5B0CA

Polyketide cyclase oac from cannabis sativa, y27f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTFVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 25
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0cA00
1P6TA 4QOTA 1YJUA 2HQIA 2XMKA 5B09A 2EW9A 4Q2LA 3E8OA 3HHLA 4OJ3A 2OD6A 1OSDA 1SQEA 1JK9B 1TR0A 1YJRA 2GGPA 2IYIA 2KT3A 2OP5A 1KQKA 1APSA 3TOQA 5A6PA 3HHLB 2KYZA 3BF4A 3GZ7A 1IUJA 4HI1A 1GXTA 4Y2IA 3TRGA 2ROGA 4A4JA 1RJJA 2BJEA 2XMWA 2XMJA 4YDXA 1X7VA 1Y3KA 4U9RA 3VTIA 4Q2MA 2QIFA 3F44A 1FE4A 1Y0HA 1FEEA 3IWLA 5B0AA 1JWWA 2FB0A 2LQBA 2OAUA 2OD4A 3HX9A 2GA7A 2XMMA 2AP6A 1CC7A 1YRXA 2OFHX 2OKQA 2RMLA 1Q8BA 2ACYA 1Q4RA 2IYGA 2OMOA 3DXSX 5B0FA 5KAKA 4ZOSA 2BJDA 1N5VA 3BR8A 2GV1A 2N7YA 2W4DA 5A6WA 1OPZA 5F0WA 3KG0A 1X0PA 2AJ1A 2HFNA 2CRLA 2RSQA 2XMUA 4HI2A 3FRYA 2QLXA 2K1RA 3K7RA 3LGMA 3FMBA 1VQYA 3TNVA 1Y3JA 2L3MA 1OQ6A 4HH0A 2N4DA 4EFAC 3FGVA 1Q53A 4Y2KA 5B0DA 1YJTA 3QGPA 1X8DA 3BDEA 1CC8A 2QLWA 2FIUA 2VH7A 1K0VA 2K1RB 2JDJA 1V3ZA 4F67A 2ROEA 5K9FA 4HL9A 1FVQA 2VV5A 2BUNA 2AW0A 2BBEA 3HHLC 3BM7A 4YEAA 1TL5A 1XBWA 2GO8A 4OJGA 2W4PA 2ZDOA 4OJHA 3HHLD 2XMTA 3BN7A 5B0CA 3QMQA 2ZDPA 2Q3PA 3KNGA 1S6UA 5F0UA 2N4CA 2RU9A 3LGNA 1TL4A 1KVJA 4NPOA 1ULRA 2KT2A 2GFFA 3LO3A 5IXUA 1S6OA 2BYCA 4A47A 2IFXA 2HIQA 3KG1A 2LXFA 1W2IA 2QYCA 2ROPA 4DPOA 1N5TA 4FNHA 1OQ3A 2OFGX 2PGCA 2XMVA 3KKFA 3CJKA 1QUPA 1MWYA 1FVSA 3IWXA 2RILA 4ZA1A 5B0EA 2LQ9A 2FTRA 1FESA 3HF5A 3UDCA 3MZIA 2HFOA 1Y9OA 2FHMA 1CPZA 3CJKB 1GXUA 5B0GA 1R6YA 5T7LB 1AW0A 2LDIA 2ASYA 3T9NA 1U7LA 5B08A 2HLUA 2K7KA 4A48A 1LQ9A 4FNIA 3WDOA 1Q8LA 1TZ0A 4Y2MA 3MCSA 2PD1A 2KKHA 2HLTA 1YG0A 1MWZA 1N5QA 4DN9A 1URRA 4A46A 2W4CA 1N5SA 3HFKA 3HDSA 2GGPB 3I9ZA 2K2PA 1KVIA 1SI9A 1VQSA 3DCAA 1FD8A 5T7LA 1AFJA 4NL5A 1FE0A 4DL0C 4HH1A 2AJ0A 1SB6A 1TUVA 3BB5A 4OIXA 1WD6A 1AFIA 2GCFA 2G9OA 1YJVA 1P8GA 2K7JA 3BGUA 4OJ1A 5B0BA
chains in the Genus database with same CATH superfamily
1BY9A 1ZM4A 4LSNB 3J7YU 1FTCA 4KJIA 2J7KA 5CD4H 3Q23A 5H9FK 1QDUB 5A8WB 3A4TA 4YY3F 3GTYX 2NXCA 2CVEA 3MMJA 3EYZA 4EZ9A 2P6TA 5KT2A 2JC1A 4ZLNA 1FTRA 1PBAA 5GAHI 1S12A 5HMYA 5KFRA 6FD1A 4JV0A 1QAXA 3BGLA 2F4FA 4LFBJ 1FJ7A 1C0UB 2FHJD 3MR7A 3T1HJ 1WTBA 1S72S 3D54A 2HVZA 1T8EA 3DI6A 4B9NA 1X5OA 3UO0A 2VG5B 3CJKA 3I6PA 1MWYA 2CG8A 3IWXA 4KHPJ 3OL6A 4OYIA 3MFIA 3W61A 1V6HA 2CQGA 2KM8C 2J7UA 1N5SA 1UPPA 2F3JA 4OYAA 3CW2C 4K7QA 2DNNA 2DXFA 4FYWB 1YGYA 2D3OR 1YJUA 1JXLA 1SJ1A 3HHLA 3H98A 2DITA 1U2CA 1PKUA 2XZWA 1FDBA 4K2JA 3Q2SC 3KHHA 2F63A 4LQ9A 2FVPA 3MUVP 1TUWA 4AXIA 1H3DA 3NNCA 2GA7A 2ZH4A 3UR3C 1KBRA 1QY7A 3MPDA 2HZVA 1QM9A 3QAEA 1T03A 4OI3A 5LSOA 3D2WA 2YKMB 1YJTA 2DGTA 4E8UA 4ZVTB 2BOPA 5KFKA 4DPYA 3R6GB 2HGNA 3OL8A 2CJBA 4ZVOB 1RT5B 2DYAA 1NK4A 3VQTA 4HKQA 4A47A 4ZIVA 2ZH2A 2FJXA 3D7SB 3N01A 1N48A 3DM2B 5T7LB 1NH7A 2IVMA 1IQZA 2GQQA 4A48A 4LF9F 2D74B 2GVZA 2B56A 3EVMA 2PMZD 2X1FA 3PFOA 3MECB 5HLFA 1Q5YA 4DSIA 5KFBA 3BGUA 2DNMA 1FJEB 2OSQA 4W90B 4C9DA 1HBNA 3D0GE 1LK7A 3TAMB 2B9XA 3AB4B 3G9CA 2G2ZA 2G0CA 3AFGA 1O6XA 3M8YA 4MKVA 4RW9A 4CLPA 2RS2A 2XMUA 3FRYA 3TNVA 2V8PA 2YX1A 2EBGA 1TL3A 2BANA 2K1RB 2OUGA 1DTQA 4GKJF 1TL5A 2VPYB 2NSBA 3HPOA 1ZAVA 3BDPA 3BN7A 3EGVA 1K0TA 1S9FA 3KHRA 1X31C 1WHWA 3H90A 2VU5A 3SI8A 4PXBA 3JS9A 2CQDA 2XMVA 3CSKA 3K0JA 2HS0A 1NU4A 4DU7A 4NZ7A 5H9EK 3QJPA 5LMUJ 2ZBRA 3CCZA 2UXBJ 4CLYA 3LAMA 4ECSA 9RUBA 1H2TZ 4USTA 3WIVA 2CPDA 3MM9B 3J7YI 3NBPB 4DR7F 3I9ZA 3GV7B 2HHHJ 4KPYA 4OZJA 4DV5F 3N79A 3HVWA 2F4VF 2JJ4D 2CQ3A 5F8MA 2QSWA 2HRTA 3Q8RB 3QRRA 3E8OA 1WHVA 3Q8YA 4I68A 4K50A 4LRAA 3N4WA 1XMBA 2WBMA 4FKXA 1IN0A 1GTHA 2F8HA 2JL9A 1HIYA 1MW7A 2DR7A 1FEEA 1RWMB 2UXCF 4DL6A 4EYHB 3PKMA 3Q8VA 1W7WA 3DLJA 1FERA 2RSQA 2PFFB 5C2GA 3M30B 1IR0A 2ZVSA 4M5KA 3NRBA 2MKYA 3QSIA 4ES1A 1V3ZA 2LCWA 4QJVA 3TWZA 2W4PA 3I0RB 1CJTA 1SH3A 3VGVA 1KVJA 5LT5A 4B9UA 3I5BA 1C0TB 2PGCA 2JWNA 4KB7A 4MMOA 1XTZA 3E3XA 1FNXH 4M8LA 2HBZB 2V50A 2W1BA 2DCUB 1SJQA 1KVIA 1U25A 3HXMA 1FRJA 2FLPA 3DOMB 4DEZA 3W9HA 1RISA 3K5LA 3CEDA 1SC3B 3W64A 1FDAA 4ECXA 2QL7B 2OD6A 2OPQA 4HEA9 4QYRA 4KY3A 1R6VA 3RRHA 4C11B 2ROGA 1RTIA 5LJ3Y 2CQ2A 3NG8A 4PYDA 1WOPA 2XEXA 3MM8A 1T9UA 5A8KA 1RT2A 2ZE2A 4PYAA 1CC8A 2BRKA 4C8YA 4CTAA 2QN6B 1J5EF 3CC4S 3U1NA 1RKJA 2AGOA 5DGBA 2VG7A 2KU7A 1NPPA 1S9GA 3G2XA 1DBDA 3DN9A 3LP1A 2XZTB 2FJVA 2DNQA 1BXNA 1GMVA 1S76D 2J9DA 1X4GA 2ZJPQ 2EEYA 4DPWA 2NYIA 4E98A 1YZ7A 7FDRA 3D66A 1KWMA 4FF4A 5J2MB 3WQPA 4KYZA 3C14A 3H8YA 1RWPB 2RF2A 3IR5B 1H73A 3K17A 3OXFA 1UEKA 4JI5J 5DDOC 4ZVPB 3UN2A 4OJ3A 1LFWA 2VHGA 1PAEX 3BF4A 4DOZA 2BKOA 3IXQA 1QUVA 2DNYA 1HYSA 2C2DA 3VAGA 3OJSA 2ZH7A 3DOLA 1REGX 4G65A 1TAUA 1WI6A 2V34A 4O3PA 2QEXS 5FDLB 1RU2A 2VB6A 2RE1A 3G8SA 1T11A 1UVMA 4DLGA 4X4QA 2H1YA 2C3MA 1KD1T 2RDDA 1YHQS 3AD8C 1NEEA 2WW4A 3DGPA 3MMAA 4CNZA 3TJ9A 3R7SB 2BYCA 3TA0A 4JB8B 4N56A 4M5IA 1FWKA 1HBUA 5D4LA 4PXCA 1AW0A 4WP9A 2J7WA 2KHDA 3CDBA 1JNZB 3MR3A 2K3KA 3CB4A 5A2QY 2CPEA 3QRPA 3R3TA 1XERA 2Y0BB 5HVHA 1A6LA 4FS2A 3T1YJ 5F9LA 1RE1B 4MTPA 1GNKA 4HVZA 2ZHOA 3OHAA 1HNIB 5KFPA 2DEIA 