5B0YD

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yD00
3REKD 5E5AB 4QLCD 5AVBC 3LZ1A 3WAAD 4KGCA 1S32B 5F99D 4YM6D 1M18A 3REHB 4JJNB 3AZNB 1P34C 5B32B 5DNMD 3AFAA 4H9NB 1KX5D 3WTPA 4J8UB 4LD9C 5F99A 4G91C 1ZLAA 3C1BC 3MVDD 3A6ND 3KXBC 3AN2B 4WV4B 1KX3A 5DNNC 3REJC 1M1AA 3X1VB 5B40C 3NQJA 1S32D 1F66C 3W96C 4XZQC 1KX4C 2RVQC 5E5AA 5B2JC 3REHD 4JJND 5G49B 2HUEB 4J8UD 4Z5TD 4DRAA 5GSUB 3AZNA 5B32A 4H9NA 5B31G 4J8XC 4J8UA 2NQBC 3MNNB 4KUDC 3VH5W 3B6FB 3X1UC 3AN2D 1AOIC 5B24C 3WKJC 1P3BB 3X1VD 4H9RA 4G92B 2HIOC 4DRBA 3X1VA 2NZDC 5GSUD 3B0DC 3MGRC 5AVBB 3TU4C 3VH5T 5GXQA 5GSUA 3B6FD 3AZFD 1TZYD 1P3BD 2F8NH 3MNNA 5AV5D 4LD9B 3B6FA 3KWQC 4G91B 1P3BA 3UTBC 4NE5A 3REJB 1U35C 5AVBD 3W99B 4YS3C 5B40B 3AZEB 3W96B 4XZQB 1KX4B 5B2IC 1P34D 4LD9D 5BO0B 4J8WC 3WTPE 3KUYC 3AZIC 3C1BD 3AZJB 3AZKC 5AV8C 4J8XB 3KXBD 2NQBB 4KUDB 3X1UB 1P3AC 5DNND 3REJD 5B24B 1AOIB 5B40D 1F66D 3W96D 4XZQD 3VH6A 3UTAC 5B1LC 2RVQD 1KX4D 5B2JD 4EO5C 3AYWB 3W99A 4R8PC 2NZDB 5B40A 3AZEA 3W96A 4XZQA 1KX4A 5B0YB 1P3KC 4J8XD 5AY8C 5BO0A 5FUGB 4H9QB 4J8VB 2NQBD 2AROC 4KUDD 5JRGC 3X1UD 1EQZA 3AZJA 1AOID 5B24D 3WKJD 4J8XA 3REIC 4KUDA 3C1CC 3X1UA 2HIOD 5B24A 3UTBB 2NZDD 5B0ZA 3UT9C 1BH9A 3MGPC 3X1SA 3AYWA 3TU4D 4Z2MG 1WWSA 5B0YA 4YS3B 5B32G 5GT3C 5CPIC 3REKB 5B2IB 1HQ3C 4QLCB 5FUGA 4H9QA 4J8VA 1M19C 3KWQD 2F8NK 4YM6B 3AZKB 5AV8B 3UTBD 3MGSC 1KX5B 3RELC 1P3AB 1A7WA 3UTBA 1U35D 4XUJA 4YS3D 4WU9C 3WA9C 4CSRB 3UTAB 3AZLC 3AV2A 5B2ID 5CPJC 3AZGC 4J8WD 4YS3A 3KUYD 3AZID 1P3IA 3REKA 3AZKD 4QLCA 5AV8D 4NE6A 3WAAA 1R4VA 4Z5TB 3AZMC 5JRGB 4YM6A 1ID3C 1P3AD 1P3PC 3AZKA 2JSSA 4H9OB 3LELC 5DNMA 1KX5A 3C1CB 3UTAD 5B1LD 2CV5C 3MVDA 3A6NA 2YFWB 4UUZB 4R8PD 4CSRA 3UT9B 1P3KD 3MGPB 5AY8D 1S32A 2AROD 5JRGD 4CAYB 3AV1C 3REHA 4JJNA 5GT3B 