 2NYIA 3SCLE 1N5TA 4ES1A 5A8WB 4YP3A 1QAIA 1MNEA 1V3ZA 4IH5A 2RE1A 4GC7A 1YI2S 4R8UB 2KKHA 2OO4A 3R3TA 1B64A 4N5SA 3QO9A 3CJ5A 2GA7A 5A0YB 1G3OA 2GMHA 2EK1A 2HFZA 2DRAA 3LPYA 2HNYA 5FD1A 2CJAA 2QO3A 1V3SA 4QQBA 3TVYA 1KFSA 2QLWA 1LWCB 2ZZMA 4YB1P 2PE8A 1FEEA 2OSRA 1VRUB 3FRYA 1K1QA 1RT5A 4O44A 4CO4A 2HZCA 4QWEA 4R25A 4KQZA 3W2VB 1RK8A 1N0UA 3IRXB 3PKYA 4YR2A 1VLYA 2CQCA 2FLOA 1R27B 1M5OC 3QGHA 3BO2A 1S99A 1GNKA 5JXSA 2ABYA 1Q7YT 3ENVA 5KFLA 5KFCA 4ICLB 5KOXA 4QWBA 5DGAA 4GKJF 4DSLA 3N6MA 1R8CA 2NPIA 4ATNA 2E29A 3SFGA 1O0PA 4OJHA 1FE4A 3HLUA 3CCES 1JLEB 1LXJA 1H38A 2KFZA 3JSYA 4Y3CA 2QLXA 4NLTA 2CFXA 3N5FA 3SI8A 3H20A 3LAMA 2OPPB 4USHA 3CEDA 3VR1A 1TKXA 2BR0A 3GIKA 1SQEA 3M1VB 2YKMB 3QAUA 1UVMA 2EI5A 4YEAA 2DNYA 3OTEA 3OV7A 1WHYA 4LVNP 4NPOA 3FEZA 4DR3F 1UP1A 1QAXA 5L1IA 1U47A 3F73A 4C8ZA 2YH1A 1VQ9S 1KVIA 4UQTA 5D6GA 2IVMA 5HLFB 2FVRA 1JLFA 1KVJA 1S6PB 1LFWA 4J5OA 3CDEA 3BQ2A 3VQSA 4IO9Q 3OTBA 5KOWA 4YY3F 3GZ7A 1TQLA 4BC7A 1RTDA 3E01A 2BANA 3G6XA 4FNHA 4QIGA 4B3TF 2HQIA 5HQ8A 2JSXA 2XC9A 3MXHP 3CE8A 5KT3A 4DV1F 4K2XA 5HROB 1TK0A 2IA6A 1ZH5A 3F41A 4RBVA 2BBEA 4DFPA 2HYIB 2RS8A 5CD4H 2B5JA 3DRSA 1RA6A 2R8KA 3K5OA 2JX2A 1GAOA 1KLNA 1UA0A 5J2PB 2AJFE 1KNZA 1WI8A 3F44A 1D8ZA 4MK7A 2BE2B 4A47A 1SKWA 2HAIA 1PGZA 3K2YA 2N82B 3RYLA 3V2UC 2B9YA 1DLOA 4RUAA 2XNQA 3N0VA 4OX9F 3L95X 2QSFA 4QU6A 2W9BA 3DMJB 4ZLPA 5GAHU 2DGXA 3W3SA 3MUVP 1YJ9S 2KXNB 1L3TA 4QR0A 4DL6A 1UAWA 3NBPB 3UD4P 2GHVC 2UUTA 3MR3A 3QGIA 2CQ3A 2E1MC 4PG4A 3UE2A 1RISA 2IYIA 2EFVA 5K8PA 3ZFVA 2B7BB 1JB0C 3SXLA 3MR6A 3MOJB 1KN6A 1XMQF 3BSOA 3UW1A 4RU2A 4TU9A 4IFVB 2W25A 3SEOA 2M0GB 3UFCX 1S6OA 4K4XA 4IOCQ 3T6BA 4L72B 1HNZF 2UU9F 1HBMA 2LQ5A 3U1LA 1IKVB 1N0VC 1HWJA 1RT6B 3CJ4A 4IH6A 4OI1A 2CQPA 4G6VB 4IRKA 2DNRA 4F8RA 3M4XA 3I87A 4RW6A 4LIWA 2XCPA 1R8PA 2V94A 4WU3A 1DAXA 1X0PA 3KLEB 4DSKA 2B51A 1VQ4S 2P6SA 3M32B 