3ICLA 1VI7A 3TRGA 4DDFA 2AYBA 2CJ9A 5K20B 1RT6B 2RHSB 2V8VA 4UOHA 2OAUA 1T3OA 3PCOB 1F1BB 3M8WA 5HQMA 1HI8A 3CO0P 2GV1A 3MPUB 4IOBA 2CNOB 3MTJA 5HMXA 2XC9A 1CLFA 5KFNA 3DRPB 3QGIA 2N4DA 4Y2KA 1KSPA 1V5IB 1C0UA 2H9ZA 4F2RA 2UUBJ 3VGTA 4WIQA 2A10A 4KGZB 1MMLA 1H0HB 3FCVA 3AY0A 2RS8A 3QJJA 3GMGA 3O1LA 3KK2B 5CA5A 3IP0A 5KT3A 3BGOP 3CUNA 2BJ7A 2HLUA 3VV2B 5F3TA 1VQKS 2XS7A 5BYRA 3N5BA 3FDSA 1HNVB 4B3SJ 4MIBA 1T94A 1JLCA 1HNXJ 1DARA 1SB6A 2MY8A 2AYEA 4Q2LA 3W66A 3CPWR 4IDKA 3D6FB 4DR3J 5T41A 1NH8A 2KFZA 1L3UA 2B4VA 3FEYB 4MYTA 2D3UA 2OD4A 2DKOB 5KAKA 5KFJA 2YKMA 4BS2A 1RT7A 3D1QA 3QT6A 2B4UA 2NXUA 1FX4A 1RT3B 1X8DA 4PAAA 2QLWA 5LM7E 2PI4A 1RT5A 4CYUB 3SSQA 1TP7A 2UXDF 2BW7A 4N41A 5HJXA 4WK3A 1X9SA 2VPXB 4F0KA 1KEKA 1QSSA 3J81j 3CT9A 2LECA 2LXFA 2ADBA 4NRUA 3DM2A 3ZZUA 2YWEA 2EBEA 2CQ0A 1KRPA 2KJWA 3OR1B 3GIRA 3OSPA 2G2YA 4XPCA 3M7VA 4J9MA 2W2MP 1N5QA 3MECA 4YFUA 4USKA 1GX5A 3NGDA 2MMYA 3N0VA 3BH7B 4X62J 3TAMA 2ZEJA 2HQCA 3DRSB 2E1AA 1A9NB 3R5AA 3ENWA 4ANDA 4A4JA 4JYAF 3ZZTA 4G3IA 1HW9A 1Y4ZB 1WG4A 2LU2A 5KOXA 2UUCJ 4DI6A 2HNDB 5ITHA 3NGSA 3EUNA 2K1RA 3FRZA 1F0XA 4FBUA 2ATLA 2ABYA 5KFEA 1FNOA 3LTOA 1FVQA 1X9WA 2MDAA 3CGIA 2HAFA 3D0IE 2XMTA 5B0CA 1M5HA 2CQHA 3EGWB 3R7NB 1RHKB 2EC0A 2RU9A 4TU7A 2DY1A 3IBWA 2KT2A 3JTNA 3L7UA 2RRAA 3WC0A 2DHGA 4OZNA 5DO2A 3ILLA 1RT1B 4LIRA 2LXIA 2RHQB 3MM9A 2VFUA 3NBPA 1GMWA 2DPIA 1KN6A 3TEHB 2AGPA 1VQSA 1KTVA 2BE9B 2DNKA 1G3OA 4IOAQ 1UETA 1HA1A 3GQCA 2D69A 2XMKA 4W98A 3TZXA 1XJWB 4I56A 3JAMU 2JSXA 3KG4A 2V69A 1LXNA 3HT0A 1X60A 3DXSX 4WFBQ 3M30A 3W2VB 4QWAA 5ETPA 1YRTA 4HI2A 1N6QB 3MWBA 2WTFA 3O3LA 4C0HA 1HMVB 3I0RA 3AQOA 1NJIT 3ZTRA 4O3QA 2EKYA 3AXKA 2W24A 4JI2F 4FF1A 3KLIB 2WVCA 3PXGa 1B0PA 1YKWA 2W8KA 3E2EA 3FC9A 3EPGA 2QYCA 1Q1KA 3KLFA 5HMWA 5DM6Q 2P6SA 2DH7A 2UUAJ 4TYAA 3A8KA 2LFVA 3VAKA 1NDCA 3KLVA 1N34J 3CJ5A 1SUQB 2HWHA 2YWFA 1RHRB 5IT0A 4DN9A 3BO4A 4E2FB 1CS4B 4PG5A 4O23A 1HD0A 5GAEU 2BM1A 2NZ4A 1Q95G 4N47A 3N28A 1UTAA 2HQIA 4U8VA 3R5JB 2W2OP 3FZ2A 3I31A 4C11A 5KG6A 3MTKA 2XO7A 4F0HA 4I64A 4TKTA 2ASDA 3D67A 3FSYA 3OD2A 1UVKA 3HSJA 2ZC4A 5KFSA 1S57A 4ECYA 1CC7A 1UP1A 4L75A 2E5LJ 3PW5A 3NGKA 3NEKA 4ZVHA 4DPTA 4ICLB 3QGPA 3AQPA 1FRKA 1HKAA 2VJVA 3D0HE 3ADAC 2BV3A 1HQEB 1TL4A 1SL1A 4LREA 4ALZA 3ILIA 2V4QA 5CYJA 1NLKL 1JLBA 3KLEA 5HP1B 4ELUA 1U26A 5J2MA 3WDOA 2JVRA 4ED2A 1MN7A 4OYXA 2XMAA 3QWUA 1IBCB 2DGQA 2ZFHA 2HKEA 1P8GA 2ZH3A 4NZ0A 2ZVIA 4FYYB 3U1MA 4LF7J 1APSA 3G4SS 1QAYA 4P2SA 1NJWA 1PJ7A 4F4YA 5KFOA 3F44A 3UDLA 2A2DA 5FDLA 4TN2A 3MR6A 4AT1B 2HFNA 1NKEA 5KG4A 3FBFA 3KK3B 5K8NA 2L48A 4EU0A 1RABB 2IRXA 2MLYA 3H5YA 2JDJA 3GV8B 1WC6A 2XWYA 4NXMF 3VAMA 3LANA 1XMOF 4JI4J 3I4PA 3RB4A 3ENVA 4W92B 4QIFA 2DHAA 2X1AA 1HW8A 2HIQA 1RCXB 1ELOA 4LFCF 1UEUA 1S1WA 2VQEF 3ET6B 2HFOA 2VBWA 2B7BB 4FVMA 4O44B 2KRRA 3H0PA 3VZIA 3TZWA 3MAAA 1XR7A 3BZQA 3R2CJ 1GFWB 4LRDA 4YB7A 3LPYA 2R8KA 3DYAB 3OXGA 2R7TA 1VCTA 1HNIA 2B4OA 3MOZA 4DSLA 2UU9F 4AL7A 2MZTA 3B6BA 3GB0A 4V19X 3M2VB 1RT6A 4RUAA 2XLJA 3IG1B 4KE5A 3UCZP 5CH7B 3SCJE 1N88A 2FB0A 4DX5A 2VFRA 4NYOA 2ZH9A 4UQGA 3O5TB 1HBMB 3M2RB 3DRPA 1UKUA 3BO2A 4YMEA 3ZXWA 5BJRA 2NR0A 4MIWA 2DIVA 1S7IA 1NJZA 3RR7A 3B54A 5KFYA 3HHLC 4C97A 4C8KA 3QMQA 4HLBA 3RYLA 5AXNA 2KHCA 4PG7A 4B02A 4Y6IA 5IXUA 2HWIA 2L9NA 1S48A 4DPOA 4DUYF 3PX0A 3KK2A 3PFEA 1ACMB 4QYZK 5GAEI 1DTTB 4USWA 1HNVA 4DV2J 8AT1B 2QSFA 5LL6d 2ZOMA 4ECZA 3EMTA 3BPSP 4ZP6A 1TUVA 2V8HA 3NS6A 4F3MA 4IRKA 4I67A 4J9QA 1SQEA 3QT5A 1KQKA 1KLNA 3OFEA 1WUUA 1QSYA 2QA1A 1FE4A 5KFXA 4FYDA 1FDNA 2MKIA 5F8JA 1TK8A 3KHLA 3DLLQ 2XHWA 2MQLA 1KKHA 2HMIA 2RJZA 2LQ5A 1NSAA 2AEJA 3R9LA 4RW8B 3TUJC 2IBKA 1B3TA 5EUHA 1EJ7L 1MN9A 1KONA 3D28A 5CQGA 4X4PA 2UUWA 2WVBA 3OR1A 1JJCB 4NEZA 1M5PC 2G2OA 3HO1A 3OFGA 2ZD1B 2LU1A 1NK8A 3DCAA 1R0BG 2IPOB 2CA9A 2CJYB 3DRSA 3EPIA 1R31A 4YR3A 3IM9A 2ZJQQ 4TLRA 2NS1B 2DNLA 3Q8PB 2Z30B 3D1HA 3X3UA 4RW7B 1AUSL 1RHQB 2NXEA 3AJ2A 2FD2A 3KDNA 3KJNB 3T9ZA 2HNDA 1JJ4A 3RU0A 3Q0AA 3FQKA 2XY7A 1XMQJ 2XSFA 1OSCA 1QD1A 3J80Y 2RDJA 4MYUA 2CPJA 1Y3JA 3PYEA 3DLHA 1RWXB 4K4XA 4ID8A 4G6VB 5ETTA 1RHUB 3BO3A 1PYTA 5ETQA 2C3YA 1JLFB 1FK9B 1TKZA 4UT4A 4AE5A 1RT1A 1MROB 1EETB 1BQMA 1XNRJ 5IC6B 2OFGX 3VHQA 1SVDA 1UVJA 3A1YG 5EWEA 3EM1A 2ASYA 4CM2A 5HSPA 1RA6A 1KHWA 2F1FA 1U1OA 2K3IA 1N5YB 6AT1B 3OQ2A 4OYWA 2R8IA 1GH8A 1UVIA 4ZVEA 2ADCA 3FK4A 2BACA 2JH3A 2Z2MA 3P3DA 5IWAJ 4ED5A 2WHOA 2HPUA 1HR0F 1R43A 5MLCV 3QYYA 1YLXA 2BJ8A 2RDIA 3GZ7A 5J1EB 1GXTA 2WOMA 5IV4A 3H7HB 2I8EA 3W2VA 1HD1A 3PZPA 3RAMA 1ZM2A 1N6QA 3V4MA 1X0PA 4PKDB 2JLEA 1N32J 1HMVA 2V6AA 2AX0A 3VAHA 2VASA 2BQRA 1S6QB 2QA4G 4DR2F 1HPZB 3BS9A 2HHPA 3DRRB 3PYDA 3BKFA 3KLIA 4ATNA 3LAKA 5DRKA 4CLWA 4UUWA 1OPIA 4WBFA 1DZ5A 4O3OA 5KFLA 4LVNP 3OXLA 4NLVA 4DL4A 1NSPA 3QQCD 4IH7A 3POTB 3TZYA 2RD5C 1TFYA 3RBZA 2VDHA 2IAJB 1SC6A 2HVEA 1SUQA 3JTPA 4M5HA 2EFNA 2MHNA 2GC8A 2VFTA 2PIIA 1SPBP 4LR7A 1ZAXA 2M9KA 2VG6B 2YNFB 4R8UA 2Y9HA 4UOFA 1MNEA 2XG8A 3UWTA 2Z8QA 4ZJQA 4P75A 4NA1A 1U6BA 3M6WA 1R8PA 4C8NA 3BEGB 2CQ4A 4LQ3A 4JI3F 3IMQJ 1RTHB 2XHCA 3EGNA 