4ZBJC 5BS7C 5BT1C 3REID 4Z5TA 5B31C 5CP6C 5JRGA 3LJAC 3C1CD 2FJ7C 3AZFB 4H9OA 1TZYB 4AWLC 3W97C 5AV5B 3MGSB 3UT9D 3RELB 1N1JB 3AN2A 2F8NG 3MGPD 4UUZA 3UT9A 4WU9B 3WA9B 2PYOC 3VH5A 4Z66C 3MGPA 3AZLB 5G49A 5GT3D 5CPID 1ULYA 3O62C 1HQ3D 5AVCC 5CPJB 1M19D 4CAYA 4HGAC 1P34B 3MGSD 3RELD 3AZFA 1TZYA 1P3PB 3C1BB 3LZ0C 3LELB 5AV5A 3KXBB 1N1JA 4WU9D 3RELA 3WA9D 3AZLD 5JA4B 1BH8B 4E44A 5DNNB 5CPJD 5BNXB 3AZGD 3AZLA 1F66B 5B2JB 5AVBA 3AZMD 1ID3D 1P3PD 1P3LC 5B33C 3LELD 4ZBJB 5B1MC 1P34A 2LY8A 4LD9A 5B31B 5CP6B 3B6GC 3AZHC 1H3OB 3C1BA 5GT0C 2CV5D 3LELA 1P3FC 4AWLB 3WKJB 3KXBA 3W97B 4M6BA 1P3OC 5DNNA 2HIOB 3REJA 2YFVB 1JFIB 4KGCC 1F66A 3B0DB 3AV1D 5B2JA 4Z66B 1M18C 3MGRB 3O62B 5BT1D 3AFAC 3B0BA 3TU4B 3WTPC 5B31D 5CP6D 2FJ7D 4HGAB 1ZLAC 5CPKC 1KU5A 2BYMB 1TAFB 2NQBA 3W97D 1H3OA 3KWQB 1KX3C 4WU8C 1AOIA 3NQUB 3WKJA 1M1AC 3W97A 5C3IC 2PYOD 1HTAA 2HIOA 4Z66D 3MGRD 5E5AC 3O62D 2YFVA 1JFIA 1U35B 2NZDA 5AV9C 4Z66A 3MGRA 3O62A 3AZNC 5B32C 3TU4A 4J8WB 3KUYB 3AZIB 1P3LB 4E45A 1TAFA 3B0CW 3MGQC 3KWQA 1WWIA 3AZHB 5GT0B 2L5AA 1P3FB 4ZUXC 3KSYA 5B1LB 1U35A 4EO5B 3X1TC 4R8PB 5GXQC 1P3LD 1M18B 5B2IA 5B33D 1P3KB 5B1MD 3MNNC 5AY8B 4J8WA 2AROB 4X23C 3KUYA 3AZIA 3AZHD 1P3LA 1ZLAB 5CPKB 5GT0D 3B6GD 5AV8A 1P3FD 3REIB 4G92C 3AZHA 1P3OD 1P3AA 5GT0A 1KX3B 4WU8B 1P3FA 4KGCD 5C3IB 1F1EA 3UTAA 5B1LA 1M18D 4R8PA 3AFAD 5AV9B 3WTPD 5CHLB 1ZLAD 3V9RB 5CPKD 1P3KA 5CPIB 1HQ3B 5AY8A 1M19B 2AROA 5CPKA 1KX3D 4WU8D 1M1AD 3REIA 4H9RB 3MGQB 3C1CA 4WU8A 5E5AD 2YFWA 3W99C 5AV9D 3AZEC 4ZUXB 3AZND 5B32D 5AV9A 3X1TB 3AZGB 5GXQB 3V9RA 1EQZC 3AZJC 5GT3A 5CPIA 1HQ3A 2CWEA 1P3MC 1M19A 3MGQD 3R45B 3AZMB 4X23B 1ID3B 4WNNB 3W98C 3MGQA 1P3GC 3MGSA 5B0ZC 4ZUXD 3X1SC 3AYWC 2CV5B 4H9PB 3X1TD 4NE3A 4WZSB 5GXQD 4NFTA 4ZUXA 5B0YC 4WU9A 3WA9A 