5B0CA

Polyketide cyclase oac from cannabis sativa, y27f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTFVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 25
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0cA00
1YJRA 2LXFA 2PD1A 1Q53A 2N4CA 2OKQA 2AJ1A 2AW0A 3QMQA 4OIXA 5IXUA 1P6TA 2KT2A 4HH1A 1YJUA 4A47A 3BN7A 4FNIA 2N7YA 2QIFA 3DCAA 5KAKA 1ULRA 3BR8A 4OJ1A 2HIQA 1S6OA 2OMOA 3MZIA 5T7LB 2LDIA 3FMBA 5F0UA 1AFJA 5T7LA 1FE4A 1Q8BA 2HFOA 1Y0HA 2N4DA 3HHLB 2QLWA 2BJEA 2FB0A 2L3MA 1AFIA 2XMJA 3K7RA 3DXSX 4OJGA 5B09A 3IWLA 3VTIA 1KVJA 1FE0A 2ACYA 2OFHX 3I9ZA 4A48A 2HLUA 1OQ6A 4ZOSA 5B0CA 1TR0A 4FNHA 1OSDA 2G9OA 1SB6A 4DL0C 2HLTA 5B0FA 4HL9A 1U7LA 3HX9A 1KVIA 5B0AA 3BDEA 2IYGA 3HF5A 1LQ9A 2GGPA 1YG0A 2BBEA 4Y2KA 2LQ9A 1Y9OA 3HHLC 3KG0A 4HI2A 2GV1A 3IWXA 1Y3KA 4Q2MA 2W4PA 4OJ3A 4YEAA 1N5TA 3F44A 3LGNA 4HH0A 2K1RB 3CJKB 3KKFA 3CJKA 2K1RA 4A4JA 1R6YA 2KYZA 4A46A 1P8GA 2IFXA 4DN9A 1K0VA 1GXTA 2AJ0A 2XMVA 2KKHA 1MWYA 2IYIA 2XMWA 4OJHA 3QGPA 4DPOA 3LO3A 1Q4RA 3UDCA 1JK9B 2GO8A 2GFFA 3BM7A 1AW0A 1OQ3A 3BF4A 1YJVA 2XMMA 2OP5A 2ASYA 2KT3A 1Y3JA 3T9NA 4YDXA 3BB5A 1X8DA 2BUNA 2Q3PA 3TNVA 1OPZA 2QLXA 2RMLA 1N5QA 3TRGA 5B0DA 4U9RA 2ROGA 1TZ0A 2AP6A 2JDJA 2LQBA 3BGUA 3KG1A 2BJDA 2VH7A 2GGPB 1FVQA 1X0PA 1S6UA 1N5VA 2BYCA 3MCSA 1JWWA 1APSA 2W4DA 1SI9A 1TL5A 2FIUA 3FGVA 1W2IA 1VQYA 5B0GA 4NL5A 5K9FA 2ZDOA 3FRYA 4QOTA 2CRLA 1YRXA 2K7KA 4ZA1A 2K7JA 2ROEA 1RJJA 1SQEA 2XMKA 3HDSA 4Q2LA 3TOQA 4EFAC 3E8OA 2RSQA 1KQKA 2OD6A 1QUPA 1MWZA 2OD4A 4NPOA 2QYCA 1CPZA 1Q8LA 4Y2IA 2FHMA 5F0WA 2OAUA 1CC7A 2GCFA 1XBWA 2ROPA 2XMTA 2VV5A 1TL4A 5A6PA 1FEEA 3LGMA 2XMUA 1URRA 1FVSA 1VQSA 2EW9A 2PGCA 4Y2MA 1V3ZA 4F67A 5B08A 2FTRA 2HFNA 3GZ7A 1N5SA 5B0EA 2GA7A 1IUJA 5B0BA 1TUVA 2K2PA 3HHLA 3HFKA 1GXUA 3WDOA 1FESA 1FD8A 1WD6A 2OFGX 3KNGA 2RU9A 4HI1A 1YJTA 2HQIA 2ZDPA 2RILA 2W4CA 3HHLD 1CC8A 5A6WA 1X7VA
chains in the Genus database with same CATH superfamily
1HNIA 4ZVGA 1HI1A 3KYLA 2HHUA 1D0EA 2YKOA 4JI1J 3TEHB 1NK5A 1S76D 3OPKA 1UEKA 3MM6A 1XTZA 3IRXB 2ALYB 3BJYA 4ZLLA 1TKDA 1AYEA 2LECA 4DR2F 2G0IA 1LQ9A 1KS2A 3B8HA 1DQ8A 4HHUA 3W63A 5KT2A 1JLEA 1A6LA 1RTDB 3L7UA 4ZIVA 2VBYA 2JEJA 2KT3A 3BB5A 4ZITA 1S1TA 1T03B 4USHA 1X9MA 4M5KA 4UY85 1GX5A 4C8NA 4CH7A 5DDRC 3RAQA 4NXMF 4Q2LA 4W90B 1B0PA 3QJPA 1HIYA 2FHMA 2IRUA 1TL4A 1YLXA 1TP7A 1SJRA 2QV6A 3C3LA 5AJ3J 2HZVA 4LFCF 1YRTA 2V4QA 3KUEA 1Q86T 2RQMA 3CCQS 3EVOA 1NUEA 2CG8A 1KEKA 2R7RA 2VG7A 1W26A 4FKXA 3UCGA 3GR0A 3GIKA 1XIQA 4HTIA 3W64A 3OD2A 3GIJA 4DFKA 1P9QC 3H5SA 5IV4A 2BRLA 4PUOA 1R8BA 4L76A 4IG3B 2CVEA 4RZRA 4ECWA 4RU2A 5D8HB 3BV8A 2J7UA 4CLUA 4C8YA 4LR8A 4C2MA 3U1NA 5ITHA 3QWPA 4WKYA 5HMWA 3HSGA 2W01A 2M5YA 1RCOB 4ED4A 3SCKE 2W1BA 1NDPA 3G87A 3VZIA 1N5QA 1VMBA 2UXCF 2DHGA 2JDJA 3HKWA 2D74B 1APSA 3SCLE 4BC7A 4UOFA 3LF0A 3MUMP 2DH7A 4M95A 2PFFB 3TX8A 3OJUA 3J7AN 5KT4A 2AZ1A 4F0KA 2CPYA 2HFZA 3R5AA 4Q8FA 4OX9F 2DISA 2N7CA 2MKCA 3TANA 2XMTA 3VCDA 3M1VA 2C3YA 3W7BA 1ZETA 1W2BR 1A7GE 2YNHA 1IM4A 2P2CB 2XZTB 3CPWR 1FT8A 4MK7A 3KJQB 3QIPA 4M5NA 2KHCA 2OO4A 1TKTA 1LWEA 2KT2A 4UOCA 5F8GA 1JKHB 4MYTA 3UDEA 2DKOB 1S72S 4TNOA 3OHAA 2E5IA 3V6DA 3N6NA 2M8HA 3MAHA 1F0XA 2F1FA 3PHEA 5E41A 1TFWA 4Y34A 3W3SA 2XULA 3T3FA 1U1LA 4FBUA 1OSDA 2CJKA 5CZVA 3D0IE 3S7RA 3P8BB 5LMUF 2F65A 1UL3A 3EWGA 3JSMA 1OQ3A 5F8JA 4NLWA 4YR2A 4L6V3 2DXFA 1FFWB 1RT6A 4HEA9 4ED7A 4ZP8A 3M2RB 3H98A 4F7VA 2XM3A 1SI9A 4WTYA 4U7CA 2BANA 5B0GA 1Z2LA 1VRUA 3LQVA 4PQAA 4F50A 3QGIA 2JWNA 2NPFA 3UN5A 5A8KA 1XR5A 1RT1A 1XR7A 3PNIA 2ZH4A 4DV2J 2ZBIA 1WC6A 3B54A 1FWLA 1WOOA 3KJNB 3K17A 5A6PA 1G4CA 5C5JA 3TVKA 2ZE2B 4DR4J 1N34J 3KLHA 3D66A 4DU7A 3MR3A 4P2FA 3MMAA 5HBMB 3BQ1A 1SV5B 4FNIA 5DDOC 3M8YA 4UTGA 3VAHA 2D1CA 1SL0A 3W2VA 5D0HA 2ZKUA 2BX6A 3LPYA 5M2UA 2L41A 3C15B 1S6PA 4O0IA 2XWYA 4FS1A 3CMQA 3D28A 4DR5J 1XMQJ 5K20B 2CQHA 4LRFA 4JI8J 2MGZA 5C42A 1F5BA 1WELA 1Q8KA 2KN4A 2WRMA 4HTJA 4X62F 4G65A 3BO4A 2M2BA 3SSSA 1HI8A 1Y7PA 3NRBA 2ZHOA 2I2YA 4U9RA 2BABA 2HNDA 4IR9A 3IM8A 1MN9A 4OZ3A 2G2ZA 3R7BB 4JI7J 3IGVA 1VLOA 3W8GA 5J2MB 2E5GA 2LMIA 1G3OA 4LBIA 4YY3F 3P96A 1W25A 4Y2MA 2EFOA 2UZAA 2KZMA 2XHWA 1N36J 2B9WA 4CT9A 2VBZA 3R2DJ 1RTJA 3FZBA 1OJ4A 1RCXB 2Y9HA 4WYLA 3ZZ0A 2QL5B 2EWHA 2PI4A 1RP5A 3WX4A 1DTQB 1JLFA 4ECVA 3M32A 4X4UA 2HIQA 4ID5B 3VAJA 2QLBB 2RF2A 4ED8A 4CO0A 4KHPJ 3GMGA 4NLVA 4DL2A 2FC9A 4IFVA 4CIOA 2HQDA 2F4FA 4PG4A 3A3PB 2WZ1A 1QVGR 5CXTA 1KR4A 4FN5A 1FK9A 2DB1A 1M0SA 4J9NA 5ETLA 5HJYA 4OI0A 1K0TA 2XYGB 8AT1B 4I6WA 4RBTA 3T1YF 3MECA 5LT5A 4EBDA 4XPCA 1YITS 2QFIA 2WSFC 6AT1B 5EWFA 2UUWA 3NAIA 3MPDA 3C6TB 5EDWA 3T9ZA 1HNZF 2C42A 2O1PA 3QGGA 2HEKA 5GADI 1R3NA 1SC3B 1M5KC 4DEZA 3NGUA 1FKAF 2ROPA 3AFGA 3K58A 5KT7A 1GNKA 2DY1A 1NJYA 4IH5A 4F02A 1MG7A 4YUDA 1S7IA 1QE1B 3J80U 1LW2B 3EX7B 3CC2S 4RUAA 3CCES 1UFKA 4PWUA 2M52A 2RH3A 3MPUB 2ACYA 4DV4F 3W60A 4LRBA 4AYBD 3QRRA 4EMDA 2FC8A 2CQPA 4DL7A 2Y1RI 3M6UA 4M5GA 1S4EA 4A8MP 2WOMB 3ET6A 3UR3C 1WF0A 4WP8A 1SXLA 2YX1A 1S0OA 4I4BA 2A0FB 5ADZA 2FVCA 3V6JA 2R42A 5F9NA 5K8OA 4XTTA 4CYUB 