4HH1A 2FVPA 2AP6A 1FESA 4B9UA 2C3OA 3KLFA 1CEZA 2IA0A 1F5AA 4H4KC 4K5SA 4LJMA 4ZOSA 4IG3A 4OZ0A 1JNRB 1U25A 3NS6A 3OVSA 2PI4A 3OJUA 1KS2A 4KO0B 4X65F 1NJYA 2KVIA 3OL6A 3KMSA 2OPQA 4O4GB 2HG4A 3JSRA 2XY6A 2AU0A 1XR6A 4OHWA 4XIUA 4IH7A 4LSNB 4F3QA 2CPFA 1WI6A 1RTJB 3PJXA 1E6VA 2V8HA 3K8WA 4QIFA 4QWCA 3T5LA 3OL7A 3C6TA 2XS7A 4ZCKA 1QSSA 4DSJA 5CYQA 5LL6d 2W7PA 3IN5A 2JJ4D 3MOZA 2D3OR 1FTCA 3S7RA 3BDPA 4USJC 1NH8A 4DUYF 1S72S 2L9DA 4O3PA 4NLRA 1TAQA 1VGYA 3HHDA 1IJEB 3T9ZA 1L5UA 3CDBA 1C0TA 1P1TA 2C2RA 1M5KC 5I3UA 3OR2A 3M2VA 5E41A 3Q24A 1TUVA 3M8PB 3P5TL 2CQIA 4A8FA 4ZVHA 1SJ4P 2CQBA 2KYZA 1RT3A 2RH3A 2JHEA 1N5SA 2V8VA 2XB2D 2WK4A 3PW4A 4BCAA 4IG0B 5KFQA 3THTA 2XLJA 3ZZYA 5A8RB 3KG0A 4DEZA 4UW2A 3BGRB 4C0BA 4ZPVR 2HVIA 1HD0A 1SUQA 1HBUB 1RA7A 4WXWA 3HVAA 2EW9A 3CMAS 2QFJA 1RTHA 4B3MF 2DD8S 3HMJG 2PGCA 1VIXA 5E3QA 1FHTA 1VQLS 1S48A 3PZPA 3TW0A 4NLVA 3FRZA 3CUNA 4I67A 1IXKA 3BM7A 1HNXF 2GIQA 1JLQA 3V6JA 4G3IA 4DL7A 5KFVA 2E9TA 4J9MA 1SXLA 4F25A 3SZ2A 2RDIA 1FJGF 1NHVA 4X2BA 3CF5Q 3ISZA 2EPIA 3MM8A 2QMWA 3DI6A 3IAS9 4URQU 1N4LA 3CD6S 3PW5A 2D9PA 1ZBTA 2KZZA 1J5OB 2L08A 3RW6A 3FZ2A 4F4KA 3IWLA 2GHPA 3GR1A 5AXKA 4DN0A 5D3GB 4DQIA 3MM5A 4QW9A 4OI2A 5AE1A 5EWFA 3FFIB 4KKOA 3HKZD 2J9DA 3CCWA 5I4MA 5JJBA 4O3NA 2ROEA 2J6UA 4M95A 2XY5A 2VG7A 5B0DA 2YNFB 2F3JA 4YHHF 4XPEA 5DQGA 3DCAA 1JMTA 1RDRA 1P9QC 2DHSA 4Q45A 4YR0A 2VOOA 4B3OA 3H2LA 1XMOF 3LP0A 1Q8LA 3BSCA 1ZAVA 5BYQA 4F4YA 1YIJS 3Q8SB 4PG8A 1HNVB 2Y0SD 2FVQA 2GMLA 2O66A 3DRRB 4M5DB 4CT9A 1FKAF 1TK8A 2B6AB 1HHSA 1QAYA 1M5VC 2DT9A 2ILZA 4LFAF 1VC6A 2P9GA 4DJBA 3JYTA 2KT3A 2LA4A 2OAUA 3EPIA 2ZJRQ 4RBUA 4NX9A 3PVXA 2KT5A 5IT4A 4Y28C 1XWLA 4C4WA 3SFUA 2BUNA 4LVOP 1HQUA 3MDFA 4LFCF 1IKWA 3O6QA 2Q1LA 2YNGB 3OFGA 3B78A 4QPXA 2A10A 3GWCA 4HLBA 5J2NB 3FJ2A 5F8NA 2KH9A 2JEJA 4NLOA 2Q66A 2JFKA 2Z2LA 2MXYA 2I9SA 4ZK7M 3DLKA 3I32A 2ROGA 