5CPJA 1Q9CA 5AV6C 3X1TA 1B67A 3MNND 4J8VC 3AZGA 4X23D 3AV1B 4H9SC 3R45A 3AZMA 4X23A 1ID3A 3LJAB 4WNNA 1P3PA 2FJ7B 4XUJC 2IO5C 4KHAB 5JA4A 1BH8A 3AV2C 5BNXA 2CV5A 2F8NB 4H9PA 5BNVB 3LZ1C 1P3IC 2PYOB 3REKC 4QLCC 5AVCB 3WAAC 3VH6W 1BFMA 3LJAD 4YM6C 5F99C 3AV1A 1EQZB 5KDMB 5BS7A 1P3MB 5DNMC 1KX5C 5B31A 5CP6A 3LJAA 2FJ7A 2F8ND 3MVDC 3LZ0B 3A6NC 3W99D 3W98B 1P3GB 3AZED 4KHAA 5B0ZB 2F8NA 1BH9B 5BNVA 5AVCD 3X1SB 3VH6T 1S32C 2PYOA 1EQZD 3AZJD 3REHC 4JJNC 5AVCA 1P3MD 5AV6B 4J8UC 4Z5TC 2BYMA 2BYKB 5KDMA 3LZ0D 1P3MA 5B33B 3W98D 5B1MB 1P3GD 5B0ZD 3AN2C 3B6GB 3NQUA 3LZ0A 3X1SD 3AYWD 3W98A 4XUJB 1P3GA 3X1VC 2IO5B 5B0YD 1P3OB 3AV2B 5AV6D 2HUEC 4J8VD 3LZ1B 4KGCB 5GSUC 1B6WA 1P3IB 5AV6A 3B0CT 3WAAB 3AFAB 3WTPB 3AZFC 2BYKA 3B6FC 5F99B 1TZYC 5B33A 5B1MA 4XUJD 4H9SA 1P3BC 5AV5C 5DNMB 3B6GA 4Z2MH 3AV2D 3MVDB 3A6NB 1M1AB 3LZ1D 3NQJB 1P3OA 1P3ID
chains in the Genus database with same CATH superfamily
3REKD 5E5AB 4QLCD 3H0RC 3EG5B 5AVBC 3LZ1A 3WAAD 4KGCA 1S32B 5F99D 4YM6D 1M18A 3REHB 4JJNB 3AZNB 1P34C 5B32B 5DNMD 3AFAA 4H9NB 1KX5D 3WTPA 4J8UB 4LD9C 2Y2NA 5F99A 4G91C 1ZLAA 3F6TA 3C1BC 3MVDD 3A6ND 3KXBC 2ZY2A 3AN2B 4WV4B 1KX3A 5DNNC 3REJC 1M1AA 3X1VB 5B40C 3NQJA 1S32D 1F66C 3W96C 4XZQC 1KX4C 2RVQC 5E5AA 5B2JC 3REHD 4JJND 5G49B 2HUEB 4J8UD 4Z5TD 4DRAA 5GSUB 2G5IC 3AZNA 5B32A 4H9NA 5B31G 4J8XC 4J8UA 2NQBC 3MNNB 4KUDC 3VH5W 3B6FB 3X1UC 2Y2MA 3AN2D 1AOIC 5B24C 3WKJC 1P3BB 2ZY3A 4H9RA 3X1VD 4G92B 3H0MC 2HIOC 4DRBA 3X1VA 2NZDC 5GSUD 3B0DC 3MGRC 5AVBB 3TU4C 3VH5T 5GXQA 5GSUA 3B6FD 3AZFD 1TZYD 1P3BD 2F8NH 3MNNA 5AV5D 4LD9B 3B6FA 3KWQC 2RIQA 4G91B 2DF4C 1P3BA 3UTBC 2Y2QA 2J8PA 4NE5A 2F2AC 3REJB 1U35C 5AVBD 3W99B 4YS3C 5B40B 3AZEB 2ZY4A 3W96B 4XZQB 1KX4B 5B2IC 1P34D 4LD9D 5BO0B 4J8WC 2Y2HA 3WTPE 3KUYC 3AZIC 3C1BD 