3VALA 2RD5C 4OLOA 2RQ4A 4OHXA 4WFZA 2M3DA 3PKYA 2NXEA 3MD3A 2OD4A 3HXMA 4F04B 3JYTA 3BEGB 3J7A1 4L75A 2OTJS 5B08A 1RU1A 1U45A 3P49B 3OBIA 3SDEA 1TMMA 1QAXA 1T0TV 2B4PA 4G1PA 3O6QA 2IJNA 3SBMA 4RNOA 2VBWA 1R8CA 3BN7A 1NSAA 4OJ1A 4KGKA 4OL8A 2EFGA 1FKPA 4UW2A 2V94A 4ZPVR 1HBOA 4F25A 5F3TA 4F4XA 1R8PA 5AXKA 4CTAA 1FERA 3ZXWA 4K4ZA 3BPSP 2IFXA 1IJFB 1HI0P 1GAOA 1N52B 4PYDA 3S01A 4WCEQ 4RR5A 3MCSA 2LFVA 2CJAA 3MMCA 4ETZA 2GAHC 2V0NA 2VFUA 2R8GA 4NLGA 2FDNA 2PI5A 3H7HB 4P7VA 3QGHA 1KD1T 1UKUA 3RTVA 2HRYA 2CPJA 3GILA 5BR8J 1S1UA 4X4TA 3DM2B 2V8HA 1T94A 1QM9A 1UVLA 1RAOA 5KFLA 1QAYA 2MHEA 2W2MP 2JFDA 5HJXA 1Q1KA 1T02A 5J1PA 3OT9A 4NMXA 4JI3F 2XGQA 2W9CA 2RDDA 2IMWP 2RS2A 2YNIA 2HW3A 2PMWA 4P71A 5E0OA 1NO8A 4TYAA 5EHHA 1ELOA 3OTOJ 2BA9A 2R7SA 3C46A 3BGRB 4A46A 4DN9A 2O67A 1U48A 5KFKA 2GFFA 3OTDA 1RHJB 4PEOA 4WZMA 3ENAA 4QR2A 2OEJA 5G0RA 1BQXA 4QR1A 4KR0B 5LJ3Y 5EUHA 1PKUA 4ZVPB 5HMZA 3N79A 3PEHA 1YIJS 2CRLA 4NLQA 2ABYA 4P52A 1KSPA 3BPDA 3IM9A 2B6AB 4Q8EA 4WP3A 2A2CA 2FLPA 1HQ2A 3V81B 3PY8A 3A8JA 1MMDA 3IP0A 1UVKA 4TKTA 4X4VA 4ZJQA 3GZ7A 2MQLA 3TWZA 3EGVA 4YR0A 3K5MA 3HKZD 1PSDA 1Q81T 3W2WA 1FTCA 4OZ5A 3TA2A 2VB6A 2J7KA 3ZTRA 1RLDA 2VODA 3ADAC 3GCWP 4ED6A 1NDKA 2MYFA 2AEJA 4Q0BB 2C2ZB 1VHFA 2GHPA 4C0HA 4Y2KA 4HI2A 2MJNA 1FCAA 1K1SA 1K0VA 3TR5A 1P8GA 5GAHI 1Z1ZA 4QJVA 3CCLS 3FBFA 2DYAA 1REVA 1S9FA 3CT9A 1JJCB 3UCUP 2EKNA 1R27B 1VQ9S 5H9EJ 2FIUA 4B3RF 2CQ1A 1UVNA 3NMAA 1GMUA 2ATCB 2ZVIA 1Z2ZA 1YJWS 5T14A 2IA6A 2FUG9 2E7VA 3V6KA 2E9ZA 5DLGA 3JTPA 2COLA 2E1MC 1SQGA 2ASJA 3NCPA 3K0JA 3HJFA 3GU0A 2H51B 4OV1A 1FKOB 2XZWA 1FDAA 1RADB 2H4WB 2ZFHA 2U2FA 5HLFB 3EGNA 4DCOB 2Z2MA 4L3NA 4Y2AA 1LNQA 6FD1A 2EPIA 1XNRF 5L9XA 1TVRA 4OJGA 2ZZNA 2E5JA 3UDVA 4USUA 1FE0A 3I9ZA 3QPIA 2CJXB 3CCUS 1UZDA 1RI7A 1RWWB 5HL7Q 5IT4A 2MMYA 3AT1B 5J2QA 2ZD1B 2QC3A 3KJVA 5CCLA 3BGOP 2QMUB 3FEZA 2VKZG 2DK2A 3G4SS 1YVFA 2HZAA 4LF8F 2OJ3A 1TKXB 2AJFE 1UVMA 4JP8A 4BBYA 2AV5A 1ZA1B 3QO9B 3R7SB 1VC5A 2RJZA 3JAMY 5HMXA 4Q45A 4I1TA 1VK8A 4M5DA 3NKYA 4H4MB 2KYXA 3LH2S 4LVNP 3B4MA 3VZHA 4EZ9A 3S8SA 2HS0A 4TQRA 2H3EB 1X4CA 4F2RA 2W2NP 1AZSB 1IR0A 4U7UD 2OKQA 2MDAA 4LVOP 3NBPB 1SKRA 4I2QA 1PJ5A 1RAEB 3Q8RB 3DLLQ 2WVCA 2FJXA 4R0EA 1SCJB 3IR7B 4J91A 1CS4B 3AD7C 4JI1F 2NUHA 1ICEB 2DNKA 2D9PA 1T9XA 4DSFA 2HHVA 2QZ8A 3LGNA 2IAJA 3M30B 2ASYA 1U6ZA 5KG7A 1NM2A 2QLXA 2FQQB 2N3LA 3THPA 4ITSA 4WE1B 2YTCA 3CJRA 4AE5A 1V6HA 3JB9k 3PEJA 3AQOA 2A18A 2H5JB 4LF4J 4KH1B 2Q6BA 3UD4P 3I82A 4F67A 5DQHA 5KFXA 1QTMA 3QT7A 1WEZA 4QWEA 2ZH9A 1GMVA 1FD8A 3RYLA 4EYHB 3IBFB 1PAEX 5DDQC 2LCWA 2R7TA 4DS5A 1CG2A 4F4KA 3FMBA 1XMOF 4EEYA 4PG7A 2D3OR 1S97A 4FVCA 2JX2A 2GHVC 1RT3A 5F8IA 1HWJA 1S9EA 1TL7B 3W5ZA 4I2PA 4MH8A 3RAXA 1ITPA 4YEAA 3L7PA 4DPTA 1OS5A 1SC4B 1FA0A 3C16A 3VGVA 4XDCA 1KP6A 3NEKA 1CJTB 2R2TA 5IM0A 3MI7X 4DLEA 4X4PA 4LFBJ 1RA6A 4Z7CA 1VFJA 3CMAS 1S0NA 1XBWA 1Y5IB 4LBHA 2B9YA 1I3OB 3S1TA 3EE3A 3N28A 5K5MA 1RA7A 1Z4UA 4B3MF 3OUYA 2J6UA 4PZVA 2DPJA 1CJVA 2DHSA 1ZS6A 4QPXA 3BBCA 4A47A 4ZK7M 2CAJA 3EVMA 3NGDA 1VR6A 2ZWOA 2F9JA 3MPWA 3MEEA 3Q83A 4X4OA 1XWLA 2L3MA 4GVBA 5B09A 2D9OA 2Y1JA 1TR0A 3QNWB 1GK8A 1J27A 5B0FA 1NPPA 5LMNJ 3TO8A 3G96A 3THTA 4K5SA 4K4SA 1KQGB 3C14B 3GE9A 5E7OB 2L9WA 1V3SA 1VISA 2UVUA 1NSPA 3BDPA 1YJVA 1U2CA 4LIWA 4K4VA 2MY7A 2KI2A 1VC0A 2FPHX 2LVWA 2CZVC 4HKQA 4FXWA 1B64A 1NZAA 4O3OA 2K06A 4ZVOB 1T95A 1KLMA 1LWXA 1UWBB 5CZXA 4UQGA 3MEGB 2DNPA 3R5CA 4U8YA 1N32J 4RPFA 2VV5A 1HMVA 1TV6B 1DHMA 5DDPC 2HFSA 1HPZB 2LQ5A 1HYSB 4KO0B 2QGFB 3VAGA 2DO4A 1BWVA 4HT5A 2QIFA 2Q6CA 3O44A 3P6YC 1AFJA 4OZ2A 2HHSA 2R7QA 3H2LA 2XMJA 5DRKA 1H72C 3M8PB 4NX9A 4PG8A 3DRRA 4TLQA 1YG0A 2UVVA 2BOPA 4CLYA 3RB6A 2JVRA 3I55S 4BC9A 2DHAA 1VQ7S 1XMQF 1WTBA 5KG0A 1AW0A 4JI8F 3UDCA 4W92B 4AT1B 3MAAB 1KLNA 2MKKA 1R0CB 4P74A 2IJRA 5GAEU 1LWFA 4KRWA 4BHQA 2VH7A 1LWCA 1URNA 4ED2A 3Q23A 3TA0A 2X1AA 3DMJB 2PEHA 2KJWA 4DUZJ 1RDRA 4YN3B 3C6UA 5DGAA 2DCLA 2NZCA 1K47A 2DXEA 4M5HA 1VQ5S 2CNLB 4JI7F 3CO9A 2HWHA 2CQ3A 1V9OA 2CXEA 2HQFA 2MY8A 2FTRA 1HBMB 2XBPA 3DLGB 1FWPA 4DG1B 4B9MA 1X5TA 1YJRA 2RIJA 2V2QA 3HFZB 1Q7LB 3UPFA 4A8SA 2ZC4A 1IWAA 1TL1A 1WHXA 4BLGA 2E1PA 2B4OA 2FVPA 3MM6B 3LP2A 1AFIA 4W4MA 2IPOB 3UDLA 2RHQB 4F3MA 3IRWP 1Q0NA 2V6AA 2VU5A 2IYGA 3MF5A 5CHCB 1Y3KA 1JLEB 3RGIA 1H73A 1U2RA 1S49A 3MDFA 1RKIA 2CFXA 4ZP9A 1K1QA 3ZZPA 4JV5J 4TY8A 4WYWA 2CQCA 2Q3PA 3H42A 4OX7A 1FDDA 4K4WA 1S1TB 4EUVA 3DDKA 3I0SA 4Y6IA 1X4FA 4DCPB 3RBDA 1LFWA 2J9CA 2FGCA 1SQEA 2JLGA 1OMSA 1SKUB 2E5LJ 3D6TB 3T6BA 3FSYA 3EGZA 5E33A 4X64F 1KFDA 1T9UA 4DV0J 4JI0J 4O4GB 3UWTA 4CZCA 5D4LA 1JNZB 5AE1A 1IJEB 2VG7B 2AW0A 5IXUA 1YRUA 4X84A 2O5DA 1F60B 4DV6J 4PUOB 1RACB 3HFVA 3H5YA 1D3WA 4LSLA 3PRDA 4RUCA 1UA1A 2GIQA 3DOLA 3JSBA 2V4JA 3J7YI 3SMZA 4J9UE 1V5IB 4DN0A 4FZVA 1M1HA 2D69A 5FLXY 2P8IA 4TN2A 4QZVB 4KJIA 5HMYA 4LFAF 2FVSA 4USVA 4B3TJ 2R2UA 2Y0SD 2IC3A 5DZ6A 4QU6A 2PA3A 4BDPA 1KQKA 4CRJA 4NPOA 2IBOA 3M1VB 1HKAA 3UCZP 5L1KA 4LF9F 2UUAJ 4C4WA 1GH8A 3C15A 4GKKJ 2YNHB 1NCLA 3Q22A 1Y4ZB 3CD5A 5AXLA 1TKTB 1YK9A 4CLKA 3MFIA 