2HFZA 5LXRA 4HTIA 3NKYA 3HX9A 4DR6J 5JVHQ 3M32B 3ILOA 2R7UA 2AJ1A 3T3FA 4ICLA 2DH8A 1KOOA 5C2CA 3CULA 1B0TA 1WOSA 1H2UX 1X4HA 1HQEA 4PQAA 1MSWD 4OX7A 3JSYA 5IT4A 3BKTA 4X2BA 5ETLA 1PIEA 5LOQA 1RP5A 5BR8J 2E9ZA 3MEDA 4DUTA 2J0WA 2YWHA 4UOCA 3SCLE 3UDCA 5HP1A 2OO4A 2DNZA 1BWEA 4WXOA 4XDDA 3S7RA 2R7XA 1Q16B 2OTJS 1L3KA 2BJ9A 1HLWA 5KFVA 2IM2A 5CD4A 1G2EA 2PDAA 2BKNA 2FYXA 4K0KJ 1NAQA 4PWDB 3HFVA 4DS4A 2C2MB 2YPYA 2DJWA 4DFPA 4QWEA 2LMIA 1SCJB 3OLAA 5I4MA 1CJKB 4YHHF 1WDDA 2OI2A 5HO4A 2QL5B 2BE2B 4JI8F 2NCKL 4Y34A 5ETSA 5DJBA 3F73A 2WB1D 3J7ZT 3R2DJ 3KG0A 4LF6J 1OJ4A 3MAQA 4C3MA 4I7FB 3V6KA 2ATCB 1CBKA 1S1VA 2C2RA 2H3EB 2Q6BA 2GVDB 1WTFA 5IOLA 4WP3A 3JSBA 1SKUB 1CVJA 3ET6A 2YX4A 5KT5A 3ZO7A 2PO4A 4IRCA 2QE5A 3UR0A 1UZDA 1SC4B 4HT7A 1G4CA 2VJUA 4JI1J 2VA3A 3DYAA 2B8PA 4H4OB 4OYMA 3HFKA 3T41A 3Q83A 4OI6A 3R97A 3P45B 4K59A 2QMXA 2HS3A 2IJNA 2CDRB 2M5YA 3M2VA 3SEOA 1KQSR 3HD2A 2IYIA 2AF6A 5MAOA 1FKOB 3CC7S 1LNQA 1CULB 2HQGA 1HBMA 3M2RA 3NCPA 4ZPVR 2FJWA 5KFFA 5HAOA 1UEVA 3DU5A 5DQIA 1MG7A 1N5VA 4AUKA 5KFQA 3AH6A 1K8AT 4I1TA 5E0OA 1JB0C 2QV6A 4Z7YA 1TU0B 3NNHA 1VISA 2CVIA 1EQ0A 3GYGA 3GFXA 3RRKA 4YY3J 2U1AA 3IR6B 2JVOA 3KDOA 2J6UA 2YWWA 3SCKE 4CLZA 4ED0A 4J90A 4PG8A 1U1PA 3TP2A 3ILJA 1DTTA 5B0EA 1QAIA 3ZZYA 5HBMA 1C1BB 1KP6A 5FD1A 3ITHB 2D1CA 3S8SA 5AE3A 3GG1A 5D3GB 3UD5A 1RAGB 2DNPA 3QIPB 3GPAA 4XK8C 2LLZA 2VBYA 1S1TB 1JLGA 2PT0A 4EI2A 2ZNZA 2AZ1A 1TKTA 2BEFA 2XLIA 4F0MA 2Y3YA 3MUTP 2ASJA 5HL7Q 3B8HA 5A8RB 2FZKB 4OHWA 2LQJA 3ZZOA 2VBZA 3Q8QB 1CJVB 3BQ2A 2XYPB 1LKZA 1RSCA 1NM2A 5KG5A 2L41A 1LWEB 5B0DA 3H5SA 2R7OA 2E29A 2J6SA 3OTBA 4RW8A 3BSOA 1RTJB 3T1HF 4ZVUB 3HJFA 1D0EA 2B8QA 2VC1A 4P74A 4CO4A 1S0VA 1KFDA 4Z37A 2J0SD 4ZPDA 4KHPF 3CCUS 1N8RT 3RJMB 3IN5A 3T19A 3HVAA 3CDWA 4I2QB 1EARA 2R3VA 1G1XA 2FJDB 4OYOA 3SCIE 4DMZA 2WONA 1AUDA 2EW9A 3CMES 4C3LA 4RW7A 4IKAA 9ATCB 4C8OA 2B3TB 1FXDA 4B3MJ 2E7VA 1NXIA 4ZP8A 5E2QA 4UY85 2QLJB 4RUCA 4WYWA 1HHQA 1JLFA 5CCMA 2NQPA 2YH0A 4HHHA 2Z2ZA 3PW4A 1YIJS 1PJ5A 1EETA 3HKZD 3TUPA 1GMWD 2WCXA 3TJAA 2R8HA 1U2RA 2DGXA 4DCJB 2JX2A 2V4JB 4U7UD 3CWJA 1N5YA 3EWGA 2MKSA 2K7KA 3GSIA 2M2BA 5DG8A 4PEOA 2HHVA 4JBCA 3DFEA 4NPOA 4I2PA 4F36A 3D9BA 5J1EA 1WOOA 5G4DA 2JEJA 3GSDA 1HWKA 2XMWA 2LDYA 4NLSA 4WU3A 4FPIA 4CRJA 1P9QC 2GO9A 4KKOB 1QTNB 3RBDA 1HPZA 4OZ0A 3DRRA 4USJC 4N7TA 5J1NA 1F2GA 5D0GA 1Q0NA 4C2MA 1S6PB 4F4KA 1URNA 2IAJA 3L9ZA 5LMUF 1L3SA 2UXBF 3U1LA 3BYRA 3OFHA 1VK8A 1FRHA 2VG6A 2D3ZA 2YNFA 4U95A 4F4ZA 2HHUA 1TZ0A 1HWLA 1YX2A 4DUZF 3QSYB 4WZMA 2JZ5A 2HHHF 4NA2A 2O66A 4AFFA 2W9CB 2BOAA 5E3AA 2BJ1A 1RK8A 4XPEA 1RTHA 1VQ6S 4ED8A 2HFVA 4A8YA 4J5OA 1TR0A 3AD9C 1RWKB 5KTQA 2GNKA 3WX4A 4RKUC 3VTIA 2DR9A 2NXNA 2DGVA 3WIUA 4RPFA 2YX7A 1F9EB 3DNCA 2KN4A 4OZ5A 4ZCLA 1PGZA 1H6KX 4AL5A 4IR9A 1XK8A 3F56A 4J9OA 2COLA 1UCNA 4H4KA 1PILA 3NP5A 2AKWB 5AXKA 2PEBA 3CJTA 3OUYB 4E0DA 2DTJA 2FVRA 1S6OA 3RRGA 2GVZB 4ETZA 3W62A 1NB2A 2Z57B 3GJQB 4A8XA 2ZUAA 4IR1A 2ILYA 2DK2A 4DL5A 4OYZA 3IAM9 4EBCA 2VQFJ 3I56S 2ZNYA 3MPYA 1L3TA 4URGA 4BDPA 4PWDA 3HD1A 1BMQB 3M8RA 4KPCA 3UFCX 4F04B 3SQGB 4WE1B 1CJKA 5E41A 2CWXA 4PWUA 3CVKA 2PMWA 2BE2A 1QLNA 4RW9B 3KUHA 2LA4A 3KJFB 2M8HA 3EVOA 2J76E 4EYIB 3PR4A 4WXWA 1T9YA 3P8BB 3BV8A 4HTJA 4CH7A 2MLZA 4PG4A 2HNYA 3FGVA 3V81A 2B7CB 2OH2A 3KOAA 3G6YA 4FS1A 2GVDA 4GMKA 2VV5A 3O6QA 1XBWA 2GO8A 1WC0A 1X5TA 4P2FA 4IRDA 2HRUA 3LGHA 3NLCA 2G1HA 4DV4J 3BGRA 3L95X 1TVRB 2HHXA 4DJBA 3UI3A 3KG1A 5IS2A 4P7TA 2MZRA 1Q78A 1RBOB 4H4OA 2X1GA 4G1QB 4K5SA 3PO4A 3FNNA 1OYDA 4KH0B 1F9HA 2WBRA 2OSRA 2M88A 4JI5F 1PSDA 2HAIA 1FKOA 3CCTA 3CC2S 2OP5A 1CULA 2H5JB 1H72C 4LSZB 5D0RA 1NSQA 2KZMA 3G8TA 2WSCC 1HWJA 2RMLA 2HURA 1NK0A 2FUG9 1C2PA 4MJKA 2O01C 3HFZB 1M5SA 4DX6A 3JQJA 4N77A 2FC8A 2B0GA 1ZZNA 3BYPA 4JI7F 2CNKB 3OL7A 3H4DA 2HNZB 4WZQA 3S1TA 1VGYA 2FC9A 2IJRA 1U1KA 3H59A 1E6VB 3N6NA 1BQXA 3QT8A 3GIJA 1C1BA 3ITHA 4CNYA 4F26A 2XNQA 3SIPB 3CE8A 5H9FJ 5AE1A 4MAKA 4GO7X 5D3GA 1YG0A 3KUGA 4A8OA 4NWBA 2CJQA 1D1UA 1WORA 3PDNA 2W2NP 3T1YF 3KLHB 1I94J 1S1TA 2V8DA 2EWHA 3QT7A 2AU0A 1Q82T 5IQQA 5A8RA 5L1JA 1RT2B 2R7VA 4R5PB 2G0JA 4J7CA 1FRXA 3AA8A 1CJVA 4NCGB 2VPZB 3RBXA 1LWEA 3TA1A 1YITS 2X7IA 5DM7Q 4IG0B 1UFWA 4OX9J 2VG7B 3W65A 3JTOA 4IYQA 2UUBF 2A6MA 3BQ1A 4OJHA 2RVJA 5E3QA 4RNFA 3PACA 4L3NA 1H7WA 4L6V3 2P9CA 4NYZA 5DS7A 4ZA1A 4QWBA 2CXEA 3B82A 3C14B 4X64J 3RB0A 2LDIA 4I2QA 4M5GA 4BHQA 1Z1ZA 2NUHA 5GADI 1M1GA 2UXDJ 2UV8G 2DPJA 4A8MP 4ZHRB 2V2VA 1VJQA 1T9VA 1TV6B 3MAHA 3OPKA 2CPYA 1E6YB 2FHJA 2HQDA 3W1YC 4QIWD 5A76A 4DR3F 2GS8A 1D9FA 1C4CA 2BM0A 4WIIA 2AP6A 3PNIA 3TA2A 4ZVQB 2ZBQA 1UW4A 3LALA 2QLXA 4USIA 3M8QB 4CO5A 2XS5A 2V9KA 1VQ5S 1PC4A 4WCEQ 4LRFA 4TNOA 3AD7C 2HZAA 4XDCA 4Z2XA 5DLGA 3NWGA 4JP8A 3LQVA 1O5JA 4EWTA 2F40A 2VC0A 4TXSA 2V4JA 1U09A 1SJ4P 4CLUA 4KO0B 5DETA 3P5BP 2HVIA 2E9RX 3H20A 4EEYA 4KRWA 3M9NB 4JI6F 3PHEA 4JV1A 3NGUA 1IKWA 4FF2A 4L73A 1M90T 3BB5A 1WD6A 2Q79A 4X62F 4DX8H 1YJVA 1ZM9A 3DHXA 3GCXP 1B64A 1OSDA 2R4FA 4BLGA 2G1DA 3OVAA 1U45A 4Y2IA 3M8PB 4Q2MA 3CF5Q 4NLGA 4OYPA 3SYZA 4KKOA 