3AZJB 3AZKC 5AV8C 3EPHA 4J8XB 3KXBD 2NQBB 4KUDB 3X1UB 1P3AC 5DNND 3REJD 5B24B 1AOIB 2XD1A 5B40D 1F66D 3W96D 4XZQD 3VH6A 3UTAC 5B1LC 2RVQD 1KX4D 5B2JD 4EO5C 3AYWB 3W99A 4R8PC 2NZDB 5B40A 2JE5A 3AZEA 3W96A 4XZQA 1KX4A 5B0YB 1P3KC 4J8XD 5AY8C 5BO0A 5FUGB 4H9QB 4J8VB 2NQBD 2AROC 4KUDD 5JRGC 3X1UD 1EQZA 3AZJA 1AOID 5B24D 3WKJD 4J8XA 3REIC 4KUDA 3C1CC 3X1UA 2HIOD 5B24A 3UTBB 2NZDD 5B0ZA 3UT9C 1BH9A 2DQNC 3MGPC 3X1SA 3AYWA 3AL0C 3TU4D 4Z2MG 1WWSA 5B0YA 4YS3B 5B32G 5GT3C 5CPIC 3REKB 5B2IB 1HQ3C 4QLCB 5FUGA 4H9QA 4J8VA 1M19C 3KWQD 2F8NK 4YM6B 3AZKB 5AV8B 3UTBD 3MGSC 1KX5B 3RELC 1P3AB 1A7WA 3UTBA 1U35D 4XUJA 2G5HC 4YS3D 4WU9C 3WA9C 4CSRB 3UTAB 3AZLC 3AV2A 5B2ID 5CPJC 3AZGC 4J8WD 4YS3A 3KUYD 3AZID 1P3IA 3REKA 3AZKD 4QLCA 5AV8D 4NE6A 3WAAA 1R4VA 4Z5TB 3AZMC 5JRGB 4YM6A 1ID3C 1P3AD 1P3PC 3AZKA 2JSSA 4H9OB 3LELC 5DNMA 1KX5A 3C1CB 2ZY5A 3UTAD 5B1LD 2CV5C 3MVDA 3A6NA 2YFWB 4UUZB 4R8PD 1W2EA 4CSRA 3UT9B 1P3KD 3MGPB 5AY8D 1S32A 2AROD 5JRGD 4CAYB 3AV1C 3REHA 4JJNA 5GT3B 4ZBJC 5BS7C 5BT1C 3REID 4Z5TA 5B31C 5CP6C 5JRGA 3LJAC 3C1CD 3P5JB 3AZFB 2FJ7C 2Y2JA 4H9OA 1TZYB 4AWLC 3W97C 5AV5B 3MGSB 3UT9D 3RELB 1N1JB 3AN2A 2F8NG 2Y2OA 3MGPD 2Y2IA 4UUZA 3UT9A 4WU9B 3WA9B 2PYOC 3VH5A 4Z66C 3MGPA 3AZLB 5G49A 5GT3D 5CPID 1ULYA 3O62C 1HQ3D 5AVCC 5CPJB 1M19D 4CAYA 2Y2PA 4HGAC 1P34B 3MGSD 3RELD 2W8SA 3AZFA 1TZYA 1P3PB 3C1BB 3LZ0C 2JCHA 3LELB 5AV5A 3KXBB 1N1JA 4WU9D 3RELA 3WA9D 3AZLD 5JA4B 1BH8B 4E44A 5DNNB 2ZM5A 5CPJD 5BNXB 3AZGD 3AZLA 1F66B 5B2JB 5AVBA 3AZMD 1ID3D 1P3PD 1P3LC 5B33C 3LELD 4ZBJB 5B1MC 1P34A 2LY8A 4LD9A 5B31B 5CP6B 3B6GC 3AZHC 1H3OB 3C1BA 5GT0C 2CV5D 3LELA 1P3FC 2UWXA 4AWLB 3WKJB 3KXBA 3W97B 4M6BA 1Z2CB 1P3OC 2FFFB 5DNNA 2HIOB 3REJA 2YFVB 1JFIB 4KGCC 1F66A 3B0DB 3AV1D 5B2JA 4Z66B 1M18C 3MGRB 