4CI0B 2Z30B 1LWEB 3UQSA 5E5NA 2IM1A 2DGVA 3BR8A 3V6DB 4I6YA 4O44A 3N0VA 1ZYQA 3G6XA 1AUDA 1VJQA 2JH3A 1RWOB 1DAXA 2HG4A 4EZ6A 2IRYA 4NLYA 3RJMB 1PC4A 4M5LA 1KOOA 2DR7A 1X4AA 4NLOA 3JSMB 2NXCA 1JK9B 3AXMA 2QLJB 4DQQA 1X60A 4DUYJ 3M05A 1RT6B 4ZLNA 3GB0A 2BANB 2FHJD 3LA0A 1VRUB 2VJVA 1IM6A 3SCJE 3TOQA 5A8KB 4OYOA 3MCMA 5HVHA 1N88A 2KZZA 5F3ZA 4ERDA 4DR2J 1NKCA 5I3UA 2UXDJ 3KLHB 4RBVA 1IWGA 3MMAB 4BWMA 5IFMA 3BKTA 1LK7A 2GJ2A 1XQIA 1X7VA 5BR8F 2MSTA 3W2VB 3G8QA 2YX7A 3VV2B 1VOMA 4HVZA 2DRAA 1S6PB 2POKA 3HHEA 2QEXS 4DQPA 2QJ3A 4B9UA 2UUCF 2BMBA 3FSXA 5KFFA 3NY0A 4UOGA 1TL3A 1UWAA 1N33F 4UT4A 4N7TA 1WTFA 3IBWA 4OYBA 6FDRA 4NLRA 2MGZB 1CBKA 5C42B 2MJUA 2KFYA 3CF5Q 1BUXA 3MOZA 3PW7A 4AL5A 2MB0B 1GXTA 4F0HA 2XB2D 1ZOTA 4IO9Q 2OPQB 2G4BA 2DGSA 3TNVA 2VPZB 1HNXJ 4LFCJ 1OPZA 3MM7B 3FUYA 3HCXA 3FQKA 3EM1A 3IXQA 3GR1A 3AH6A 3DKDA 4EGLA 1IR1A 1RQ0A 1V5VA 1ZAWA 2HHPA 2ACMA 2P9CA 3W1YC 4ECRA 1VQMS 5KG6A 2PGCA 2CUYA 2GVZA 5CA5A 4OV6A 3MM5A 4A8OA 1RTJB 2WBRA 3BH6B 1NK9A 4NYZA 1JLFB 3ELHA 3M32B 1OO0B 1Y11A 1ULRA 2KRRA 2RF2B 2UXCJ 2OMOA 2WOMA 4J9VA 3ENVA 1DLOA 2F9DA 4OHVA 2HGNA 4IFVB 3FCHA 1DTTA 4JI4F 1SL2A 4P7TA 1M90T 3RW7A 5B0AA 1FK9B 1R43A 4OX9J 3ILOA 3GJRB 4Q7AA 2KB2A 2NXJA 4DZDA 1KVKA 1WKJA 3MCNA 3MECB 1IBMF 1QLNA 5BYRA 2BJ1A 1TZ0A 2YQ0A 1YJNS 3FRZA 1C4AA 1CEZA 4K5RA 4CO2A 3ZZYA 1BHNA 2VPYB 5C2CA 3I0RA 1RWVB 2R7WA 2DNGA 4QBUA 3AD9C 4PABA 3X3UA 3M6WA 2DITA 2OSRA 3CD7A 4PXDA 5LMUJ 3HHLD 1KTVA 1N5VA 3HT0A 3WC2A 4PRFA 4WK3A 5K8MA 2MQMA 4ZVQB 3ZNJ1 2RNEA 1Q79A 4YB5A 3EDQB 3A8EA 1ZAVA 3PYDA 3HD2A 2ZJPQ 1RGVA 1ZM4A 2MKSA 1SVDA 2Z2LA 3VQSA 3ET6B 1F2HA 2KRBA 2HFUA 1C2PA 2H1YA 2ERRA 1U49A 3CULA 3OVSA 1W7WA 4AQYF 4B9LA 1NKEA 5GVQA 3CDUA 4PKDB 2L48A 4F8RA 4DLGA 1P1LA 3E8OA 5A0YA 2QYCA 2ZH5A 3JYTB 2YWEA 2V8GA 1VQSA 1OY9A 3KLIA 1WSRA 4ENOA 1NSKL 1U47A 3DLEA 3SDEB 3RBZA 1RAGB 1KFSA 1KWMA 2QL7B 1HW8A 4X62J 1L3KA 2VFRA 3PV8A 1F9FA 1IQZA 3AXKA 3M8RA 4X65J 2H5EA 1YSJA 2QA1A 3R6LB 2CPZA 2E1CA 3AHPA 3EXYA 2XWXA 1FKPB 1VHIA 3FCVA 5EGYA 1HBOB 1N8RT 1SJ4P 3ILLA 2MXYA 4YY3J 3RRHA 4CTAB 1WWHA 3PR5B 5CYMA 3R2CJ 4XPEA 3CJ0A 1FO1A 3LAKA 2CQBA 1RKJA 3H8YA 3BGUA 2EC2A 3VF0B 2E7XA 3MMCB 3MUTP 2B7CB 1KQFB 3NNCA 4RLEA 1JQGA 1H38A 3NOCA 2RS8A 4KIAA 3I5BA 5FDLA 1SH0A 3OL7A 3RG6A 2JNJA 3M2UA 2WTFA 3EZOA 4LF4F 1JNRB 2CYYA 3VWSA 2RRAA 2DNRA 5D4PA 2H9ZA 3ITHA 3SQOP 4C48A 2RU9A 3KLGA 3D6MB 3BQ2A 2AJ1A 4K7QA 2C2EA 4ECXA 4MKBA 1DFDA 3T1YJ 2DNQA 3CMES 4DV3F 2XI2A 2JOQA 2W9CB 3RW6A 3V4MA 2YNIB 2HFOA 2AEFA 3RR8A 3ZTSA 5MLCV 1MW7A 1IKVA 1HNZJ 3OL6A 4O4RA 2EK1A 3HLUA 1ZH5A 3MPYA 1RBOB 3IR6B 3QGPA 4ZPWR 2HWTA 2VICA 2XYPB 5G0RB 4GKJF 1A9NB 4KAIA 1YTYA 1VCTA 3HVAA 1P27B 2FJBB 2CPFA 3CJQA 2AYEA 4OMFG 1WKLA 1ZAXA 1ROFA 1NHKL 1U0SA 3DFEA 3A4TA 3FC9A 2B7BB 1X4DA 2XTJP 4J9MA 4KGMA 4ZDNA 4LFBF 4DV4J 5HLFA 2HBRB 3DGPA 4H4KC 3NAHA 1FI4A 1IKYA 2EFVA 1CULB 2VF3A 4I69A 2VG6A 2PT0A 3W2WB 2NZ4A 2XG8A 1WHYA 4EU0A 2DH9A 1HBNB 1DZ5A 2FJDB 2FVQA 2F8MA 2ZD1A 1OYEA 4QYRA 1ZBTA 5B0CA 3R5GA 4ALZA 1JLCA 4DOZA 1SJFA 5IT9Y 1GX6A 2XI3A 1QAIA 4OI3A 1TAQA 4DV1F 3PW5A 1REVB 3I5CA 2ILYA 1BWEA 4QIVA 2ROGA 2QLFB 3HVRA 4ELVA 4CWBA 4TVAB 4IOAQ 1HW9A 1RTHA 4N8NA 1HR0F 2HRTA 1NEEA 1RXOB 3WZ0A 2K7JA 2ROEA 1RJJA 3K5NA 3D3CJ 2G0CA 2Z2YB 3KOAA 4RW6B 2V67A 2ZH1A 4TYBA 4IG0A 1F3VA 4WZQA 1NHVA 4RW7A 2RILA 3GIIA 2BE2A 4RWXA 3NNHA 4OYMA 3TZYA 4PCQA 1N48A 4W98A 2G2OA 3W61A 3MZIA 1MLAA 1B70B 1EX8A 1TVRB 4DMZA 3P4UB 4YMEA 4P10A 2CJBA 5DZ7A 2VJUA 4ZPDA 4LR9A 2I1RA 5HVFA 3KKFA 3CJKA 3A12A 3FSIA 4KPYA 5J2QB 3N5BA 5FJ4A 5HN0A 2X1FA 2NQPA 2YKQA 3KJVB 1VBXA 2Y1LB 3HVWA 3Q86A 1HD0A 3KK2A 4RUBA 5E3QA 2N3OA 3PRVA 1RWKB 2J0SD 2QRRA 4NI2B 5H9EK 2XO7A 5AT1B 1QUPA 5BXIA 3QZ7A 2I6WA 2X3GA 4M5DB 4DUZF 4YB7A 1RYSA 1RK8A 2J6SA 2A2DA 4ER8A 5GAGU 4NYPA 3KXDA 5A6WA 2VFVA 5GAEI 2BEFA 4WJBA 4A8QA 3M8ZA 4I2QB 3GFHA 5F8NA 1HHTP 5MAOA 2FB0A 3PG9A 1EJ7L 4JBCA 3Q0AA 4CH1A 3ZO7A 4X2BA 1S1VA 3HX9A 3NS5A 1RHUB 3OFHA 4HH0A 2Z0GA 1IBLF 1EQMA 2BVZA 1R8AA 3M9MB 3HSJA 4LRCA 2GO8A 3MWBA 4NCAA 3VVTA 4B9NA 1S0VA 2GZOA 2R7XA 3T41A 3OTBA 4YQWA 3R27A 4KQZA 3CJSA 4JV5F 3D7SB 3CO0P 1UMJA 1HARA 1FEHA 1IXKA 3BH7B 4MT1A 5I42A 2HHHJ 4GRSA 1VK3A 2HMIA 3BSNA 1M5OC 2XZDB 3PYFA 2BRKA 4WPAA 2RRBA 2NS1B 2UUTA 2W24A 3GYNA 1AROP 3KMQA 2E5LF 3P5TL 2RKIA 1NDCA 3A3NB 1WKKA 1VIXA 2B51A 1YJ9S 3P45B 4LSZB 2J8SA 3FK4A 1F1BB 1B3TA 4ILRA 4DXLA 5T7LA 3C14A 4FXDA 4WBFA 3FJ2A 1NRKA 4B3RJ 2H65B 1RT3B 1S9EB 4RWWA 3DRXA 3VGTA 4DV6F 2HNZA 1CJUA 2KVQE 1VBKA 2J0WA 1KTQA 1C1BA 2C3MA 4RW8A 1N4LA 2FLLA 1JB0C 2KKHA 3CUNA 2CQIA 1B99A 2PFDA 2X3DA 3QIDA 2DT9A 5L1IA 2PE8A 4FXVA 5CYJA 5IM0B 1X5SA 4I56A 4DHVA 2DGWA 4XO0A 1R31A 5EWEA 3GV8B 2CIMA 4DFMA 3TJ9A 3M8SA 3RB4A 1HYSA 4KO0A 3N9UC 4C8MA 1XNRJ 4B3TF 2XY7A 4U7UK 3HSDA 2LQ8A 2RE1A 4KE5A 1FFSB 1WHVA 3VQTA 2BW7A 3CCZA 2IDEA 3OUYB 3JAMU 4IOCQ 2ZDPA 4B9TA 1FRMA 1MSWD 1CJVB 1RHQB 1T9VA 2IM0A 1EETA 1EARA 4WFBQ 2WVBA 5D4NA 4LF8J 4GVBB 2YVSA 3R8YA 1HHSA 1S0MA 3Q8QB 3QSIA 4OYIA 2FJVA 4ZOSA 5HI7A 1U1KA 5JVHQ 3F0NA 1U7LA 2AGPA 1IKXA 2LQ9A 4OJ3A 