1U6ZA 2UUCF 4J9SA 4OI4A 3KTQA 4X4RA 4ZVGA 3TVYA 3CD7A 5H9EJ 2FIUA 4B3TJ 2KH9A 3QATA 1EX8A 3ENQA 4RR5A 3OBIA 1S6PA 3TUZC 4C8ZA 3HP6A 4NCBA 2C2KB 3K89A 4N76A 1OQ3A 4R25A 4C8MA 4FYVB 1Y5LB 2XYHB 4KFBA 3A3NB 1JLCB 2V8GA 2Q1LA 3HVTB 4C7QA 2FPHX 3EICA 4BWMA 2WAQD 4IDKB 4GVLA 1XNQF 4OI1A 2W9CA 4Q0BB 1SJRA 1X0FA 3CCLS 1N36F 1PC5A 4I6YA 3G82B 2B6AB 3PHTA 4LT6A 3A8EA 4NOHA 1VQ8S 2Y1LB 1H7XA 4R0JA 1RT7B 1X4DA 3HT3A 1F5CA 4Y00A 2DRAA 1JWWA 4UUXA 1C1CB 2DBBA 2IYGA 3DLKB 3EE3A 3MCOA 1R89A 2RKIB 3JAMY 2O3DA 1FXLA 1UWBB 2D9PA 3OUYA 2BUNA 3LH2S 4QR0A 1Q8KA 2YKOA 3O8WA 1X4EA 5L9NA 3VR1A 2Z58B 4K4SA 1R8AA 2LA6A 2W8LA 2Z0GA 2ZHAA 4QZVB 1VQLS 1VRTB 2IDLA 2XY5A 1T95A 3RAXA 3GILA 1LFPA 4ER8A 2P9GA 1WC3A 2GQ2A 3PW0A 1DFDA 1KLMB 3P5TL 2BQUA 3SQGA 1QVGR 4WE1A 2AJ0A 4OIXA 2N3OA 3SFUA 2LXUA 1YRUA 2UVUA 1NMEB 1ZPWX 2ZH1A 1VIOA 4RBUA 2EVZA 5KOWA 1FJCA 4RBVA 4P6QA 5KFCA 3NCQA 4WFZA 2E5LF 2ALYB 2W2QP 3UE2A 2DXEA 2LP4A 3R5BA 3HM9A 3FCHA 2IC3B 4DQPA 1TVRA 4Y2AA 1XC9A 5EGYA 2GAHC 3P6YC 4JI0J 3KNGA 4DSJA 1HNWJ 3LP2B 5D78A 3HI9A 4ZCIA 1TK0A 4DQIA 5F3ZA 2JC0A 3A3PB 4G1QA 4NXMJ 1AZSB 2CZ4A 3ZZZA 4U8YA 3RTVA 2A1BA 2RQMA 4C6AA 2VOOA 5DDPC 2MZSA 2K2PA 1CQNA 1RWWB 3PG9A 5D6GA 1OWXA 4J9PA 4KGKA 4TVAB 3T1AA 2LYVA 2MKJA 3ZC4A 3CD0A 4USHA 2UZAA 5KG1A 3CCES 4KV8B 4QPTA 1U6FA 2LQBA 2VONA 1CG2A 1CSJA 3M6XA 2Y8YA 4ECTA 2IM0A 3TQ1A 2BQ3A 2HNZA 3MR5A 4AQYJ 3KLFB 4CLLA 1YVFA 4B08A 4F02A 1SKRA 1E6VA 2BVZA 2ZKUA 5GMDA 4P9SA 2MKKA 3IS9B 2MB0B 1TL1B 1NK9A 2FZGB 4EO8A 1LV5A 2P2CB 1VLYA 3QIDA 3S6EA 4JV2A 1ZH5A 3KLHA 4ZITA 2AWZA 5B7WA 3JYTB 4I69A 2GJ2A 4PG6A 3CIMA 2YWKA 3QNWB 2DXDA 4EK2A 4ED1A 4OV6A 3PEHA 4OZ1A 3QZ7A 4R5PA 3T5KA 1RAIB 3HVRA 3BJYA 2HQFA 4NCGA 2KRBA 4X66J 5AT1B 1Y0HA 4B3RF 1UAWA 3Q24A 2DB1A 3UCUP 1Q8BA 2HGLA 4OHXA 1B7YB 5CAAA 4DR5J 4IG0A 4RLEA 1UMJA 4DL3A 2VPWB 3CJQA 1Q53A 2EK6A 3FJ2A 3M4XA 1H2VZ 1RT4A 2PI5A 3TZZA 3SV3A 3UPFA 2ZDPA 4WPAA 2MZJA 1OMSA 2OHDA 1EP4B 1JLBB 3TAQA 3KLEB 2OPPA 4ILRA 1S0MA 3W7BA 3IBCB 2DD8S 3ULHA 1YDLA 4CM0A 3VVUA 4ZHRA 1JQGA 4M5NA 4OZLA 1M5VC 3MCSA 1S79A 3W5XA 2F9DA 5CHCB 3HDSA 3QO9B 1TV6A 2R9LA 1UJ6A 4A8KA 1E6YA 4HH1A 3NMRA 3M1VB 2HHQA 4RX6A 4PZVA 3P49B 3WX8A 2AHOB 1OIAA 2QYGA 1K47A 3UDEA 4F7VA 5C25B 1RA7A 2RUSA 2XNRA 3M8QA 2JFDA 2J9DE 2CQIA 1G7CB 4C0BA 1M5KC 2CRLA 4ECVA 3C6UB 2Q6CA 2QL9B 3MD3A 1HNZJ 5KFIA 3NNAA 4ZMMA 4NRTA 1R27B 3GIMA 5A0YB 4ZS6A 1LWFB 3G87A 2Y1RI 1S1WB 3DOKB 1T7PA 4LF1A 2N7CA 2RB7A 4F25A 4KO0A 3KJVB 5HROB 3MAAB 3DRXA 4ILMA 3PW7A 3W2WA 2R7RA 1ZZFA 4GVBB 5LJ5Y 3QAUA 2UV8A 1AB8A 3TUIC 2PD1A 3SV4A 4X65J 5THWA 4DV1J 5CYMB 3E01A 3D6HB 2MQ8A 4K8RA 5IT9U 1YWXA 3AOBA 3M8PA 4KIAA 4D3HA 4GKKF 2ZH6A 2CNNB 5RUBA 4X4VA 4MKBA 1XMQF 3GONA 1HI0P 3BR9A 1TL7B 1NDLA 1BE4A 2GW8A 2B51A 1HR0J 3MFHA 5U47A 1SC1B 1UW9A 2QO3A 4F67A 4KH1B 2DR8A 2V68A 1IKYB 5GAGU 1I3OB 1XNRF 1ZM3A 2WSEC 1GK8A 3HVTA 1FI4A 3C6TB 4DR2J 2ZOGA 3IGVA 2Q66A 2O67A 2CPFA 1NK6A 4J9KA 2DIUA 3OSNA 2MKHA 4Q0BA 2J5AA 1XR5A 4C8LA 4FXDA 4ED3A 4YS2A 1P27B 3G82A 4H4KC 2B6AA 5CZXA 4ZPCA 2W7OA 5E7OB 1FE0A 1ZYQA 2XZDB 4RWWA 3EX7B 2RQCA 2CG4A 4NCAA 3CXCR 1S0NA 3MMCB 4F8RA 1WG1A 2DR5A 1NKCA 1IUJA 4LSLB 1C1CA 2FLNA 3FVYA 1U8WA 1Y3KA 3DLKA 2F8MA 1UL3A 2HMIB 1N33J 1OY6A 5LSRA 4I0WA 2GIFA 3QPIA 2RKIA 3QRQA 1N32F 5F0WA 4QIEA 5KFGA 1VQMS 1UWBA 2EG2A 1VBYA 3KJQB 1RAOA 2GAGC 4JI3J 1EAYC 1GQEA 2VH7A 2AV5A 4H54A 4B9SA 2XB2D 2J9EA 3FMWA 1EB0A 2I38A 4O3SA 4TU9A 2KVIA 4M5DB 3MOJB 2Q3PA 1WSVA 1ULRA 1RAFB 2UVWA 3THPA 1Q81T 1OY9A 4CO3A 1GAOA 1KQFB 1QUPA 1SBRA 2ZC3A 2RU3A 1KDNA 1Y9OA 1VRTA 3VAIA 4DV0J 1FKPA 4O4GB 3L7PA 1KLMA 4DV6J 2DEJA 1RADB 2MQNA 2A2CA 3EDQB 2G9OA 1K1SA 3EGZA 1V9OA 3JXOA 1KC8T 1J27A 2V2ZA 2V67A 4WJBA 5J1PA 3VGUA 1WG5A 2ZZNA 1FO1A 3GE9A 2C2ZB 2PA3A 3ZZPA 2P9EA 4DR6F 2I9SA 3Q2TC 5C42B 4RO0A 4FXVA 1TKZB 1YK9A 5J2PB 2R7QA 1RLDA 1U24A 2Y1IA 2IC3A 3SQOP 3BDEA 2EFVA 4YHHJ 1MMNA 1BQMB 1W2BR 3JQMA 3LWMA 1UZHA 3LP2A 1NUEA 2QX0A 5BR8F 4H4MB 2E5GA 4OHZA 2KFNA 1FDDA 4QU6A 2GZOA 4DZ6A 4P52A 1AZSA 5E3RA 3CCVS 4F3QA 4ED6A 3N6LA 3NAHA 3W3SA 1YSJA 2HLTA 4ZJOA 5EWFA 3NGTA 4PQUB 4K0KF 3U27A 3VGSA 1T0TV 1FCAA 3K8VA 2MQPA 2WOMB 4ZN1A 1I1GA 5E3CA 7AT1B 4MK8A 5B09A 3MURP 4ANEA 4I6WA 1SL2A 4KV8A 2LEBA 4Q43A 4MIAA 4NZ6A 2I6WA 2E7XA 2PSZA 2XWXA 1JLQB 3M6UA 4Q7AA 4LF6F 1ZBTA 4LFAJ 3R5DA 1VQYA 4YDDB 3A13A 1RTDB 3DXBA 2WZ1A 4IQMA 2UVRA 4IFVB 1JIHA 3SSRA 3MF5A 3SXLA 3K5PA 3IS9A 3M2UB 4BC9A 1TL1A 4ZIWA 1LWCB 1VQ7S 1R0CB 3ONQA 4YR0A 4R8UB 4NXNJ 2CUYA 4Y28C 4IQXA 4I4BA 1FFSB 3GIKA 1TUGB 4JI1F 1BD6A 1UVLA 4DR4J 4ZVRB 5JUMA 3JYTA 3ENAA 1N0UA 3C8YA 5AJ3J 4ERDA 2E66A 1XN9A 4F4XA 2DGOA 2KL8A 5EX3A 3UVJA 3A8JA 3ETMA 4IH5A 4UZCA 4U67Q 1CQMA 2G0IA 1JLAB 3IWNC 1SXLA 3T5LA 4NLYA 1R8BA 5KFAA 2BJEA 1X7VA 2KO1A 2C42A 4QIGA 2DY9A 5ETOA 2DGWA 4YR2A 3AJDA 2V94A 2QT7A 5K14B 4URSA 3SFGA 2MLXA 4WK1A 1LOUA 2GJFA 1SH0A 1GMUA 1R8HA 4QYZJ 3BBFA 2QLBB 2OPRB 1FRLA 3MEDB 1IVZA 3HHDA 1GEHA 3GJSB 2NSCA 2ZDOA 1EP4A 4CLSA 3H2VE 3CCRS 3NL0A 2HFUA 1FFGB 2P8IA 1RCOB 2YQ1A 4AD6A 1W2IA 2ZBIA 1U0HB 5DLFA 2HK2A 2PN6A 4DQRA 1RLCL 1IBKJ 