1LXNA 5AXLA 4ZPDA 1VQ5S 1VI7A 1QM9A 3K8VA 2HMIB 3DLEA 5DDOC 1HWKA 2MY8A 5DQHA 2PIIA 4IR9A 4FXDA 1U7LA 1NK6A 3GIMA 2XSFA 3PRBA 2PMHA 3M2RA 2OPRB 4A8XA 3VAFA 2X1BA 3RR7A 2IM0A 2Z2MA 3TX8A 2ADCA 1X4FA 1R43A 2AX1A 1VRTB 4MYTA 3TA1A 2CQ4A 2C22A 2K1RB 2ZVSA 4NCGA 4A8YA 4ED8A 4F2RA 3DOLA 2LDIA 4EUVA 1SB6A 1S6QA 5D4OA 1HI8A 1G7CB 2EK6A 1HI1A 1FRXA 4CNYA 3WX4A 4EBEA 1R89A 2ZFHA 4DBQA 3BEGB 5H1SV 2VFVA 4YR3A 3K5MA 4QCLA 3OFHA 1JWWA 5HBMB 2WCXA 1N88A 1DQAA 4I7FB 2O67A 4BS2A 3BB5A 1IBLF 1U6BA 1SIWB 2FJVA 2RQMA 1LWEA 1S9GB 4Q2LA 2QE5A 1XMBA 4MMOA 4M8LA 2WSEC 1E6YA 3NCPA 4KGKA 2AGOA 2QT7A 1S0OA 3E8OA 3PO4A 4NMLA 1N5VA 2W8LA 3DHWC 3P49B 3GB0A 4MK8A 4TLQA 1U24A 2CDQA 4HI1A 4I2QB 3OW2R 2JZ5A 2LU2A 2V4JA 3JTPA 1XNRF 2L9WA 1SJFA 4NXMF 5F3TA 4DX8H 3CJKB 1G6BA 1XK8A 2BACA 1HBOA 3CSKA 2ASYA 4R5PA 1RT7B 1S1UB 2HHTA 2Y1IA 1RQ0A 2NR0A 4PUOB 1R6YA 2YWFA 2XMJA 4HDHA 1K1SA 1CC7A 1XR7A 1Z1ZA 4KPYA 3I0SB 2JLEA 5M2UA 4RUHA 4KFBA 3PR5B 3IS9A 2LCWA 4NLQA 2KXFA 1R8AA 2VBWA 1SBRA 4IDKB 4PXCA 2HNDB 5KFIA 2JLGA 1HI0P 4RW8A 3HO1A 1C1BA 4G1PA 4UQGA 2MZSA 2DHAA 3KMQA 1BQMB 3MMJA 1YRXA 5DETA 3I56S 1CLFA 2NSBA 1JX4A 2HIQA 1WTBA 1L3SA 3TOQA 1FRLA 4P6QA 2VG6A 1D8YA 5EN1A 3CCVS 3R27A 1YGYA 4C8MA 2JEFA 2P9CA 3H5UA 2VFRA 3PFEA 4TLRA 5H9EJ 3FMWA 1BQNA 3SCJE 3IG1A 4LT6A 4ED0A 1RTIB 4DV0F 3DYAA 3J7YU 1FNOA 4ECQA 2VG5A 2OSQA 4ILMA 2JL9A 5L38A 1N8RT 4A8MP 2DJWA 4DSEA 4YDXA 4BDPA 1FXRA 2I5JB 2HWIA 1UEUA 4FZVA 4MFBA 5B0BA 4U6PA 4EO8A 1I6JA 1VK8A 2CQ2A 3GV7B 5M2PA 4WTYA 4F4WA 3C46A 2MKJA 4C2MA 4LF7F 4J9PA 5DDRC 3WBZA 3I5AA 1S77D 1URRA 1B0VA 2MMYA 4RLEA 4I64A 1S9FA 3OJSA 2FGOA 4NLSA 1RAJA 2ZH9A 4DV7F 5FJ4A 5T7LB 3VAHA 4DLGA 1H6KX 3WDOA 3RRHA 3JSMA 3MMBA 3D0HE 3U7JA 3BO3A 1H7WA 1TKZB 2DISA 2WSFC 1U1QA 1FERA 4F50A 5KTQA 1FTRA 1YJRA 3W2WA 2XULA 3UPFA 1TL3B 5B0FA 1U1NA 5HMZA 2X1FA 3CULA 1C1CB 4I0WA 4URGA 2D74B 4XDDA 3B8HA 3J7ZT