4U8VA 4C3KA 4B02A 2F4VJ 1HWLA 3BM7A 4B08A 3NMRA 5IS2A 2VQEF 3VAMA 2WK4A 1L3VA 2XLIA 1UW9A 4FYXB 3EPIA 2HBZB 3OVBA 3PR4A 4LIRA 3MTKA 1KLMB 4ILLA 2LDYA 2XSFA 4DG1A 1VLYA 3BSCA 1T3NA 3WHIA 1VI7A 1HMVB 4I67A 3MM9A 2B0GA 2F7VA 1L3SA 4WFXA 1TU0B 1QUVA 1KONA 3NS7B 1IUJA 2BV3A 2PO4A 5KFAA 2DVIA 3NNAA 3HMJG 3G71S 1IQTA 2KXHA 1E6VB 4KYZA 2UXDF 2WAQD 3DGVA 5J1NA 3IG1A 1WEYA 3GIMA 4DQSA 3DLBA 3I56S 3K5LA 2V8PA 2VDHA 3DRRB 4WF9Q 4A8WA 2RRNA 5IQQA 4OHYA 3DLKA 3CGIA 1HWIA 1SJ3P 1REGX 3CCTA 1RT2A 3GYGA 4MKVA 4P72A 4H4KA 1LWFB 4IH7A 1NHUA 4LF7F 4B9SA 4I64A 3UR0A 1LWCB 4PXCA 1Q78A 5FIIA 3QJLA 2LLZA 2HVDA 3C6UB 5DO2A 1DQAA 1HNXF 1VRQC 2N82B 3MM8A 4O4GA 4NA1A 1XMOJ 3CE8A 3GFZA 5LM7E 2QSWA 1H6KX 4D3HA 5GMKa 2ZOGA 2CWKA 3BZQA 2WBMA 1XEZA 4ZCKA 3ISZA 2K2PA 5LJ5Y 2YH0A 2UXBF 4OIXA 4NA2A 2BKOA 3UVJA 1TL1B 1NH7A 3PO5A 2CA9A 3SSQA 4QPTA 1NK4A 4GVLA 4ZVFA 3DXBA 3LP2B 4ECYA 2APOA 2RAQA 1TK5A 2HLTA 3TAPA 1X4HA 4KPCA 2J7WA 4I68A 4IFYA 5F9LA 2OMLA 2DGQA 3AB4B 3H0PA 4HR2A 1NB7A 3PHTA 4TY8B 2YWHA 4PQUA 2EEYA 2UP1A 3MD1A 2L9NA 2ZWPA 1RBLA 4LMZA 4YHHF 4B3MJ 3I0SB 1VQ8S 2OUGA 3MUVP 4ICLB 3G6VA 1VQYA 1GTHA 1SJ1A 2HYIB 4YFUA 1RAAB 2CZ9A 4OYXA 3DYAA 5HANA 4YS2A 3K5PA 4RU9A 2ZUAA 1N0UA 2AX1A 4ECZA 4CM0A 2W25A 2GA7A 1SKWA 5ETVA 1WOPA 2HBQB 2BQRA 3R5JB 2ZJQQ 2OTLS 2PD1A 3GIRA 4O3QA 4RUHA 5CYQA 2NYIA 1QAJA 1SUQA 4MIBA 2HVIA 2GIRA 2XHCA 4ZLPA 4LSLB 4RW4B 2Y0BB 1GEHA 1FNMA 2AU0A 3DOLB 2V4JB 1HFEL 2BW2A 3CJTA 1WORA 3QT5A 1I94J 3LAMA 1G1XA 2BM1A 2IJFA 1YZ7A 3D54A 3OTEA 2MZQA 2IC3B 5L9NA 1VIOA 2KFNA 2NLWA 3TAMA 3CTRA 3D0HE 2DIUA 1DRZA 4K4YA 2PA8D 2Y8WA 1RWPB 4LT6A 1XNQJ 2JFKA 5B0BA 2ALZA 3ZNUA 5FD1A 3WDOA 2E7WA 1RB0A 4DPUA 3RU0A 2WSCC 4USWA 4CT8A 2AYBA 4KT0C 1QY7A 4O44B 4ZVUB 5KG1A 2BJEA 4X65F 2OPQA 3SV3A 1CQNA 3KK3A 3W66A 3MM7A 4PR6A 4LQ3A 1RSCA 5E3AA 4RO0A 1Y10A 3DRSB 1WF2A 4ANDA 5DETA 3CXCR 4NE9C 2DO0A 4AFFA 2BR0A 2A3JA 3JTOA 5JMNA 3ETOA 1JJ4A 4C11A 3TJ8A 1VDHA 2MZSA 3KHRA 1YBUA 2I38A 4NMLA 2OD6A 4CLSA 1NK7A 1OWXA 1P9YA 2VPXB 1XN9A 1FEEA 5I3UB 1WACA 4KHMA 1B7FA 4DWIA 4DS4A 1D9AA 4OFZA 1FJ7A 3E51A 4MKYA 1J5EF 1H2UX 1ZTWA 5ETPA 4ED1A 1S59A 1U6BA 1PGZA 1NNDA 2WSEC 4E2FB 4HH1A 1JXVA 1T05A 2GW8A 4ZMMA 1TL3B 4JV1A 3K7RA 4LR7A 4EBCA 2JL9A 1SB6A 4FPRA 4QWCA 2E5HA 4TLRA 2JRSA 2HVEA 1AXQA 5ETOA 2W4PA 3AODA 1X31C 3NLCA 2EVZA 2XEXA 4OYWA 2NPIA 5GADU 4X64J 3KHGA 2UV8G 2V68A 4NCGA 3Q2TC 2JEIA 4U95A 5KFIA 3Q8PB 1S7HA 4GC7A 4LF6J 4F3OA 1YBTA 3ZZUA 2OGUA 4ZA1A 5A8WA 4R8UA 3RBXA 4BS2A 1X4BA 3TVYA 2NYHA 1Q95G 2GQQA 2HK3A 3ZZOA 3N4WA 2XSJA 2GVZB 4CNYA 1NK8A 2YNFA 3MM5B 1LW0A 4RJVA 1FF2A 1GXUA 5KFOA 4JI5F 5HATA 2AIRB 1TKZA 2HQIA 3OFEA 3H20A 2RVJA 1FD2A 4LFAJ 3EPGA 4KHRA 2EKYA 4RW9A 1DLOB 1FFGB 1DTTB 2PC6A 1YQHA 3A3OB 2V8VA 4P73A 3B82A 3M2VA 1BY9A 2NXUA 1NU4A 4K59A 3RBEA 1JJHA 2R2RA 4LF9J 1K73T 3CJ2A 2DR5A 5C2GA 3DLHA 2DY9A 2E1AA 2R8KA 3DI6A 1U09A 5LXRA 3TRGA 3NG8A 2NREA 5IWAF 2VASA 1TL5A 1UJ4A 1CJKA 2ZBRA 1HQUA 3BGLA 3JQKA 3CWJA 1MU2A 3I0RB 4DR6F 3CDAA 2BOAA 4DSEA 3H5XA 1R0AB 2HFVA 1MROB 3MOJB 3AA9A 1X9SA 5KFEA 1L5UA 1FJEB 1WC5A 2ILZA 2V5HG 3S6EA 3D5MA 4QWAA 2M8DB 2W2QP 2O01C 3HHDA 1ZA2B 4J9KA 2UV8A 2QA4G 3RRGA 2HHWA 2FJEB 2KJVA 2YQ3A 4WTOB 7FD1A 2PDAA 3IWLA 4LQ9A 2RT3A 3HO1A 3GJQB 4DL6A 1RWXB 2HURA 3LO3A 2DHXA 3QT6A 3T1AA 2HS4A 3MR7A 4J37A 1QJHA 4WXWA 3IGNA 2CNKB 4C97A 3VAFA 2EG2A 2FY1A 3PYGA 2X1BA 1PO6A 2UUCJ 1FNXH 2RHSB 1H7WA 4Q5VA 5A0YB 4B3OA 1N33J 3CB4A 3MURP 3OW2R 3SI8A 2AJ2A 5HROA 1J5OB 3KLIB 2H54B 3DLEB 3W8PA 4O3PA 4YOEA 4P9SA 2MLZA 2QN6B 3JQJA 4C8LA 4DSLA 4HI1A 4N8OA 3QT8A 2VA3A 1JLQA 2VOPA 4DU8A 3RB0A 3ILJA 2MLXA 4PWWA 1FHTA 3PFEA 2PSZA 3ZC4A 1Y00A 2YKNA 4EI2A 1N0VC 2M88A 4M94A 3NGTA 5A2QU 4CLWA 2W2OP 4WU2A 1LOUA 3VR1A 1T11A 5CYMB 1R89A 3KMSA 2LA6A 2CNNB 3M7VA 1WEXA 4RX6A 2PIIA 3GG0A 2DEJA 3BF4A 3TW0A 2QA4S 4OI1A 1UW4A 3QWUA 4MJKA 2R2SA 3Q8SB 3W62A 1NJWA 3FGVA 3UI3A 4PWDA 1S5ZA 5IC6B 2DNYA 3KHLA 2MKHA 1CULA 4KBIA 2GMHA 4F4YA 5FDLB 3SQGA 3PW4A 4QW8A 1L3UA 1WJ9A 5CD4H 1FRIA 4JI4J 1HBNA 3CJ5A 2B5JA 3M2UB 2HHHF 5B0EA 1RHKB 4DDFA 2EFPA 3ITHB 2J8AA 5G4DA 4ECTA 3KLGB 5KOWA 1IKWA 3QJJA 2MLYA 2AJ4A 1JXLA 3DDIA 1G2EA 1HQEA 1IBMJ 5GAHU 1N6QA 4HACA 3HHNB 1S6OA 4NZ0A 1WI6A 3TEGA 3KUHA 2C2NA 4RNMA 1IKVB 3KK1A 2DGOA 1I6JA 1HD1A 2BBEA 3OR2A 1RT5A 3FEXB 3JSYA 1H7XA 3T9NA 3QAUA 2KVIA 4QIEA 4NXNJ 4RW6A 3UNYA 1PYOB 1BE4A 2B4UA 3G6ES 2E44A 1H2VZ 2W7PA 1FXLA 3CCVS 2D7SA 5KG4A 5A8RB 3DGPB 1WOSA 1FVSA 2DPIA 1NZ8A 1S57A 1IKYB 4LJMA 3G8TA 3MAQA 2DXDA 2DCUB 2VG6B 4MIWA 3PKMA 4AXIA 4KB7A 3KHHA 4WKRA 5JXSA 1NDLA 4AQYJ 4M5MA 4O23A 2DEIA 1NAQA 2CJQA 3MMBA 1JLCB 1ZM3A 5KFPA 2G13A 4I6AA 4AD6A 4WK1A 4FBTA 3V5RA 4NI2A 1X9WA 3V4IA 5KT3A 1FTRA 4I7FA 2ZH7A 2GGPB 2F4VF 2BKNA 1DQ9A 1RTHB 4HLBA 3HULA 1S1XA 1ZM9A 5LSRA 1EKRA 2UUBF 3HDSA 2VQFF 5EWGA 2DBBA 1DURA 2B56A 2M4MA 4ZIWA 3IAM9 4ZPTR 4OYAA 2D3UA 2ZUGA 3POTA 1PBUA 1WG4A 2VHGA 4ELUA 4IG0B 2IMOA 1T9WA 1SIZA 1T8EA 4RW7B 2BE2B 3LW5C 3IBCB 4ILMA 2CADA 2DGXA 5AXNA 4PXBA 2V8DA 5SZTA 1WI8A 2Q66A 1T7PA 3LTOA 2PMZD 4PPZA 2QMWA 5L39A 1RWNB 3QLHA 4J9SA 