2DNGA 3JSRA 4OQJA 3RR8A 3PJ9A 4ELVA 4FVCA 3QO9A 4M5LA 4O4RA 3AOCA 4DPUA 4MH8A 1B99A 2R8GA 1URRA 4ECUA 2Y1JA 3M1VA 2R2UA 1SL0A 2HBRB 1RHJB 4Q8EA 4IG3A 1IJFB 1D9DA 2OJ3A 3O2IA 4D3GA 4ID5B 5C25A 1SJFA 2KTQA 2YKNB 3HZEA 4JOUA 4TQRA 1ZTWA 1S1VB 3C6UA 1AYEA 3KMQA 3RAQA 1I5OB 4P7VA 2EPIA 4TU8A 3FFIB 4NA3A 2BABA 3KLGB 2PMHA 5A0YA 1LWFA 3H2LA 5EDWA 1VIXA 1X4AA 2E1RA 2WSFC 3OHBA 2CADA 4YEAA 3DOKA 3FZBA 5DG9A 3KK1A 2IY5B 3KJVA 3PYGA 5HROA 2VBXA 2ZITA 3EXCX 4GVBA 4OL8A 3I5CA 3U02A 2W9BB 4CLTA 1S4EA 5LSLA 1S1XB 4C98A 5CYMA 1ZA2B 1DY3A 3MM6B 7FD1A 2VODA 3DDNA 1U0SA 2H54B 3K59A 2ZWPA 3SBMA 4OI0A 3MM7A 1RGVA 4GC7A 4DFMA 1Y7PA 1AXQA 2MSTA 2GGPA 4DL7A 5DG7A 2HVDA 3I32A 1C4AA 4NYPA 4PR6A 2XI2A 2C2EA 5K5MA 1WHYA 1RWUA 4B3MF 2OPSB 1TL7A 4K4VA 1EKRA 2POKA 4YB6A 5LMNJ 4FF3A 5HVGA 1O51A 3OVBA 2KXHA 3FUYA 3R1LA 1EIYB 2R2SA 1IQTA 2A18A 3DDKA 3BSCA 1IKYA 1IBMJ 1KR4A 3HHLD 1RYSA 5HBMB 2AQ4A 4CCHA 1U02A 5D4PA 1FJGJ 3RB3A 1PO6A 2UUTA 3MUMP 3C6TA 3TANA 1HWIA 4YN3B 1FESA 3AODA 1QVFR 2Z2YB 5C7PA 2F65A 2BX6A 2R8JA 3ZTOA 1HWUA 1JLGB 5FLXU 1WJ9A 2FVSA 1TKTB 4ZDNA 5J2QB 4IO9Q 4NLTA 4NLQA 1Y11A 2CJXB 3MMCA 1WC1A 4LSLA 4DCOB 3PIOQ 3IA0A 4ZCMA 1MU2A 4IOCQ 4DUZJ 2JEIA 2C3PA 2KB2A 3B78A 3L7OA 1JJ2R 1Q4RA 2GHPA 3CMQA 4OFZA 1TMJA 3QZ8A 2CPZA 1ROFA 3CJ2A 2LVWA 4DF8A 4USUA 1OQ6A 3OTEA 3R27A 1TKXB 4M5DA 4N5SA 3W63A 2AW0A 3ZNUA 4OI2A 4OV1A 1WEYA 4AYBD 4CO1A 2ASLA 3OTOJ 2QLFB 1S0OA 5KFHA 4ENOA 3C66A 1RWNB 1YQHA 4N8NA 4O4GA 3VZHA 5B08A 1LEOA 1ITPA 3WHIA 4LF4J 2WONB 5L1LA 1M1KT 2MYFA 1T05B 3K57A 2B9EA 3UNGC 2ZM6J 4OMFG 4JV5J 2AYGA 2XGPA 4Y3CA 1U2FA 1NBEB 3GYXB 5KG2A 1TFWA 5ETMA 4DBQA 2CAJA 1QSLA 2DH9A 3NMAA 4IFYB 4ECRA 2DVIA 1YJWS 3X1LB 2A3JA 4MKYA 5C42A 3AJ1A 5CYQB 4HACB 1DJ0A 4AXJA 1D8YA 5J2PA 2NPFA 3THTA 3BKUA 4NLWA 2J8SA 1U1QA 2CYYA 2BA9A 2XS2A 1YJNS 4N8OA 2F7VA 1PG5B 1WSRA 2JHEA 4H4MA 1WHXA 3DC2A 1EQMA 3TEGA 2RILA 2M8DB 4DPXA 1UA0A 2VICA 4DV3J 3NXZA 4OHYA 4K4UA 4PPZA 2VQFF 1CJUA 2CQ1A 3AHPA 2CWKA 3MDFA 1UJ5A 4I2PB 4PQUA 4LF5F 1EKSA 1FKAF 5IM0A 2YKPA 2ZOFA 3H40A 2HYIB 2RT3A 1M5OC 2AEFA 2YNGB 3GJTB 4QR1A 3GLJA 1JLQA 2PFDA 2C3UA 2AGQA 4ZJLA 4QW9A 2ACYA 4HT5A 2W4DA 1M1HA 3PEJA 2QTWA 3MI7X 2K8GA 3MR2A 2VFVA 3IAS9 5GVQA 1RTDA 4RUHA 4DG1B 2DHSA 3O44A 1PYOB 4IFVA 1IJEB 1UWAA 1VOMA 4DV4F 3M2UA 5L1IA 1F5AA 5F8GA 1LWCA 3RGIA 1WI8A 3G86A 1KNZA 3RUBL 3D3CJ 2XO6A 1FRMA 2PC6A 2B9WA 2FGOA 3KYLA 3T9NA 3F0NA 5CCLA 4JI7J 2HWTA 2DHXA 2KG0A 2D7SA 1NPKA 3BGFA 1U49A 3DDIA 3FEZA 4NI2B 2W9AA 4TQSA 2I0XA 2GMHA 3FQLA 2FHKA 5M2UA 1FHTA 4KT0C 4QU7A 2YH1A 3QJLA 2HW3A 4KGXB 1B7FA 1EHWA 2D41A 1JLAA 1TQLA 3HKWA 5KG3A 2YNIA 2SXLA 2M4MA 2C2NA 3CO9A 4HI1A 2UVVA 1YI2S 1KTQA 3IRWP 1IR1A 1VC5A 4B9MA 3KMSA 5K14A 4U7CA 1YRXA 4LSNA 1AROP 4QQBA 4KHMA 4FKYA 2XSJB 2C2OB 3ZTPA 2AJQA 2KYXA 2RAQA 5DZ6A 2L08A 3OL9A 2OPRA 5A8WA 2IRUA 3V5RA 3I96A 4IO1A 4DR1J 3U7JA 4Q5VA 3W60A 2M0GB 1VK3A 5HJYA 3LF0A 5ETKA 2LEPA 3IBFB 1U0HA 1JNRB 1VC0A 4U7UK 4FNHA 2XM3A 2VIHA 3B4DA 1CEZA 2OTLS 4QBUA 2LQ9A 5JVGQ 1NSKL 3TQEA 4URQU 2XQCA 4KAIA 1XWLA 2RQKA 2H48B 2VG5A 2OEJA 3D3BJ 3TW0A 1T9XA 2JOQA 1D09B 2YQ3A 1I94F 3LUYA 4TYBA 4BWJA 1VRUB 1IBLJ 3KUEA 4OJ1A 1I6JA 1ZS6A 4ID5A 2ZUGA 5K8MA 4PXEA 3KXDA 3MGJA 2F5GA 2YKNA 1S5ZA 1JX4A 2KXFA 2XMJA 2HNYB 3V81B 2DT9A 4WP8A 4LIWA 4OX6A 4LF8J 1X5PA 3FFIA 3TX8A 4ZOSA 3MXHP 2KDOA 3KLGA 4P10A 3I82A 2W2PP 4OX9F 3BGRB 2FLLA 2CDQA 4CO0A 3PO5A 4MFBB 4CO2A 2N82B 2IM1A 2HHTA 2YWGA 3EZOA 3G96A 4B9TA 4DV7J 3Q8UA 4B17A 2Z56B 2ZH8A 4K5RA 1DHMA 2XBPA 2MGZB 4PABA 2IVYA 2W9BA 1NDKA 1S1XA 2RIJA 1IKVB 4X64F 3CJ3A 1RAHB 1R6YA 3MM6A 4DSKA 3CDEA 1F3FA 1VHFA 1VRQC 2CFXA 5CABA 6FDRA 4J9RA 2VOPA 3GFHA 5T7LA 4NL5A 1RAJA 1KOHA 1RKIA 3AB2B 4P72A 4MK7A 2OPSA 1WEXA 1RWVB 1R0AB 3TJ8A 4JI6J 2DO0A 1S99A 4RNOA 3TX0A 3J7Z5 1S9EB 2ZZMA 1VC6A 1S1UB 3D6MB 4K4WA 3V6DB 3C19A 2EG1A 5JXSA 3RZAA 1JJHA 2J0XA 2BR0A 4J9LA 1N0VC 2GFFA 3ZTQA 1H38A 4F50A 1UA1A 3GR1A 3P96A 4EMDA 2FHMA 2I2YA 4P2XA 4B3OB 4CH0S 1VJWA 1HQUB 4PWWA 4CT9A 5J2QA 5I42B 3D6TB 4G1PA 1VLOA 2QFJA 3OR2B 1A0OB 1NO8A 2CPIA 3SDEB 2X51A 1UFLA 1YTYA 4TY9A 4ZPWR 4CP5A 1NK7A 4C0OC 4M95A 2EFGA 4LFBF 2QIFA 1XNQJ 2MQOA 4C48A 4Q45A 4FPRA 3M05A 3ZNJ1 4JUZA 1VYAA 1N36J 4J9NA 1JKHB 2LKZA 1TKXA 1R3NA 3NY0A 1HFEL 2CJAA 4UQTA 4B3TF 4DL2A 5HQ8A 4KC5A 5E33A 5ETRA 1S7HA 2OIHA 1N4LA 4RU2A 4WTYA 2KVQE 2HHWA 3SSSA 1VBZA 1T05A 1GXUA 3UCGA 2YKAA 4KTQA 1WELA 5EX0A 3BSNA 4LF9J 1C0TA 1X9MA 4YQWA 1MMDA 3MEGB 3TVZA 2XCAA 4WFXA 4CI0B 1FD8A 1OYEA 5EN1A 2BRLA 1GX6A 2MHEA 4IFYA 1WWHA 1D9AA 3M6VA 3H4BA 5BYSA 2WVEA 1TMMA 3MEEB 1V3SA 5HN0A 5ADZA 1RBLA 5CYQA 4HACA 1R7IA 3DOMA 3QFWA 3D68A 4ECWA 2OMOA 1WF2A 4J37A 3MM5B 4C4WA 2J9CA 2IMOA 1DQ8A 3HCXA 4P2MA 4DSEA 1D3WA 3R7BB 3W9JA 1J5OB 3GCWP 3UDVA 3BM7A 4GKJJ 2KM8B 2NREA 3RW7A 1VBKA 2GHVC 3VWSA 3TI0A 2QFIA 4RW6B 3H5XA 1XQIA 2GIQA 3DLBA 5KFTA 3KKFA 1FVSA 3AT1B 3K58A 2FJBB 1LXJA 1IKWB 4M63A 1T02A 1B70B 1RAEB 2DRBA 1AT1B 3C15B 1Q8LA 1QE1B 4F4AA 1RUSA 4LBIA 2MZQA 1SQFA 2KJVA 3W8GA 2IVFB 1S59A 4DR7J 5L8RC 1DQ9A 4CLFA 2GCFA 2YNGA 4DV5J 2M52A 1REVB 