3O62B 5BT1D 3AFAC 3B0BA 3TU4B 3WTPC 5B31D 5CP6D 2FJ7D 4HGAB 1ZLAC 5CPKC 1KU5A 2BYMB 1PZRA 1TAFB 2NQBA 3W97D 1H3OA 3H0LC 3KWQB 1KX3C 4WU8C 1AOIA 3NQUB 3EPJA 4WJ3C 3WKJA 1M1AC 2VQRA 3W97A 5C3IC 2PYOD 1HTAA 2HIOA 4Z66D 3MGRD 5E5AC 3O62D 2YFVA 1JFIA 1U35B 2NZDA 5AV9C 2Y2GA 4Z66A 3MGRA 3O62A 3AZNC 5B32C 3TU4A 4J8WB 3KUYB 3AZIB 1P3LB 4E45A 1TAFA 3B0CW 3MGQC 3KWQA 1WWIA 3AZHB 5GT0B 2L5AA 1P3FB 4ZUXC 3KSYA 5B1LB 1U35A 4EO5B 3X1TC 4R8PB 5GXQC 3EPLA 1P3LD 1M18B 5B2IA 5B33D 1P3KB 5B1MD 3MNNC 5AY8B 4J8WA 2AROB 4X23C 3KUYA 3AZIA 3AZHD 1P3LA 1ZLAB 5CPKB 5GT0D 3B6GD 5AV8A 1P3FD 3REIB 4G92C 3AZHA 1P3OD 1P3AA 5GT0A 1KX3B 4WU8B 1P3FA 4KGCD 5C3IB 1F1EA 3UTAA 5B1LA 1M18D 3IP4C 4R8PA 3AFAD 5AV9B 3WTPD 5CHLB 1ZLAD 3V9RB 5CPKD 1P3KA 5CPIB 1HQ3B 5AY8A 1M19B 2AROA 5CPKA 1KX3D 4WU8D 1M1AD 1T3UA 3REIA 4H9RB 3MGQB 3C1CA 4WU8A 5E5AD 2YFWA 3W99C 5AV9D 3AZEC 4ZUXB 2XD5A 3AZND 5B32D 5AV9A 3X1TB 3AZGB 5GXQB 3V9RA 1EQZC 3AZJC 5GT3A 5CPIA 1HQ3A 2CWEA 1P3MC 1M19A 3MGQD 3R45B 3AZMB 4X23B 3FDDA 1ID3B 4WNNB 3W98C 3MGQA 3EPKA 1P3GC 3MGSA 5B0ZC 4ZUXD 3X1SC 3AYWC 2CV5B 4H9PB 3X1TD 4NE3A 4WZSB 5GXQD 4NFTA 4ZUXA 5B0YC 4WU9A 3WA9A 5CPJA 1Q9CA 5AV6C 3X1TA 1B67A 3MNND 4J8VC 3AZGA 4X23D 3AV1B 4H9SC 3R45A 3AZMA 4X23A 1ID3A 3LJAB 4WNNA 1P3PA 2FJ7B 4XUJC 2IO5C 2Y2LA 4KHAB 5JA4A 1BH8A 3AV2C 5BNXA 2CV5A 2F8NB 4H9PA 5BNVB 3LZ1C 1P3IC 2PYOB 3REKC 4QLCC 5AVCB 3WAAC 3VH6W 1BFMA 3LJAD 4YM6C 5F99C 3AV1A 1EQZB 5KDMB 5BS7A 1P3MB 5DNMC 1KX5C 5B31A 5CP6A 3LJAA 2FJ7A 2F8ND 3MVDC 3LZ0B 3A6NC 3W99D 3W98B 1P3GB 3AZED 4KHAA 5B0ZB 2F8NA 1BH9B 5BNVA 5AVCD 3X1SB 3VH6T 1S32C 2PYOA 1EQZD 3AZJD 3REHC 4JJNC 5AVCA 1P3MD 5AV6B 4J8UC 4Z5TC 3KFUG 2BYMA 2BYKB 4DQYB 5KDMA 3LZ0D 3A1IA 5B33B 1P3MA 3W98D 5B1MB 1P3GD 5B0ZD 3AN2C 3B6GB 3NQUA 3LZ0A 3X1SD 3AYWD 