2A6OA 1B4SA 3CJKB 1FXRA 4CP5A 1RISA 4OZLA 3BO3A 2IM2A 4A8YA 1BD6A 4IRKA 4PG5A 3RB3A 1NB2A 3EYZA 2IBKA 3KK2B 2I0XA 2C2DA 1QDUB 4MKAA 3M8QB 2OPRA 3JXOA 3G2XA 3WIUA 2W9BA 4DV3J 2GHWA 2C22A 3G8SA 4E8UA 2WCXA 4M5JA 2J0XA 2RSQA 1NPKA 3T1HF 1U1PA 2X51A 4A8FA 3D6HB 2FVRA 2HBYB 4ECUA 1C1CA 1R8HA 3OR1A 3I87A 2CDRB 1UJ5A 5ETRA 3ISND 4X4SA 2KH9A 4DQRA 4NASA 5I3PA 3PCOB 4OI4A 4GKJJ 4IQXA 2QO3A 4IR1A 2EC0A 2L9DA 4J9OA 5DLFA 3PIOQ 4KTQA 3QATA 2HS3A 1OQ6A 1VQPS 4H4OA 1OSCA 3D9BA 1S1VB 2X1GA 3CCWA 4U67Q 2P5VA 4NWBA 4D3GA 5KFWA 1N5TA 4XIUA 1WNEA 1MWQA 4I0WA 4IRCA 4DR1J 3T5KA 3G82A 5H1SV 4OI2A 3NCRA 1VYAA 4L73A 4NRTA 1YBAA 2RB7A 3AY0A 2HNYA 5IT9U 2LEBA 3F73A 3NCQA 3ISNC 1EKSA 2JC1A 3KFWX 4LRDA 4QOTA 1D9FA 3OXFA 3O8WA 3MXHP 3GV5B 3GP9A 5I42B 1HBUA 2HMIB 2KXNB 2F8EX 4OHWA 1Q8LA 4CLZA 3DHWC 2HKEA 2VG5A 4GO5X 3W9HA 3T5LA 1NBEB 2HK2A 3ENWA 4LF5J 2RKIB 1ZPWX 3CC4S 2VZ9A 4DV1J 2MQNA 1TUWA 4XDDA 4DF8A 5T7LB 2A1BA 3MFHA 5KG3A 1N5YA 3HHLB 4Z2XA 3CDBA 1HR0J 1KVIA 2HNZB 4XK8C 1JLGA 2ZITA 1CJUB 5EX3A 3PW0A 1C1BB 4RW8B 4V1Ak 1R6YA 1PG5B 4U6PA 2IYIA 1F2GA 2JSXA 4NA3A 3GCXP 4K0KF 3BKFA 1QSLA 3WC0A 2GVDA 3OLAA 4NOHA 2D3O1 4C3MA 4TU8A 4WFYA 1I94F 1NKBA 4FVMA 3HZGA 1KBRA 1PCAA 1E6VA 1YKWA 3LANA 3PXGa 2V9WA 4DSJA 4J9QA 2HHQA 3NGKA 1FRHA 2PN6A 1N5SA 1U2FA 4OYZA 2JHEA 2VONA 3H25A 4RL1A 2QL9B 3N6LA 3HVTA 5KFVA 2QLWA 1XNQF 1EETB 1E6YA 2HHXA 2Z4PA 5LL6d 5KOXA 5DQIA 2BE9B 3PTWA 2L08A 5F8LA 1QD1A 3IC1A 5F41A 3G86A 3J81U 2DRBA 5HSPA 2SXLA 5AE2A 4G3IA 4B3SF 1IKXB 1WC3A 4ED5A 2ZC3A 4IOBA 5T41A 9RUBA 2AEMA 2DR9A 4CCHA 1F9EB 1NSQA 3OSNA 2D3ZA 5RUBA 4DX5A 4IDKA 3T6JA 4MYUA 5B0DA 4ES3A 2LQJA 4J90A 1EIYB 2MSSA 5KFTA 3WQPA 2AF6A 5KFJA 5IZHA 2FLOA 1VJWA 1X0FA 1GQEA 4JI6F 1OPIA 2RQKA 3RR7A 2BJ7A 3TVZA 3MM9B 1JMTA 1TMJA 1HNVA 2H4YB 4PXEA 3PIPQ 4P2XA 3ZTPA 1HWKA 1IBLJ 3F41A 2HSEB 2KG0A 1SH2A 1NK6A 4UF4A 3LP1A 3TUPA 2J5AA 3IG1B 3G6YA 5KFYA 3L95X 3Q24A 3M6VA 4ES1A 5HQMA 4UUWA 4DFPA 4MIAA 1LV5A 4Z37A 5DGBA 4ZS6A 3DLKB 2JEFA 4ICLA 1Y9OA 2NSCA 1RT2B 2VDIA 4OJHA 4DPXA 4HHJA 3CJ8A 1RZMA 3PJXA 3KG1A 3MMJA 4FYVB 1CVJA 2MZ1A 4QWDA 1FNOA 2MQQA 1I1GA 3TJAA 2R7OA 3AJDA 1V3RA 2WB4A 3U7JA 2FJWA 2HVZA 3DU5A 2HAFA 3MM8B 3SXLA 3NS6A 2V2KA 2C3OA 3U1LA 2JLEA 4NRUA 4G1QB 1C0TA 2MKYA 4LF6F 3D1HA 3GONA 2BQUA 4QIFA 2BXJA 3NWRA 2CPIA 3FEYB 3NWGA 3DRPA 1YJTA 3H4DA 4KKOA 4RW4A 5J2NA 3MCOA 3QMQA 3J7YU 5CCMA 3UVJB 3ICLA 4GC6A 5LOQA 1IR2A 2P6SA 1CSJA 4JV2A 3HI9A 3KDOA 5KG2A 2KM8C 3TUZC 3DXSX 2Z2ZA 2KG1A 2C2MB 1EP4B 3DOKA 3Q8UA 3MHYA 3ZZTA 2LU1A 4RBUA 2JEGA 4IFYB 3LUYA 3CCRS 2YKMA 4ZN3A 2WW4A 1YJ7A 4CLTA 4PQUB 2C28A 5A76A 2AJQA 1QVFR 2IHR1 1NXIA 3P3DA 2ZM6F 1BQMA 4DR3F 1S6UA 5LSLA 1JWWA 3SZ2A 4QIGA 2ZHAA 5I3QA 1S9GA 1JLBA 4YDDB 1TQLA 5CH7B 3DYAB 2ADCA 1XERA 1GFWB 2XMUA 4ZHRB 5C7PA 1UETA 2VC1A 1D8YA 2E9RX 2UVWA 2B9XA 2OELA 5AXMA 4IH6A 2WVDA 3I5AA 2C2RA 2RDJA 2IM3A 5CYQB 2VQEJ 1QSYA 1SUQB 4XAKA 4V19X 3OJSA 4DBQA 3SFUA 2DRDA 5F0UA 3QSYB 4ETXA 2QX0A 2FY8A 2YKAA 3DRSA 1FXDA 3HM9A 3H5UA 2EK6A 3EGWB 3ONQA 2G0JA 1H98A 4MFBA 4ID8A 1VQOS 3IWXA 5KT6A 2W7OA 4C98A 3E01B 1TUGB 3CJ4A 1N54B 1WHWA 2GMJA 2XMMA 3OFFA 2Y1IA 3UFCX 4ATNA 1O6XA 3QRPA 1FDBA 1F6TA 4OZ1A 4DFJA 3T19A 4V19J 3U02A 2QMXA 2W4DA 4C9DA 3C19A 1ZM2A 2A6MA 2Y3YA 2XLKA 4LF2A 2WVFA 2E29A 2VD3A 3R3TA 3TAMB 3PX0A 1QSSA 1NK0A 5HVGA 1MWZA 2VFSA 4Y2IA 2JVOA 2HIYA 4MAKA 1RLCL 2GNKA 1Q5VA 3AB2B 4F4ZA 1Y5NB 3EZ5A 3EUNA 1RAIB 1PAUB 1L3TA 2ZNYA 4PYAA 4N56A 5D77A 3Q8VA 4X66F 1EHWA 2UVRA 4DV5J 4LF7J 1GTEA 4FF3A 4HT7A 1SPBP 4B17A 2WB1D 1Q7YT 5DG8A 2MZRA 3KK3B 4NYOA 4KSEB 2XQCA 4OYPA 8ATCB 2I5JA 2OHDA 2J76E 3GTYX 3PW2A 4U96A 1HWUA 1BXNA 1PYSB 5HO4A 2LP4A 1SC1B 4Q43A 5D3GA 4NLTA 5CQGA 3UW1A 1RYRA 1RT7A 3BS9A 2UXBJ 4EO6A 5IOLA 2YWWA 1VC6A 4OQJA 4NLUA 2ZEJA 4E0DA 2RUGA 2AYGA 1CQMA 1PJ7A 3V6HA 1RTZA 4C11B 1FX4A 1NPRA 2HPUA 1U26A 1U24A 1U8WA 4HDHA 2RDIA 3D6FB 2XCAA 5C24A 3PJWA 3UN2A 1C0UA 4MK8A 1RT4B 4CDIA 5HP1A 3GJSB 3ZTQA 3NXZA 2OLWA 4UZCA 2F63A 1R0BG 2AKWB 3PZPA 2DNHA 2BQ3A 4NLXA 2RU3A 3SEOA 2HZCA 4N77A 1S12A 3C8YA 1HL6A 1T05B 2KL8A 5KT5A 1U25A 2OPPA 2R8IA 4FS2A 4YHHJ 2ZBCA 2XYHB 3UN3A 1B0VA 1I51B 3TA1A 3OSPA 1F5AA 3IO1A 1U1MA 4P75A 3NL0A 5L38A 1IBKJ 2BM0A 1I5OB 3DOMA 2GO9A 5J1EA 3AAWB 1UPPA 1WUUA 2XMVA 3I32A 1UCNA 2UU9F 4USKA 2K3IA 4F3QA 4TU7A 4NCGB 5KFNA 2D41A 1R0AA 4MK9A 1MROA 3U1MA 1KHVA 4EYIB 3UNGC 4DSKA 2AHOB 5E2QA 4HYKA 3W5YA 2ZVSA 2R9LA 1MN7A 4WWSA 4LBPA 3E3XA 4J9RA 4OZ0A 2M70A 1YRXA 4NXNF 4QCLA 5A8WB 4R8UB 4USIA 2YQ1A 2J9DA 1TTHB 4Y00A 4K4TA 3DC2A 2XSJB 4DL4A 5L8RC 1D1UA 2YNFB 3VAIA 3HT3A 1LW0B 3K57A 1TKZB 4TY9A 1O51A 2BE7D 1OY6A 4F0MA 1VQ6S 3PX4A 5JUMA 4YR3A 2AD9A 2CPDA 3HD1A 4DR7F 4KY3A 3FDSA 4RW9B 4BWJA 4JYAJ 2MHNA 3OLBA 1UEUA 1JIHA 1NJXA 3H90A 3KLFA 3M2VB 3W9IA 2GX8A 3HHLC 4F36A 3R1HA 2K1RA 4ED3A 3MEKA 2IA0A 3M6XA 4Q44A 2WHOA 1BQNB 3DI6B 3L7OA 4M5IA 2ZZTA 3W5XA 1J5OA 4UQTA 4DCJB 3GFYA 1CJKB 1HQUB 1VRTB 1MU2B 3Q2SC 3GPAA 3SFGA 1ZTTA 2KO1A 3FVYA 4ECQA 5L1JA 2CQGA 4GMKA 2F3JA 2HQ3A 5KFCA 2WONA 2AT1B 4M63A 2WVEA 3R5DA 5C25B 4EBEA 3SSRA 1HNWF 