1G6BA 2F4VJ 3LW5C 2FDNA 3A3OB 2RRNA 4QPXA 3DU6A 3MCNA 3AOAA 2IJFA 1LK5A 3D5MA 2OKQA 1VQOS 5KT6A 1B0VA 3G6VA 2UXCJ 3BR8A 2R7SA 2D9OA 2Z2LA 4WF9Q 4DG1A 3CJRA 2OEKA 2R42A 1BQNB 2X3DA 2ZZTA 5E5NA 4JI0F 4KFBB 2VA2A 1UVNA 1HNWF 1FA0A 3QWPA 2IDEA 4B9VA 1N54B 3DHWC 1Y5NB 4QIVA 4NI2A 3B4MA 2XI3A 1Z2ZA 4DQSA 3JSMB 1R8CA 3R5CA 1RACB 2AT1B 3CD5A 1FWLA 4Y0FA 3F41A 5AE2A 1S10A 1Z4UA 4CIOA 3TYTA 2N3LA 1NJYA 1JK9B 5L38A 1DAXA 3TR5A 3TOQA 5A6PA 3FBEA 3RG6A 3E51A 2GHWA 3ZFVA 4DHVA 2XSJA 1SKWA 3IWLA 1S97A 3ETOA 4I6AA 2CQCA 1YBAA 1TKDA 4DF4A 1GXLA 3K7RA 3LGMA 2H5EA 2G13A 2YQ0A 3FBCA 1RDRA 4AQYF 1RAAB 2DCLA 3VAJA 3GG0A 2F9JA 4A8QA 1GTEA 4B3RJ 1J5EJ 2GIRA 2O5DA 5IFMA 5D77A 3GR0A 5DQHA 1HBOB 5KG7A 5GMEA 1PJ6A 3IRXB 3BBCA 3CCSS 4LVOP 1UFKA 3VALA 3C3LA 2CZ9A 1B4SA 2XY6A 1CPZA 3FSIA 4CH1A 2KT5A 2R2TA 1U7LA 1S49A 1L5UA 1RBAA 2MSSA 4M94A 2KKHA 1VRUA 1FWPA 2O1PA 4YB1P 1DRZA 5AXLA 3HK2A 3EVWA 4DX7A 2OMLA 3HLUA 3TVKA 1QJHA 5D8HB 1IM6A 3MEKA 4X66F 1K9MT 4KQZA 1P9YA 3KFWX 4LBHA 1TELA 4DR5F 2N7YA 2IBOA 2B9YA 4MFBA 2MXYA 1SKSA 3FCWA 4ANCA 4LMZA 4QWDA 5AXMA 4Y2CA 2MGZA 5F9NA 5GMKa 1RT3A 3LO3A 3ZTSA 4UTGA 5A2QU 1IKVA 2AMCB 4RWXA 2G4BA 2CNLB 3BN4A 1SIZA 4CYUA 1T9TA 1IXKA 2PA8D 2DGSA 4NLOA 1OY8A 4EGLA 2Y8WA 1QTMA 1LW0B 5C24B 1SJ3P 5L46A 4DU8A 3PRVA 1RI7A 2AIRB 4J91A 2F8EX 1BC6A 3LPEA 3S01A 1AFIA 4HHUA 3C16B 5KFZA 2QRRA 1O0PA 4ED7A 3QBCA 4DZDA 3K5OA 4RNMA 1R0AA 1YJ9S 1KFSA 1YBUA 1F2HA 4OLPA 4O3RA 3ZZRA 2ZWOA 4O0NA 3CJSA 4KBIA 3PJXA 1S9EA 1S1UA 2R2RA 2FJEB 3V6DA 1HNZF 1NK5A 5F8HA 3G8QA 1DQAA 4OYBA 1ICEB 4GKKJ 3BPDA 5I3UB 5K9FA 1N56A 3V4IB 1TAQA 3UNYA 4Q44A 2HIYA 2ILZA 2EFQA 3DLEB 4S0MA 2AX1A 5IZHA 1FEHA 1BUXA 1ZETA 2VF3A 1U1MA 2HZCA 5F8NA 4X4SA 1N5TA 2V63A 3R5GA 5D4NA 4CWBA 2J6TA 4B3OA 1IR2A 2FTRA 4ZVSB 1HQUA 5DQGA 5I42A 3EDRB 5FIIA 4XO0A 3HHKA 4K4TA 4X65F 4ETXA 4MK9A 4DV1F 1KQGB 3OR2A 3MMBB 1U47A 3OTDA 1DURA 1Q5VA 3SDEA 3LP0B 3GU0A 3VAFA 2K7JA 5B0BA 3C46A 4TLQA 3OVSA 4WFNQ 2J0QD 5DGAA 1PYSB 2HVHA 5EWGA 1YZ6A 1D8ZA 2CJKA 3NWRA 3PX6A 4RL1A 4BCAA 4O0IA 2FJAB 3OT9A 1VQPS 2L9WA 1TK5A 1JKHA 1RT4B 5IT9Y 3VCDA 3IC1A 5A6WA 5EHHA 2YTCA 1ZA1B 2VKZG 2OPPB 2E9TA 4WKYA 2FHOB 2XULA 5IV3A 1NB7A 1NRKA 3EJMA 4QWCA 4OJGA 2JEGA 3M9OB 4W4MA 1SIWB 1KS2A 2DHHA 4B3SF 2EK1A 2E1MC 3HHEA 5H1SV 3MPVA 1K73T 1ZOTA 2CIMA 1HNXF 2EC2A 1Q7YT 4K2XA 2W7PA 2DR6A 3HSZA 3DRYA 3I5AA 1NJXA 3THVA 4WFAQ 2DRDA 1U48A 3MEGA 3GYNA 1ZPVA 3BH6B 2JFKA 1PAUB 5HANA 2V2QA 4DL0C 2IMWP 1FD2A 3R8YA 3MEEA 3K5MA 1RQ0A 2I5JB 4LBPA 1CS4A 1LWXA 1YJRA 1N52B 1PBUA 3N9UC 4JYAJ 1N33F 3MM5A 4USVA 3EXYA 3G6XA 2BJDA 3CDAA 1FXRA 4TY8B 1Y5IB 1H98A 2BE7D 4LR9A 2IRYA 1J5OA 3NCRA 5KFMA 3FKBA 5HK4A 1MWQA 2MTLA 3PJWA 2OEMA 4RW6A 2LEAA 3W2WB 5F0UA 4F3OA 4KR0B 5DDQC 4USMA 2Z4PA 3L4BC 4M5JA 3C15A 4DV0F 1QE1A 3E01B 3V2UC 4DV6F 3JQKA 2AJ4A 2W4CA 1IKXB 3JB9k 1U8SA 5ETNA 2K06A 1REVA 4OLOA 1K1QA 2E5HA 4NEYA 2KXNB 1IM4A 2QJ3A 2V4RA 1VQ9S 1RB0A 4RNNA 5HI7A 4B9LA 1HHSA 4RU9A 3KHGA 3I55S 1UJ4A 5D0HA 3L09A 2IA0A 3GFZA 3G71S 1RWOB 2HQ3A 4U96A 4ZN3A 1V3RA 1RYRA 3W5ZA 2L9DA 1BQNA 4L74A 2DISA 5D0EA 4RW4B 2W01A 3UD3P 4WWSA 5SZTA 1VMBA 4Y65A 3KK3A 2A6OA 8RUCA 4JI2J 1K44A 2EKNA 4LF2A 4KGVB 2AZ3A 3L3CA 3PRDA 4YOEA 3JSMA 5I3QA 2JRSA 1VHIA 1WEZA 2A0FB 1WNEA 4P73A 2MJUA 4ELTA 4M5MA 1U4BA 3CJ4A 4NLRA 4PUOB 3P4UB 2ZKTA 4O44A 1U1LA 1NNDA 2JLFA 3SMZA 2QC3A 2FLOA 2B4PA 1WKJA 2YNHB 3TO8A 3HSGA 4J9UE 4OHVA 3HMJG 3PTWA 3I87A 4WYLA 3Q86A 1T3NA 3CJ8A 1QAJA 4U9RA 2YKQA 4PCQA 5J2NB 3PIPQ 4LFAF 3PR5B 4HYKA 1F9FA 4ZP7A 3IG1A 3GP9A 3NAIA 3KWMA 2AJFE 2HEKA 4EBEA 2UUAF 3CDUA 1S4FA 2H4WB 4DXLA 1W26A 1BWVA 1HBOA 3PRBA 3W8PA 3IRXA 3TARA 1N34F 1FNMA 3MCMA 3T6BA 2OLWA 3UQSA 1VQNS 3AA9A 1FKPB 4LUBA 5IC4B 3J81Y 3H25A 4OZ3A 4NXNF 3DLGB 4CZCA 1Z2LA 2IA6A 4DR4F 1GT8A 1LQ9A 3PVXA 1L3VA 4OZ2A 3OV7A 4YP3A 1SV5B 4XAKA 1MWZA 5AJ3F 3I0SB 1HQ2A 2ZBCA 2RQ4A 2MQQA 1RXOB 2MKCA 4Z7CA 1P6TA 4LR8A 2ZH5A 4WKRA 3HZGA 3V6HA 5F8LA 2QMWA 1FT8A 2JEFA 2KT3A 3QLHB 2VD3A 5HATA 1PCAA 5L39A 3D1OA 4CT8A 2QA2A 3DKDA 3MD1A 2WVDA 3OFFA 2OFHX 1XEZA 4HR2A 2U2FA 8ATCB 1S77D 4NLDA 4PRFA 1X4FA 3RB6A 2L3MA 4EFAC 3NOCA 4UY8T 4EO6A 1BLUA 1JXVA 2XLKA 1P1TA 4GC6A 4X4UA 4Q8FA 1NDPA 4UW2A 1XMOJ 4L3KA 2H4YB 4NLUA 2HS4A 1LW2B 1I51B 4ES3A 2ROPA 1WKLA 2HGMA 5D4OA 3FSXA 1FF2A 4LFCJ 1IBKF 2VQEJ 3ELHA 2EFPA 1VBXA 2QA4S 1LW0A 5C24A 3CCQS 4LF7F 2V0NA 2GMJA 4Y2MA 2DNHA 2GX8A 3H2UB 3BBBA 4A46A 1DLOB 3OLBA 3T5HA 2FVCA 4O3NA 3C16A 2B5JB 3A12A 2HFSA 3I4HX 1JXEA 2V5HG 2JNJA 2ZD1A 2UU9J 1U1RA 2CPHA 2DNOA 3IM8A 1FFWB 3EZ5A 1OS5A 3J7AN 4NMLA 4JI4F 2XMMA 2BMBA 4WU2A 2IIHA 4QCLA 2R7WA 1NHVA 2RUGA 2BZ2A 1F5BA 3PKYA 1BGXT 5I3UA 5G0RB 4HH0A 3V4IA 4NLXA 4UOGA 4DLEA 3HJVA 2C28A 4RUBA 1NHKL 3DLEA 2ROEA 5JJBA 3H5UA 2BBEA 4A8FA 4WTOB 3OW2R 2KI2A 1NHUA 2M3DA 2DNRA 1Q79A 3BSAA 3CD6S 1S6UA 2EXUA 4ZVFA 2N4CA 4XIUA 2VDIA 1FK9A 4DUYJ 2NUUG 4KGMA 3HF5A 1WDTA 2E7WA 5F8IA 2JLGA 1EZZB 3DMJB 5B0GA 1IWAA 4EBDA 1MROA 3A8IA 3I9V9 3UVJB 3MMBA 3HHNB 4NMXA 2MQMA 3LP0A 4ITSA 2FVQA 1MLAA 1JMTA 2D3O1 4EUVA 2DO4A 1FRIA 5KFWA 4HDHA 4ECQA 3QGHA 