5D78A 1Q8BA 3HZEA 5M2RA 1B0TA 3Q89A 1S1WA 1VGYA 3I4HX 2PMHA 3TQEA 4ANCA 3VAKA 4AL7A 3TI0A 4QW9A 4A4JA 3C66A 2BJ3A 4IKAA 4DL5A 1FJGJ 4ELTA 4YB1P 1AB8A 3MEDA 2ATLA 1IVZA 1J5EJ 2LQBA 1BGXT 2FGOA 2DIVA 5HAOA 3TX0A 2ZBQA 3QQCD 3IN5A 2DTJA 2IIHA 4KV8A 1JLAA 1F9HA 2W9AA 5J2PA 2K7KA 1U0HA 4R5PA 4L74A 4QYZJ 4B3OB 1M1GA 4LSNA 1XR6A 1S10A 5HROB 1YI2S 3PJ9A 3O2IA 3CW2C 2VIHA 1V3ZA 1SC6A 2Z8QA 3D67A 1UEVA 3EMTA 5JVGQ 3HFKA 3BBFA 2LEAA 4DX7A 1JLQB 2B3TB 5KFMA 4ZLJA 4KFBB 1S48A 1RTIA 4K4UA 2F8HA 2N7YA 1TAUA 4CLPA 2QG9B 2N4DA 2YKNB 2Q43A 2OPSA 4URSA 2MQPA 1S99A 3OVAA 1S77D 4X4RA 3GV7B 3JQMA 5AJ3F 1JX4A 2DH8A 4TXSA 2W2PP 2RQCA 3T5JA 2DGTA 4HHHA 5JJBA 2AJ0A 2XMWA 1Y5LB 1D09B 3GYXB 5DM7Q 3PO4A 1UPMB 2OP5A 4ZVRB 2GIFA 3KTQA 1T9YA 5I4MA 2E9TA 4JI5J 4DR1F 5A8RA 4JI2J 3J7ZT 2DNNA 4PWDB 3HJVA 4NL5A 2R4FA 5KG5A 2VC0A 4WIQA 4DPWA 3I4PA 3ZZRA 4EFAC 3SQGB 2YBVA 2CPEA 2MKIA 4R25A 2B5JB 4DI6A 3C2PA 2AGQA 3IS9A 2HQGA 3US5A 2YKPA 3FMWA 1S6QA 1SL1A 3LP0A 2OFGX 1PIEA 3AOCA 1JXEA 2YNGA 1VBYA 1IKWB 5KFQA 1HQEB 2KFZA 1N6QB 4YB6A 4LF5F 4ZJOA 4HACB 3FFIA 5IWAJ 4CM2A 2YY3A 3HPOA 4LRAA 3OTCA 4RKUC 4URGA 3BGFA 1KVJA 4K2XA 3KK1B 5ETKA 2GMLA 1GMWD 2BJ8A 5L1LA 2J9EA 4GO7X 4DR6J 2GGPA 3CD0A 2JLFA 2IVMA 3OR2B 3F44A 3FBBA 1RT5B 3I6PA 3HP6A 3W9JA 1NJZA 3KLEA 3HHKA 5K14A 2XGPA 3IFEA 5LSOA 1NLKL 1ZPVA 2FHJA 1K8AT 3R97A 2QT7A 4E98A 2XS7A 4DV7J 5E3PA 4UZBA 3G9CA 4USJC 2BKPA 4DX6A 4Y3CA 3OV7A 4C8ZA 2OAUA 4M8LA 2MPUA 3FKBA 2HGLA 3Q8YA 4C6AA 2IDLA 1VQNS 4PG6A 2LXFA 5K8NA 2YPYA 4ES2A 5H9FK 1FRKA 2CDQA 2HAIA 4NLSA 5EN1A 2GQ2A 3MR2A 2ZKTA 4DV2F 4DL3A 3IRXA 3MMBB 2KTQA 2ZOMA 4DR4F 1N34F 8RUCA 3O5TB 3M8QA 2FZKB 5HK4A 3P5BP 2QYGA 3FBCA 4R0JA 3N01A 1RTDA 2GS8A 3V4IB 3QRQA 1T9TA 4I7FB 1Q8IA 4B9VA 4DF4A 2AP6A 1SBRA 1YZ6A 3LWLA 1T03A 3TQ1A 4AL6A 1S1XB 2XNRA 4DR5F 2V2VA 3BYPA 1EAYC 3JTNA 3UD3P 2XNQA 3QZ8A 4KC5A 3IR5B 2PEBA 1TELA 2MQ8A 4PPDA 3CIZA 3POTB 2C3PA 2VOOA 4C7QA 4URQU 1OYDA 3KNAA 2Q1LA 3OQ2A 2W7AA 5D0EA 1UP1A 2H5IB 1KOHA 4ECSA 2CZ4A 1KC8T 1VQKS 3HSZA 1WG5A 3R9LA 2VFTA 5ETQA 1PC5A 3WX8A 5DG9A 4A48A 2FJAB 3D1OA 1Q16B 2G1DA 4EK2A 4IG3A 1HNIB 2ZH3A 3QLHB 3N5FA 1N36F 3VVUA 2QTWA 2YX4A 1UFWA 4DPOA 2XS5A 2VL1A 4WFAQ 4QR0A 2LKZA 3V2UC 4KHPF 4N76A 2OPRB 2B8QA 2W9BB 3H4BA 3JSRA 2IVFB 1DY3A 2G1HA 1U1QA 2V4RA 1YHQS 5KFHA 2V34A 4J9PA 3B6BA 1C1CB 3UE2A 2YXLA 2X7IA 3OR1B 4ZP7A 1YX2A 2XY6A 2K8GA 3HHLA 2P9GA 3PDNA 4ZJLA 2AZ3A 2KDOA 1HA1A 5KFRA 7FDRA 4RNHA 2AGOA 2CJ9A 5CD4A 1GT8A 1JKHA 2QE5A 3LWMA 3LPEA 4L72B 3CD6S 3K59A 4H4OB 4IRDA 1U1RA 1LFPA 4ZCIA 4DL0C 4HL9A 4TU9A 2DD8S 3KG0A 2VA2A 2M9KA 1WC0A 2KYZA 3G82B 2VUGA 3NGRA 5GMEA 5D6GA 2HNYB 3K2YA 4FKYA 4P2SA 2RMLA 2R7VA 2ZJRQ 3MGJA 3OL8A 3F56A 3M2RA 2MZJA 3DDNA 1R7IA 2U1AA 2XCPA 3X1LB 2FZGB 5DM6Q 3D68A 2DR6A 1HBUB 2O66A 5L46A 4M1KA 4CLLA 3TZWA 3DN9A 5HQLA 3LGHA 2VG5B 4BCAA 3J80Y 3NP5A 2ZE2A 2V9KA 1N56A 3JS9A 2BDPA 4NEZA 2VKRA 4C8OA 1TK8A 3CCSS 4DUTA 5HBMA 2C1EB 4CLFA 1NJIT 4UOHA 1SV5A 3UO0A 5KFBA 1RWMB 5THWA 1N5YB 1U1OA 2JC0A 2OFHX 3QIPB 5ETNA 2HLUA 3R1LA 4USTA 2VPWB 1B7YB 2UUBJ 1JLGB 1KHWA 3CJ3A 2VQFJ 1Q82T 2GJFA 2NCKL 4NLPA 1O5JA 2LEPA 1X4EA 1WSVA 1H0HB 1Y3JA 3AJ1A 5CABA 2GVDB 3KWMA 4DZ6A 2JZ5A 2Z58B 5J2MA 3FCWA 3BQ0A 1KN6A 3M9OB 3ZFVA 3FQLA 2IY5B 5BYQA 2J6TA 3VGSA 1LXJA 5K8PA 3HVTB 1RT1B 1E6YB 1DTQA 1YJUA 5SUHA 2EG1A 4RNFA 4ID5A 3CSKA 3R5BA 2MZTA 2V50A 3GSIA 1NMEB 3BBBA 4DV5F 2G9OA 4ZVTB 1M5PC 2WW8A 3T1HJ 2FYXA 3EXCX 1MWYA 2GC8A 2KXFA 3QAEA 2CVIA 4C8KA 4IDKB 4G1QA 2KU7A 3J81j 2FD2A 4NXMJ 4J9LA 1F5CA 1O0PA 3C6TA 2EFNA 3TUIC 3PM9A 3AOAA 3OTOF 5E3CA 1R6VA 3BN4A 3H59A 4ANEA 4O3NA 2HNDB 3KLVA 3D2WA 7AT1B 3QYYA 1HNVB 2QFJA 1WG1A 2ASLA 4N5SA 1K44A 3O1LA 1KRPA 1EP4A 2W4CA 4DSIA 1QE1A 3LP1B 1LW2A 2B8PA 2JJ4D 1H3DA 2ZHBA 3ULHA 3DLJA 3DCAA 2ZZMA 2FHKA 5LXYA 1Y0HA 1UZHA 3I96A 3AD8C 2RUSA 4FYWB 4IUFA 2DHHA 3H2VE 4QU7A 3BDEA 1F3FA 5A2QY 4HDGA 4CNZA 4NCBA 3LOUA 4PAAA 3RZAA 4WXOA 2J0QD 4CO1A 1DARA 3TYTA 4N47A 1GMWA 1IBKF 3N6MA 3DRYA 3B78A 3FNNA 2BJDA 2ADBA 1BC6A 4ZHRA 1XMBA 2NUUG 4CYUA 2BACA 4JOUA 2EI5A 1KKHA 1C0TB 4EWTA 3SYZA 4FF2A 3PACA 1RE1B 4ZP6A 1JJ2R 1FRJA 2XLJA 3BO2A 2C2KB 4ED0A 3DRPB 1FESA 2B43A 3K5OA 4UY8T 2AYMA 1QTNB 4KKOB 5J2NB 2N4CA 2P9EA 2F40A 2Z56B 4K0KJ 4K2JA 3E01A 1U4BA 2XY5A 2KT5A 2NSBA 2CQ0A 5D0GA 3DOKB 2ZH8A 4JYAF 1VQ4S 4CQ1A 1NH8A 3CIMA 4DPYA 1MMLA 2YKMB 2V2ZA 2LXIA 2Y8YA 1UFLA 2LU2A 4OZNA 5F8HA 2OSQA 1SJQA 4DX8H 1DBDA 4Y0FA 1BQMB 1TFYA 4QWBA 1FVQA 3GLJA 2Q79A 3TUJC 1U02A 3FBEA 4OLPA 4F26A 3CDWA 2ZDOA 1AA1B 1S9GB 1JLBB 4FYDA 4OHZA 4H54A 3WIVA 3A13A 1YGYA 2W8LA 1FRXA 3HK2A 3KJFB 1H74A 4ZPCA 3D1QA 4FF1A 2DJWA 1AUSL 3IWNC 4N41A 4B3SJ 2O3DA 3DM2A 2V63A 3K8VA 5KFUA 5BYSA 4UUXA 3H2UB 1WDDA 1OIAA 2OIHA 2LXUA 3QBCA 2ZOFA 3J7Z5 4G1IA 1LEOA 2P6TA 4FNHA 2QSFA 4JI6J 2XO6A 4Z7YA 4KH0B 4MFBB 1UAWA 3ZTOA 3GSDA 4FF4A 3BGRA 5IQ6A 3IA0A 1ZZNA 4KGZB 3GG1A 2DGUA 1WC1A 2R8JA 1WC4A 1FJGF 3RAMA 1RT4A 1W2IA 2HGMA 3EDRB 4C0BA 1T3OA 1S79A 1HHQA 1XJWB 4WIIA 2IVYA 2B6AA 1EB0A 4CO5A 4FYYB 3OHBA 3V81A 2EW9A 2ASDA 1PYTA 1X4GA 9ATCB 4ZCMA 1OY8A 1Q53A 2I9SA 1P6TA 1UVJA 3EJMA 3DNCA 2BJ9A 1S1UB 2LDIA 5CAAA 2GQCA 1VS3A 3LALA 2CWXA 4MTPA 4IYQA 2HQCA 2I5JB 4Q0BA 3MR6A 3M9NB 1IBCB 4ZVSB 2ZH6A 2FZCB 2XC9A 2YPZA 5FLXU 4C3LA 1P1TA 1YDLA 2XS2A 3PYEA 4Y2CA 5D3GB 3BR9A 1X5OA 2VBXA 3TP2A 3GFXA 2GAGC 1RT7B 5ETSA 3D0GE 2ZBPA 3VGUA 1X0PA 2BYCA 3TARA 4CH0S 1G7CB 5BJRA 4K4XA 5KTQA 5K9FA 3I9V9 3I31A 4G6VB 1J2VA 2ZH2A 4QIWD 4YP3A 2FLNA 2YWKA 4JI2F 5C24B 1C0UB 4X4NA 5HP1B 2C3UA 3RUBL 4K8RA 2R7UA 4F4AA 3ETMA 4KGVB 4X4QA 1CC8A 1FKOA 5DJBA 3DU6A 2LYVA 3VHQA 2OPPB 2DNOA 2ZM6J 2E66A 4DR3J 1RABB 3BREA 1XC9A 1D8ZA 4O0NA 1BQNA 3KDNA 1BLUA 1RHMB 2MTLA 1M1KT 3SCIE 3MTJA 4OZJA 3DOMB 3A8KA 5J1EB 1O8BA 1EQ0A 1LKZA 1VRTA 1LK5A 1X8DA 2NR0A 4CO4A 4LF1A 4JUZA 4A8XA 2AWZA 1DJ0A 1TKXA 4QQBA 4OI6A 4A8KA 1RAHB 2YWGA 4Y65A 5LMNF 1WDTA 1KNZA 3QO9A 2CG4A 3EZUA 5IT0A 5ETMA 3L9ZA 5EX0A 1CC7A 4DV7F 5C25A 4NZ7A 4H4MA 5DQGA 3L4BC 2AQ4A 1BMQB 3K89A 3KG4A 2YWFA 1UA0A 3ZZZA 1VBZA 1AZSA 4J5OA 3OFGA 3NBPA 2M0GB 3UD5A 4EO8A 2CQ2A 4J7CA 1N32F 1GXLA 1UTAA 3VTIA 5F8MA 1CS4A 2AMCB 4DJBA 1SIWB 3KLFB 4RNNA 4LREA 4O3RA 2HHTA 2R8HA 2K1RB 3BKUA 2F5GA 4ZPAA 2MKJA 1CLFA 2CQDA 1Q4RA 1G6BA 5KFSA 3M30A 4JV0A 2BUNA 2C2OB 3BYRA 5AE3A 2CJYB 1SH3A 5KFGA 2GJIA 4WFNQ 3T5HA 2HWIA 3A8IA 1M5VC 3THVA 5DS7A 4WE1A 4X66J 4ZPBA 5IC4B 4NLDA 5KFDA 1ACMB 4ZVHA 3OL9A 1M5SA 3AOBA 4WP9A 3TZZA 4KFBA 2GCFA 2YH1A 2J9DE 1URRA 2LA4A 2OEMA 4L3KA 1MNEA 3EICA 4F2SA 2XMAA 4C0OC 2WONB 3AQPA 3CVKA 5IV3A 2R3VA 3O3LA 4JI3J 3FZ2A 5E3RA 3PVXA 2B4VA 3QFHA 1PILA 4ZKAA 2I8EA 1WF1A 2CNOB 2OH2A 3PFOA 3CEDA 1FE4A 4K50A 2G2YA 1RAFB 3CC7S 1S1WB 3NOGA 4IQMA 1TL7A 3J81Y 5GAGI 3ILIA 1M5HA 1RUSA 3WBZA 1FDNA 4Q2MA 2V69A 3OXGA 4DQIA 3EVWA 2B9EA 3GJTB 3MEDB 2DNZA 5U47A 4ZCLA 2QA2A 1CJTA 1FJCA 1RBAA 3OXLA 2AX0A 4FPIA 4KV8B 1JLAB 2MQOA 2IAJB 5J2PB 2NXNA 1U0HB 4R5PB 3AA8A 5D4OA 5H9FJ 1MMNA 2KM8B 4LSNB 2H48B 4AXJA 3GQCA 1KDNA 3IAS9 3PX6A 2OEKA 3MPVA 1TUVA 4OX8A 3BSOA 1C4CA 5KFZA 2UU9J 1RTIB 3D3BJ 5D0RA 5HQ8A 3MR5A 1SQFA 2M7SA 1RAJA 2FHOB 5DG7A 2EFQA 3W65A 1S4FA 2CQ4A 1IN0A 2CPHA 2OPSB 1RHRB 2K3KA 4ZN1A 3H40A 4CO3A 4DV0F 2BZ2A 4JI0F 1UVIA 4WU3A 3L3CA 4MMOA 2HRUA 2Z57B 2EBGA 3R7NB 3RRKA 3NGSA 5D15A 2HVHA 1FX2A 2W8KA 1A0OB 1HLWA 4YDXA 2IRXA 4TQSA 4I2PB 2DNLA 3ENQA 4FDFA 3M8WA 3A1YG 4FP9A 1H2TZ 3D4JA 3FRYA 4DR7J 4P6QA 1K9MT 1UWBA 4F4WA 2XMKA 3C16B 1Q5YA 5GMDA 3MEGA 1FWKA 3AJ2A 3QFWA 1CPZA 3R6GB 4ZVEA 1XK8A 5F0WA 4QYZK 1PJ6A 3LGMA 1TV6A 4NEYA 2EXUA 3IS9B 2HFNA 3CCMS 1HPZA 1S6QB 1YWXA 3IMQJ 4O3SA 3LP0B 4P2MA 1WD6A 2YNGB 1VQLS 1UJ6A 4LUBA 1U8SA 3TZXA 1AT1B 1TK0A 3FFIB 2CPXA 5KAKA 3E2EA 3KUGA 1SKSA 2E1RA 3M4XA 1RWUA 1FRLA 4OX6A 1D9DA 2UUAF 2MEWA 1ZZFA 2EBEA 3M8PA 5B7WA 4GKKF 3HF5A 4Y28C 2OI2A 3PRBA 2GV1A 4JB8B 3MEEB 3KLEB 3L09A 3MAAA 2CKWA 5K14B 3CNQP 1U1NA 3CCJS 4S0MA 4USMA 2ZNZA 3K8WA 3U27A 3B4DA 3DMJA 2DR8A 1HNWJ 3GWCA 3DHXA 1U6FA 2DNMA 1X5PA 5ETTA 3TAQA 1EZZB 1PBAA 1KQSR 1RU2A 2KHDA 3SV4A 4NZ6A 5M2PA 1HBMA 3BSAA 1LXNA 4DUYF 2A10A 4KGXB 3KNGA 4AUKA 4IO1A 3DLGA 3SIPB 3CDEA
chains in the Genus database with same CATH topology
1HNIA 5KFMA 4ZVGA 1HI1A 3MFIA 4CI0B 3KYLA 1LWEB 1S48A 4KFBB 1RTIA 3UQSA 5E5NA 2HHUA 2RVJA 1D0EA 2YKOA 2IM1A 4K4UA 2F8HA 2N7YA 2DGVA 1FD2A 3BR8A 1NK5A 1TAUA 3EPGA 1S76D 3V6DB 3OPKA 4KHRA 2EKYA 4RW9A 4I6YA 4O44A 2N4DA 3MM6A 1XTZA 1DLOB 2YKNB 3IRXB 3N0VA 1ZYQA 3BJYA 1DTTB 1TKDA 2PC6A 2Q43A 2OPSA 2LECA 3G6XA 1AUDA 1YQHA 4URSA 2MQPA 4DR2F 2V8VA 2JH3A 1S99A 3OVAA 1DAXA 3B82A 1S77D 3M2VA 4X4RA 1BY9A 3GV7B 5AJ3F 2HG4A 1JX4A 1LQ9A 2DH8A 2IRYA 2NXUA 1NU4A 4EZ6A 1KS2A 4K59A 4NLYA 3B8HA 3RBEA 1DQ8A 1PC4A 4TXSA 1JJHA 2RQCA 5KT2A 1JLEA 3T5JA 1A6LA 2DGTA 5JJBA 1KOOA 1RTDB 2R2RA 2DR7A 2AJ0A 1X4AA 4NLOA 2XMWA 1K73T 1Y5LB 2VBYA 3JSMB 1JK9B 3CJ2A 3GYXB 5DM7Q 2DR5A 3PO4A 2JEJA 2OP5A 3DLHA 2KT3A 3BB5A 4DQQA 2E1AA 3KTQA 3M05A 5I4MA 2R8KA 3DI6A 1U09A 5LXRA 1RT6B 2E9TA 3TRGA 3NG8A 1S1TA 4DR1F 2NREA 5IWAF 5A8RA 1T03B 4USHA 1X9MA 3J7ZT 2VASA 4UY85 2DNNA 1TL5A 4PWDB 3GB0A 2BANB 1GX5A 2FHJD 4C8NA 4CH7A 5DDRC 4NL5A 2R4FA 1UJ4A 3RAQA 1VRUB 5KG5A 2VC0A 4NXMF 1HQUA 3BGLA 3SCJE 3CWJA 3I4PA 1MU2A 3ZZRA 3I0RB 4Q2LA 3TOQA 4EFAC 5A8KB 4DR6F 3SQGB 4W90B 1B0PA 3CDAA 4DSEA 2CPEA 3H5XA 3QJPA 1R0AB 1N88A 2KZZA 1MROB 2FHMA 2MKIA 4R25A 5F3ZA 2IRUA 1TL4A 2B5JB 4ERDA 3MOJB 1TP7A 1SJRA 3AA9A 1NKCA 1X9SA 5I3UA 2QV6A 3C2PA 5KFEA 3C3LA 2AGQA 3IS9A 1L5UA 3US5A 2YKPA 1FJEB 2ILZA 2V5HG 3S6EA 3KLHB 4RBVA 3D5MA 1S6QA 3FMWA 4LFCF 1YRTA 4QWAA 1SL1A 3LP0A 2V4QA 2M8DB 2OFGX 2O01C 3MMAB 4BWMA 1JXEA 3HHDA 2YNGA 5IFMA 1Q86T 2RQMA 4J9KA 2UV8A 3CCQS 1LK7A 2QA4G 2GJ2A 3RRGA 1X7VA 5BR8F 1VBYA 1IKWB 2MSTA 2HHWA 1KEKA 3W2VB 2FJEB 2KJVA 2VG7A 2YQ3A 3G8QA 5KFQA 2R7RA 1HQEB 2YX7A 7FD1A 2KFZA 3UCGA 4YB6A 3GR0A 1N6QB 1VOMA 2PDAA 4LF5F 3FFIA 4HVZA 1S6PB 2POKA 3HHEA 3GIKA 4HTIA 2QEXS 4DQPA 2DRAA 4B9UA 3GIJA 4DFKA 1P9QC 2UUCF 3H5SA 3FSXA 2YY3A 3HPOA 5KFFA 2BRLA 4PUOA 3OTCA 4RKUC 1TL3A 1N33F 4URGA 3IWLA 3BGFA 1WTFA 3IBWA 1R8BA 1KVJA 4LQ9A 4K2XA 2RT3A 3HO1A 4IG3B 6FDRA 3KK1B 2CVEA 2GMLA 4NLRA 2MGZB 5C42B 2MJUA 5L1LA 2J9EA 