3AAWB 3CCMS 1JLEB 4L76A 3CTRA 4OX8A 2I1RA 1ZAWA 3GWCA 5DDRC 1VFJA 1HARA 2QMUB 2E44A 5HQLA 2VKRA 2HBYB 5LMNF 4FP9A 2HG4A 4AL6A 2PEHA 4R0EA 2YY3A 3IO1A 2WW8A 3N5FA 4X4TA 3GV5B 4KSEB 1IWGA 4GRSA 2MJNA 2W7AA 1IBMF 3UN3A 1HHTP 1VDHA 4ILLA 1F6TA 2H5IB 4DV2F 4A8WA 1KVKA 1FX2A 2QZ8A 2Q43A 1FJGF 3PY8A 2NLWA 2AD9A 1S6QA 3LA0A 3FBBA 4FDFA 4RNHA 2FY1A 3DI6B 3GFYA 1H74A 3CJKB 4DN0A 3KNAA 4UF4A 4FNIA 3K5NA 4CDIA 3POTA 3IGNA 2AEMA 4IG3B 4DWIA 4FYXB 3NGRA 3T5JA 4WFYA 1X5SA 1Y00A 2I5JA 1AA1B 2C22A 2Y0SD 1SH2A 4BC7A 4ZLJA 1O8BA 3DGVA 4C3KA 1NZAA 3N6MA 5JMNA 2ACMA 3J80U 3RBEA 4CQ1A 2ZHBA 5FLXY 3NOGA 4DFJA 3QFHA 3HHLB 2QGFB 1XIQA 2H65B 5B0AA 4TY8A 1YBTA 3VF0B 3OTCA 2CQBA 2YVSA 5B0FA 4NLPA 1X4CA 3CNQP 1OPZA 2MY7A 1BHNA 4RBTA 3KK1B 2BXJA 1F60B 5K8PA 1T03B 1K0VA 2ZJRQ 4HDGA 3M9MB 3C2PA 3CCWA 3M32A 4IUFA 5HVFA 1RZMA 4LRBA 1RU1A 2WRMA 4YB5A 2VZ9A 2XCPA 3OTOF 2FGCA 1XR6A 2WK4A 2CQPA 3ZZ0A 4ZLLA 3MZIA 5CXTA 4LF4F 3WZ0A 4FN5A 2IM3A 1IKXA 4DSFA 3MM7B 5M2PA 2ZM6F 4ZPBA 4JV5F 1WF0A 3Q89A 3R6LB 2WB4A 2GGPB 2BKPA 5L1KA 4RZRA 1X4BA 1W25A 4ZK7M 4RJVA 2MPUA 5HLFB 3IFEA 3W5YA 1HL6A 2HRYA 1Y10A 1HBNB 4LF5J 3AXMA 2FZCB 4YDXA 1NPRA 5K8OA 3VQSA 1Q86T 5GADU 4YUDA 3CIZA 3H42A 3OJUA 4V19J 3M8SA 2FY8A 1Q8IA 4RW4A 3FMBA 2M70A 2H51B 3SZ2A 3CJ0A 2OGUA 5F41A 1TL3B 2BANB 5IQ6A 1M0SA 1DTQB 2FQQB 2XTJP 4U6PA 2VL1A 4I7FA 3LGNA 5KFUA 4FXWA 2PE8A 4MT1A 5IWAF 3PV8A 4IH6A 5C5JA 4DV3F 3T6JA 1NKBA 3HSDA 1WC4A 5BYQA 3PYFA 2BW2A 3Q22A 2AYMA 3VVTA 5T14A 2E5IA 4LJMA 4PUOA 4NASA 4ZLPA 2GQCA 4X4NA 4QR2A 3PW2A 5ETVA 5FJ4A 1SI9A 4K4ZA 1AFJA 2YNHA 4ED4A 1MU2B 2CKWA 4PXDA 1WACA 4ZCKA 1P1LA 5KT7A 2HBQB 2QG9B 1A7GE 5J2NA 5BXIA 3EZUA 1YJ7A 3WBZA 2CPXA 5KT4A 2V9WA 3US5A 4K4YA 3LWLA 4P71A 4LRCA 2V2KA 2MEWA 2X3GA 2ZBPA 2APOA 4ZPTR 5E3PA 1VS3A 2XYGB 2NXJA 4HL9A 3PM9A 2ALZA 1WF1A 3FEXB 5CZVA 5GAHU 2BDPA 3ISNC 1CJTB 1U1NA 3IR7B 2IFXA 3DLGA 4G1IA 5L9XA 3CCJS 4DS5A 5HMZA 4V1Ak 1SV5A 1ZTTA 1OO0B 3D4JA 2C1EB 3I0SA 4XTTA 5KFDA 2E1CA 4X4OA 2M7SA 1T9WA 2P5VA 2NYHA 2X1BA 3ISND 3BQ0A 4NE9C 2RRBA 2VFSA 4QOTA 3QLHA 5D15A 3MHYA 5LXYA 2E5JA 4UZBA 3UN5A 3Q8SB 3QIPA 2W25A 1RJJA 2OPQB 4HHJA 2KFYA 1J2VA 4BBYA 4JI8J 2EI5A 1RTIB 3LOUA 5KG0A 2HHSA 1SQGA 2EFOA 5M2RA 2WVFA 3MM8B 2RH3A 1WC5A 2BJ3A 5A8KB 4MKAA 4DR1F 4X84A 2KG1A 2ZE2B 1TTHB 2LQ8A 4ZP9A 1LW2A 3R1HA 4CTAB 2NZCA 4L72B 1WKKA 1CJUB 4F4WA 2YPZA 3J7A1 2UP1A 1RTJA 3PX4A 1HI1A 2YBVA 1S9GB 5IM0B 5DZ7A 2MZ1A 2B43A 4ES2A 3NS5A 3V6JA 3LP1B 1DLOA 1VR6A 1NCLA 2B5JA 3GJRB 1NZ8A 4KHRA 2AJ2A 2KZZA 1VQ4S 1IBLF 3CMAS 3W9IA 4F2SA 2RNEA 4A8SA 2RF2B 2HSEB 3QGGA 2KYZA 5GAGI 3J81U 4ZPAA 3K2YA 3UW1A 3G6ES 4LF8F 2ERRA 1HYSB 4FZVA 4J9VA 3K8WA 2OELA 3DOLB 5G0RA 2XGQA 4DCPB 4QW8A 4EZ6A 2E1PA 3M8ZA 4M1KA 4NX9A 4GO5X 4DV7F 1Q7LB 4DFKA 5I3PA 2GJIA 2J8AA 2C3OA 3UD4P 4PPDA 2HK3A 4DQQA 4ZKAA 3HULA 1RTZA 1RHMB 3DMJA 3DGPB 3MMAB 2IHR1 2DGUA 3BREA 1HBUB 3ISZA 1KHVA 2YXLA 5SUHA 4CLKA 3GIIA 4FBTA 3MPWA 2NPIA 3NS7B 1UPMB 1V5VA 2YNIB 3RW6A 1JLEA 3WC2A 2CZVC 2VUGA 1F3VA 3TAPA 2GMLA
chains in the Genus database with same CATH topology
1R8PA 1REVB 1BY9A 1G6BA 2HHQA 4C8NA 3BEGB 1ZM4A 3LW5C 4LSNB 3J7YU 1FTCA 2CQ4A 2FDNA 4RX6A 4LQ3A 4KJIA 3P49B 4JI3F 2RRNA 4QPXA 3DU6A 1RTHB 3EGNA 2IJFA 2J7KA 5CD4H 2HFZA 3Q23A 1OIAA 5LXRA 5A8WB 4HTIA 3NKYA 4YY3F 1LK5A 2CVEA 3D5MA 3HX9A 5C25B 2OKQA 1VQOS 3MMJA 5KT6A 1RA7A 1B0VA 3G6VA 2XNRA 3M8QA 5JVHQ 3M32B 2JFDA 3BR8A 2R7SA 2J9DE 3EYZA 4EZ9A 2CQIA 1G7CB 4C0BA 2P6TA 2AJ1A 2D9OA 2Z2LA 2CRLA 4ICLA 5KT2A 4ECVA 3C6UB 2Q6CA 3T3FA 4WF9Q 2DH8A 2JC1A 3MD3A 1KOOA 1FTRA 5KFIA 4DG1A 5GAHI 3NNAA 4ZMMA 3CULA 4NRTA 5HMYA 5KFRA 1B0TA 1R27B 4JV0A 6FD1A 1H2UX 1X4HA 3GIMA 1QAXA 3BGLA 5A0YB 4ZS6A 1LWFB 1BQNB 2Y1RI 1FJ7A 1S1WB 1HQEA 4PQAA 5E5NA 1C0UB 2FHJD 4JI0F 1MSWD 4OX7A 4KFBB 3JSYA 2VA2A 1UVNA 5IT4A 1HNWF 3DOKB 4X2BA 1WTBA 1S72S 3D54A 1T7PA 1FA0A 1RP5A 2N7CA 2HVZA 3QWPA 1T8EA 2RB7A 3DI6A 4F25A 4B9NA 2XS5A 2E9ZA 1X5OA 3MEDA 4KO0A 3KJVB 2J0WA 2VG5B 2YWHA 5HROB 3CJKA 3I6PA 1MWYA 3IWXA 4UOCA 3DRXA 4B9VA 1N54B 3DHWC 3SCLE 4ILMA 3UDCA 5HP1A 2OO4A 3PW7A 1Y5NB 3W2WA 2R7RA 1ZZFA 5LJ5Y 4QIVA 2DNZA 3OL6A 3B4MA 2XI3A 1Z2ZA 4DQSA 1BWEA 4WXOA 3JSMB 3QAUA 2UV8A 4XDDA 1R8CA 3S7RA 2R7XA 3R5CA 3MFIA 1Q16B 3TUIC 1V6HA 2OTJS 2PD1A 2CQGA 3SV4A 1L3KA 2KM8C 2J7UA 5THWA 1N5SA 5CYMB 5KFVA 2IM2A 2F3JA 3CD5A 1G2EA 2PDAA 3E01A 4Y0FA 1NAQA 4PWDB 2DNNA 4DS4A 3F41A 5AE2A 1S10A 1YGYA 2DJWA 2D3OR 4DFPA 1YJUA 1Z4UA 4QWEA 2LMIA 1JXLA 4CIOA 3OLAA 1SJ1A 3HHLA 3H98A 1YWXA 5I4MA 3TYTA 2N3LA 2DITA 1NJYA 1JK9B 3M8PA 5L38A 1DAXA 4KIAA 3TR5A 4D3HA 4GKKF 3TOQA 5A6PA 4YHHF 2ZH6A 3E51A 5HO4A 2GHWA 2XZWA 1FDBA 3Q2SC 3KHHA 2BE2B 4LQ9A 2FVPA 3MUVP 3ZFVA 3G71S 4DHVA 2XSJA 1SKWA 3IWLA 4AXIA 4X4VA 4JI8F 4MKBA 1H3DA 1S97A 3NNCA 4Y34A 2GA7A 2ZH4A 3ETOA 1XMQF 1HI0P 3UR3C 3BR9A 5DJBA 1QY7A 3F73A 2WB1D 4I6AA 3J7ZT 1QM9A 1YBAA 2CQCA 3QAEA 3KG0A 2GW8A 1TKDA 2B51A 4DF4A 4OI3A 3MFHA 1T03A 1GXLA 5LSOA 3D2WA 3MAQA 3K7RA 3LGMA 4C3MA 2H5EA 2YKMB 2G13A 5U47A 4I7FB 1YJTA 1RDRA 3V6KA 4AQYF 2DGTA 4E8UA 2BOPA 1S1VA 2DCLA 2QO3A 4F67A 