4GO7X 2GGPA 4RZRA 4ECWA 3CD0A 2KFYA 2JLFA 3CF5Q 4RU2A 5D8HB 3MOZA 2IVMA 3OR2B 3F44A 3PW7A 4DL6A 2J7UA 4AL5A 1RT5B 3I6PA 3HP6A 2MB0B 4C8YA 1GXTA 2XB2D 1ZOTA 4C2MA 1NJZA 3U1NA 5ITHA 3LO3A 3KLEA 3QWPA 4IO9Q 2DHXA 2OPQB 4WKYA 3T1AA 3HHKA 2G4BA 5HMWA 2HS4A 2M5YA 5K14A 2DGSA 3SCKE 3TNVA 2VPZB 1OPZA 3VZIA 1N5QA 1VMBA 2UXCF 3MM7B 2XGPA 2DHGA 3IFEA 5LSOA 3FQKA 2JDJA 1ZPVA 2FHJA 3IXQA 4J37A 3GR1A 1K8AT 3AH6A 1QJHA 4WXWA 3HKWA 2D74B 1APSA 3IGNA 3SCLE 4EGLA 2QT7A 4BC7A 4C97A 4E98A 3VAFA 2XS7A 2EG2A 3LF0A 3MUMP 5E3PA 2DH7A 4M95A 3G9CA 4USJC 2PFFB 3TX8A 3OJUA 2FY1A 2X1BA 5KT4A 1PO6A 1RQ0A 2CPYA 1FNXH 2HFZA 1H7WA 4Q5VA 3R5AA 5A0YB 4Y3CA 1ZAWA 3OV7A 4Q8FA 2HHPA 4OX9F 2DISA 2N7CA 4B3OA 4C8ZA 2P9CA 2MKCA 3CB4A 4ECRA 3MURP 3TANA 3OW2R 3SI8A 2OAUA 2XMTA 3VCDA 3M1VA 1VQMS 2C3YA 5KG6A 2PGCA 4M8LA 3W7BA 5HROA 1ZETA 1J5OB 3KLIB 1W2BR 1A7GE 3DLEB 2MPUA 4O3PA 2YNHA 5CA5A 4YOEA 1IM4A 2HGLA 3MM5A 3CPWR 1FT8A 4A8OA 4MK7A 1RTJB 4C8LA 4DSLA 1VQNS 2WBRA 1NK9A 4HI1A 4N8OA 3QIPA 2KHCA 4NYZA 4PG6A 2VA3A 2LXFA 2OO4A 1JLQA 1TKTA 5K8NA 1JLFB 2VOPA 4ES2A 3M32B 1FRKA 1OO0B 1LWEA 2KT2A 2CDQA 4UOCA 5F8GA 2HAIA 1JKHB 4NLSA 4MYTA 3RB0A 5EN1A 1S72S 1ULRA 4TNOA 2KRRA 2RF2B 1FHTA 2OMOA 2GQ2A 2WOMA 3PFEA 3OHAA 2E5IA 2PSZA 3V6DA 3N6NA 3MR2A 3ENVA 2M8HA 3MAHA 3ZC4A 1F0XA 2F1FA 3PHEA 2ZKTA 1DLOA 2F9DA 1Y00A 5E41A 2YKNA 4Y34A 3IRXA 4OHVA 4DV2F 2HGNA 4IFVB 1TFWA 1N0VC 2M88A 3FCHA 1DTTA 4JI4F 4M94A 3W3SA 3MMBB 2XULA 3T3FA 1U1LA 4FBUA 1OSDA 2ZOMA 4P7TA 1SL2A 2KTQA 1M90T 2CJKA 4WU2A 4DR4F 5CZVA 3RW7A 5B0AA 1N34F 1FK9B 3O5TB 3D0IE 3M8QA 1LOUA 1R43A 3VR1A 5CYMB 1R89A 3S7RA 3KMSA 2LA6A 4Q7AA 4R0JA 3N01A 5LMUF 2KB2A 1RTDA 1WEXA 1UL3A 4RX6A 2PIIA 3GG0A 3JSMA 3V4IB 1OQ3A 4DL3A 5F8JA 3BF4A 3MECB 4I7FB 4NLWA 3TW0A 4YR2A 2QA4S 1IBMF 1QLNA 4OI1A 4L6V3 1UW4A 1Q8IA 5BYRA 4B9VA 1RT6A 4HEA9 4DF4A 1TZ0A 2AP6A 1YJNS 1SBRA 4ED7A 3QWUA 4MJKA 3FRZA 4ZP8A 3M2RB 2R2SA 3LWLA 1T03A 3Q8SB 3H98A 3TQ1A 1C4AA 1NJWA 4AL6A 1SI9A 1CEZA 4WTYA 3FGVA 4K5RA 1S1XB 3UI3A 4CO2A 4PWDA 2XNRA 3ZZYA 4U7CA 2BANA 5B0GA 1Z2LA 4DR5F 2DNYA 3JTNA 3UD3P 3KHLA 1VRUA 3LQVA 2MKHA 4PQAA 3QGIA 4F50A 2XNQA 4KBIA 2VPYB 2JWNA 2NPFA 3QZ8A 3I0RA 5A8KA 1XR5A 2GMHA 4F4YA 5FDLB 3SQGA 1RT1A 1XR7A 3PW4A 4KC5A 4QW8A 3IR5B 3PNIA 2ZH4A 1L3UA 2ZBIA 2R7WA 2DNGA 4QBUA 5CD4H 4PPDA 1FRIA 5A6PA 1HBNA 3CJ5A 2B5JA 3CIZA 3M2UB 3POTB 3TVKA 5C5JA 2C3PA 2ZE2B 2VOOA 2HHHF 5B0EA 3X3UA 4C7QA 4DDFA 3M6WA 2EFPA 2DITA 2OSRA 3KLHA 4URQU 3ITHB 3KNAA 2J8AA 2Q1LA 3OQ2A 2W7AA 5G4DA 3MMAA 5HBMB 3MR3A 3CD7A 4ECTA 3KLGB 4PXDA 5KOWA 1UP1A 3HHLD 3BQ1A 1KTVA 1N5VA 1SV5B 4FNIA 5DDOC 3VAHA 1KOHA 2D1CA 4ECSA 1IKWA 1SL0A 3W2VA 3WC2A 2CZ4A 3QJJA 2ZKUA 2AJ4A 1KC8T 1JXLA 1VQKS 4PRFA 1G2EA 1HQEA 5GAHU 3LPYA 5M2UA 1N6QA 2L41A 4WK3A 5K8MA 1S6PA 1S6OA 2MQMA 4O0IA 2XWYA 3HHNB 4NZ0A 1WI6A 4FS1A 1WG5A 2RNEA 1Q79A 4YB5A 2VFTA 1PC5A 3A8EA 5DG9A 3D28A 4A48A 2FJAB 3D1OA 1Q16B 1ZAVA 2G1DA 4IG3A 4RNMA 1IKVB 3KK1A 1HNIB 2DGOA 1I6JA 2ZH3A 2CQHA 2MGZA 3QLHB 5C42A 3N5FA 1HD1A 1F5BA 1WELA 1N36F 2BBEA 2KN4A 2ZJPQ 1RGVA 2YX4A 1UFWA 1ZM4A 2MKSA 3OR2A 2WRMA 1RT5A 2Z2LA 4HTJA 3VQSA 4X62F 3BO4A 2M2BA 4DPOA 2KRBA 3FEXB 2XS5A 2VL1A 3JSYA 1H7XA 3T9NA 3SSSA 1HI8A 1Y7PA 1JLQB 3QAUA 4WFAQ 3NRBA 1C2PA 4QR0A 2ZHOA 2KVIA 2LKZA 2ERRA 2I2YA 4U9RA 4QIEA 1U49A 2BABA 3V2UC 2HNDA 3CULA 4IR9A 4KHPF 4RW6A 3OVSA 4N76A 2OPRB 4AQYF 4B9LA 2W9BB 3H4BA 3JSRA 2IVFB 1NKEA 3IGVA 5GVQA 1U1QA 5J2MB 3CDUA 2B4UA 2E5GA 4PKDB 2E44A 2LMIA 2V4RA 3G6ES 1H2VZ 1G3OA 2L48A 2W7PA 4F8RA 4YY3F 4DLGA 1YHQS 3P96A 3CCVS 1P1LA 3E8OA 5KFHA 1FXLA 5A0YA 1W25A 4J9PA 2QYCA 2D7SA 5KG4A 3JYTB 2ZH5A 2YWEA 5A8RB 1C1CB 2V8GA 3UE2A 1FVSA 1VQSA 4Y2MA 3OR1B 2DPIA 2EFOA 4ZP7A 3KLIA 2XY6A 2UZAA 2KZMA 1U47A 3DLEA 3SDEB 1IKYB 2K8GA 2XHWA 2B9WA 4LJMA 4CT9A 3HHLA 2P9GA 3PDNA 2VBZA 1KFSA 3G8TA 2KDOA 3MAQA 2DCUB 1HW8A 1RTJA 1HA1A 2VG6B 3FZBA 4MIWA 3PKMA 1L3KA 2VFRA 4WYLA 3PV8A 3ZZ0A 5KFRA 2EWHA 2PI4A 4AXIA 1RP5A 1F9FA 3WX4A 1IQZA 3M8RA 1DTQB 1JLFA 4RNHA 7FDRA 2AGOA 4ECVA 2CJ9A 3M32A 2H5EA 4KB7A 1GT8A 1YSJA 2QA1A 1JKHA 4X4UA 2HIQA 4ID5B 3VAJA 3KHHA 2QE5A 2RF2A 4WKRA 3LWMA 2CPZA 4ED8A 5JXSA 4CO0A 2E1CA 3AHPA 3GMGA 3EXYA 2XWXA 1FKPB 4NLVA 4L72B 4O23A 3CD6S 1NAQA 4DL2A 2FC9A 4IFVA 5EGYA 1HBOB 4CIOA 3K59A 2CJQA 4H4OB 4IRDA 4PG4A 1U1RA 1LFPA 4ZCIA 3MMBA 1N8RT 1SJ4P 4DL0C 1JLCB 4HL9A 2MXYA 1ZM3A 4TU9A 2DD8S 5KFPA 1QVGR 3RRHA 5CXTA 1KR4A 4FN5A 4CTAB 1FK9A 1WWHA 2G13A 3KG0A 4I6AA 3PR5B 2DB1A 1M0SA 2VA2A 4J9NA 2M9KA 4WK1A 4FBTA 5CYMA 4OI0A 1K0TA 2KYZA 4XPEA 3CJ0A 3V5RA 1X9WA 4I6WA 1FO1A 2VUGA 4RBTA 3V4IA 3LAKA 5KT3A 2CQBA 1FTRA 3T1YF 3MECA 4I7FA 5D6GA 5LT5A 4EBDA 2HNYB 3K2YA 4P2SA 2RMLA 4XPCA 1RKJA 3H8YA 1YITS 2R7VA 3BGUA 2ZJRQ 3MGJA 3OL8A 3VF0B 2ZH7A 2GGPB 2E7XA 2WSFC 2F4VF 3F56A 5EWFA 3M2RA 2MZJA 2UUWA 3MMCB 3NAIA 3MUTP 1DQ9A 1RTHB 3DDNA 4HLBA 2B7CB 1R7IA 3C6TB 2U1AA 1S1XA 1KQFB 2XCPA 3NNCA 5EDWA 3X1LB 4RLEA 1H38A 5DM6Q 1ZM9A 5LSRA 3T9ZA 1HNZF 2RS8A 2UUBF 1HBUB 2O66A 4KIAA 3HDSA 2VQFF 2C42A 2O1PA 3QGGA 5EWGA 2DBBA 4M1KA 5GADI 1R3NA 3I5BA 1DURA