4U7CA 2C2RA 3VAJA 2Q6BA 3GG0A 5KFKA 2F9JA 4A8QA 1GTEA 2HGNA 2GIRA 2O5DA 5IFMA 2CJBA 3OL8A 1WTFA 5D77A 2DR8A 3GR0A 5DQHA 1HBOB 1RT5B 5KG7A 1IKYB 1NK4A 3VQTA 3JSBA 5GAGU 3IRXB 3CCSS 1CVJA 4HKQA 1XNRF 1ZM3A 4LVOP 4A47A 2ZH2A 2YX4A 2FJXA 5KT5A 2WSEC 3N01A 3VALA 3C3LA 1N48A 2PO4A 2XY6A 1CPZA 3FSIA 3HVTA 4IRCA 3C6TB 3DM2B 2QE5A 5T7LB 2ZOGA 4CH1A 1NH7A 3UR0A 2KT5A 2R2TA 3IGVA 2IVMA 1U7LA 1IQZA 1S49A 4HT7A 2GQQA 4A48A 2Q66A 2O67A 1L5UA 2CPFA 1NK6A 2MSSA 4LF9F 4J9KA 4M94A 2D74B 2DIUA 3OSNA 2MKHA 2KKHA 2VA3A 4Q0BA 2J5AA 3DYAA 4H4OB 1VRUA 1XR5A 3HFKA 4C8LA 2O1PA 4YB1P 4ED3A 1P27B 2B56A 4H4KC 5AXLA 2B6AA 5CZXA 1DRZA 2PMZD 3HK2A 2X1FA 4ZPCA 2W7OA 3PFOA 4OI6A 5E7OB 3MECB 1FE0A 1ZYQA 4K59A 5HLFA 4DSIA 2QMXA 2OMLA 5KFBA 3BGUA 2DNMA 1FJEB 2HS3A 2IJNA 2OSQA 4RWWA 2M5YA 3HLUA 3TVKA 3EX7B 3M2VA 2CG4A 2RQCA 4W90B 4NCAA 3CXCR 1S0NA 4C9DA 1QJHA 1HBNA 3SEOA 5D8HB 1KQSR 3D0GE 3MEKA 1LK7A 2IYIA 3MMCB 4F8RA 1WG1A 2DR5A 3TAMB 2AF6A 5MAOA 2B9XA 3AB4B 3G9CA 2G0CA 1NKCA 1IUJA 4LSLB 1C1CA 1FKOB 2FLNA 4X66F 3CC7S 3FVYA 1Y3KA 1K9MT 3DLKA 2F8MA 1HBMA 1UL3A 3M2RA 3NCPA 4ZPVR 2FJWA 4KQZA 5KFFA 2HMIB 5LSRA 3KFWX 1UEVA 3DU5A 5DQIA 4I0WA 4DR5F 3QPIA 2RKIA 1N5VA 2N7YA 2IBOA 4AUKA 1N32F 5F0WA 4RW9A 3AH6A 5KFQA 1K8AT 4I1TA 2B9YA 4QIEA 5E0OA 2RS2A 5KFGA 1JB0C 2QV6A 1VQMS 1UWBA 2XMUA 3FRYA 2EG2A 4MFBA 3TNVA 2YX1A 2MXYA 1VBYA 3NNHA 2CVIA 1SKSA 1GQEA 2EBGA 2VH7A 1TL3A 2AV5A 4H54A 4B9SA 2BANA 3GFXA 2K1RB 4LMZA 4QWDA 5AXMA 2XB2D 2J9EA 1DTQA 3FMWA 4GKJF 1TL5A 4Y2CA 2VPYB 2NSBA 3RRKA 3HPOA 1ZAVA 3BDPA 2U1AA 2I38A 3BN7A 4O3SA 4TU9A 2KVIA 3IR6B 1K0TA 2JVOA 4M5DB 2MGZA 5F9NA 3KHRA 1S9FA 5GMKa 3MOJB 2Q3PA 1WHWA 3SI8A 2J6UA 1ULRA 4PXBA 1RT3A 3LO3A 3SCKE 4ED0A 4PG8A 1U1PA 2CQDA 2UVWA 1IKVA 3THPA 4RWXA 1Q81T 4CO3A 1GAOA 2XMVA 1KQFB 1QUPA 3TP2A 3CSKA 3BN4A 1SBRA 1DTTA 1SIZA 2ZC3A 5B0EA 2RU3A 1QAIA 3ZZYA 1IXKA 2HS0A 3K0JA 1Y9OA 5HBMA 1NU4A 1C1BB 4NZ7A 1VRTA 2PA8D 3QJPA 2DGSA 4NLOA 3CCZA 4EGLA 5FD1A 3LAMA 3ITHB 3VAIA 4ECSA 1QTMA 1FKPA 2D1CA 1LW0B 3S8SA 1H2TZ 5C24B 4O4GB 3L7PA 1KLMA 2CPDA 1SJ3P 3MM9B 5AE3A 3J7YI 3NBPB 3GG1A 4DR7F 1RI7A 3I9ZA 5D3GB 2MQNA 3GV7B 2A2CA 4KPYA 2F8EX 4OZJA 2DNPA 4DV5F 3QIPB 1BC6A 3S01A 1AFIA 3N79A 2G9OA 3HVWA 2F4VF 1K1SA 3EGZA 2JJ4D 2CQ3A 4XK8C 2LLZA 1V9OA 2QRRA 2VBYA 1O0PA 5KFZA 5F8MA 4ED7A 2QSWA 1S1TB 1JLGA 2PT0A 3E8OA 3Q8RB 1KC8T 1WHVA 2ZNZA 4I68A 1TKTA 3K5OA 4WJBA 4RNMA 2XLIA 1R0AA 1YJ9S 5J1PA 1KFSA 4K50A 4OLPA 4O3RA 3N4WA 3ZZRA 3MUTP 1XMBA 2WBMA 1WG5A 1IN0A 1GTHA 2ASJA 2F8HA 1FO1A 2ZZNA 2JL9A 5HL7Q 3B8HA 4KBIA 1MW7A 3GE9A 5A8RB 3PJXA 1FEEA 1S9EA 2PA3A 3ZZPA 2DR7A 2P9EA 4DR6F 4OHWA 2UXCF 4DL6A 2I9SA 4EYHB 1S1UA 3Q2TC 2LQJA 2R2RA 5C42B 3PKMA 3ZZOA 2VBZA 3Q8QB 3BQ2A 2FJEB 1LKZA 4FXVA 3DLJA 3V6DA 1FERA 1TKZB 5J2PB 1HNZF 1NK5A 5KG5A 2RSQA 2R7QA 5F8HA 2L41A 1U24A 2PFFB 3M30B 1IR0A 1LWEB 2ZVSA 3G8QA 3NRBA 1DQAA 5B0DA 3H5SA 2R7OA 2IC3A 2Y1IA 3BDEA 2EFVA 4ES1A 1MMNA 1V3ZA 2E29A 5K9FA 1BQMB 2LCWA 5I3UB 1W2BR 1N56A 3V4IB 2J6SA 1TAQA 4QJVA 3OTBA 4RW8A 3BSOA 1RTJB 4Q44A 3LWMA 3T1HF 2ILZA 2W4PA 3HJFA 1D0EA 2EFQA 3DLEB 2VC1A 3I0RB 1SH3A 2AX1A 5IZHA 4CO4A 3LP2A 1FEHA 5BR8F 1S0VA 1ZETA 1KVJA 1KFDA 1U1MA 4H4MB 2HZCA 5LT5A 5F8NA 4X4SA 4B9UA 2E5GA 3I5BA 4Z37A 4OHZA 2J0SD 1N5TA 1C0TB 2J6TA 2PGCA 5D4NA 2KFNA 4ZPDA 4KHPF 3CCUS 1N8RT 1FDDA 4QU6A 4B3OA 2FTRA 2JWNA 4KB7A 4MMOA 1XTZA 1HQUA 3IN5A 5E3RA 5DQGA 3CCVS 3T19A 4F3QA 3E3XA 4ED6A 3N6LA 1FNXH 3HVAA 4M8LA 5I42A 5FIIA 4XO0A 3HHKA 4K4TA 3NAHA 3CDWA 4X65F 3W3SA 4ETXA 4I2QB 1YSJA 4MK9A 4DV1F 2HLTA 1G1XA 1KQGB 3OR2A 3MMBB 5EWFA 2DCUB 1SJQA 2FJDB 1U47A 3SCIE 3OTDA 1U25A 4PQUB 1DURA 3U27A 4K0KF 1KVIA 3HXMA 3SDEA 4DMZA 1FCAA 1FRJA 3K8VA 3LP0B 2FLPA 2MQPA 4DEZA 3VAFA 2WOMB 2WONA 2K7JA 1RISA 1I1GA 5E3CA 3K5LA 3CEDA 5B0BA 4MK8A 1FDAA 5B09A 1AUDA 3C46A 3MURP 2EW9A 4I6WA 4TLQA 3OVSA 4ECXA 3CMES 4C3LA 1SL2A 4RW7A 2OD6A 4IKAA 4C8OA 4KV8A 4WFNQ 2LEBA 2OPQA 2J0QD 4HEA9 4QYRA 5DGAA 4Q43A 3RRHA 2B3TB 4C11B 4MIAA 2HVHA 5EWGA 2ROGA 1RTIA 4NZ6A 1D8ZA 5LJ3Y 2CJKA 2CQ2A 3PX6A 2E7XA 1FXDA 3NG8A 2PSZA 2XWXA 1JLQB 4BCAA 4O0IA 2FJAB 1VQPS 2L9WA 1TK5A 1JKHA 4ZP8A 2XEXA 1RT4B 3M6UA 3MM8A 4Q7AA 3VCDA 5IT9Y 3IC1A 5E2QA 5A6WA 4LF6F 1ZBTA 3R5DA 5A8KA 1RT2A 5EHHA 4UY85 1VQYA 4RUCA 2YTCA 4WYWA 2ZE2A 4YDDB 2VKZG 2OPPB 1CC8A 1JLFA 2BRKA 5CCMA 2E9TA 2NQPA 2YH0A 4WKYA 4C8YA 2FHOB 2XULA 4CTAA 1J5EF 1NB7A 3PW4A 3CC4S 1NRKA 1YIJS 3U1NA 4OJGA 4QWCA 1RTDB 3DXBA 1EETA 3M9OB 2JEGA 4IQMA 3HKZD 2UVRA 1SIWB 1KS2A 1RKJA 2WCXA 4IFVB 4B3SF 1JIHA 3SSRA 2EK1A 2E1MC 3HHEA 2AGOA 2R8HA 5DGBA 5H1SV 2VG7A 2KU7A 3MF5A 3SXLA 3K5PA 3IS9A 3MPVA 1S9GA 3M2UB 1K73T 4BC9A 1ZOTA 2CIMA 1HNXF 1TL1A 1LWCB 1VQ7S 1Q7YT 4K2XA 1DBDA 1U2RA 3DN9A 3ONQA 2DGXA 3LP1A 4YR0A 2FJVA 2JX2A 2V4JB 2DNQA 4R8UB 2W7PA 3CWJA 1S76D 2J9DA 1N5YA 4Y28C 4IQXA 1X4GA 4I4BA 3DRYA 3I5AA 2ZJPQ 1NJXA 3GIKA 3THVA 2MKSA 4WFAQ 2K7KA 1U48A 4JI1F 1BD6A 2NYIA 1UVLA 4E98A 7FDRA 3MEGA 5JUMA 3GYNA 1ZPVA 3JYTA 4FF4A 2M2BA 2JFKA 5J2MB 1N0UA 5DG8A 3C8YA 2HHVA 3H8YA 2RF2A 3IR5B 4ERDA 2E66A 4JBCA 1XN9A 3OXFA