3W98A 4XUJB 1P3GA 3X1VC 2IO5B 5B0YD 1P3OB 3AV2B 5AV6D 2HUEC 4J8VD 3LZ1B 4KGCB 5GSUC 1B6WA 1P3IB 5AV6A 3B0CT 3WAAB 3AFAB 2BG1A 4UPKA 3WTPB 2BYKA 3AZFC 3B6FC 5F99B 1TZYC 5B33A 3A1KA 5B1MA 4XUJD 4H9SA 1P3BC 5AV5C 5DNMB 2Y2KA 3B6GA 4Z2MH 3AV2D 3MVDB 3A6NB 1M1AB 3LZ1D 3NQJB 1P3OA 1P3ID
chains in the Genus database with same CATH topology
3REKD 5E5AB 4QLCD 3H0RC 3EG5B 5AVBC 3LZ1A 3WAAD 4KGCA 1S32B 5F99D 4YM6D 1M18A 3REHB 4JJNB 3AZNB 1P34C 5B32B 5DNMD 3AFAA 4H9NB 1KX5D 3WTPA 4J8UB 4LD9C 2Y2NA 5F99A 4G91C 1ZLAA 3F6TA 3C1BC 3MVDD 3A6ND 3KXBC 2ZY2A 3AN2B 4WV4B 1KX3A 5DNNC 3REJC 1M1AA 3X1VB 5B40C 3NQJA 1S32D 1F66C 3W96C 4XZQC 1KX4C 2RVQC 5E5AA 5B2JC 3REHD 4JJND 5G49B 2HUEB 4J8UD 4Z5TD 4DRAA 5GSUB 2G5IC 3AZNA 5B32A 4H9NA 5B31G 4J8XC 4J8UA 2NQBC 3MNNB 4KUDC 3VH5W 3B6FB 3X1UC 2Y2MA 3AN2D 1AOIC 5B24C 3WKJC 1P3BB 2ZY3A 4H9RA 3X1VD 4G92B 3H0MC 2HIOC 4DRBA 3X1VA 2NZDC 5GSUD 3B0DC 3MGRC 5AVBB 3TU4C 3VH5T 5GXQA 5GSUA 3B6FD 3AZFD 1TZYD 1P3BD 2F8NH 3MNNA 5AV5D 4LD9B 3B6FA 3KWQC 2RIQA 4G91B 2DF4C 1P3BA 3UTBC 2Y2QA 2J8PA 4NE5A 2F2AC 3REJB 1U35C 5AVBD 3W99B 4YS3C 5B40B 3AZEB 2ZY4A 3W96B 4XZQB 1KX4B 5B2IC 1P34D 4LD9D 5BO0B 4J8WC 2Y2HA 3WTPE 3KUYC 3AZIC 3C1BD 3AZJB 3AZKC 5AV8C 3EPHA 4J8XB 3KXBD 2NQBB 4KUDB 3X1UB 1P3AC 5DNND 3REJD 5B24B 1AOIB 2XD1A 5B40D 1F66D 3W96D 4XZQD 3VH6A 3UTAC 5B1LC 2RVQD 1KX4D 5B2JD 4EO5C 3AYWB 3W99A 4R8PC 2NZDB 5B40A 2JE5A 3AZEA 3W96A 4XZQA 1KX4A 5B0YB 1P3KC 4J8XD 5AY8C 5BO0A 5FUGB 4H9QB 4J8VB 2NQBD 2AROC 4KUDD 5JRGC 3X1UD 1EQZA 3AZJA 1AOID 5B24D 3WKJD 4J8XA 3REIC 4KUDA 3C1CC 3X1UA 2HIOD 5B24A 3UTBB 2NZDD 5B0ZA 3UT9C 1BH9A 2DQNC 3MGPC 3X1SA 3AYWA 3AL0C 3TU4D 4Z2MG 1WWSA 5B0YA 4YS3B 5B32G 5GT3C 5CPIC 3REKB 5B2IB 1HQ3C 4QLCB 5FUGA 4H9QA 4J8VA 1M19C 3KWQD 2F8NK 4YM6B 3AZKB 5AV8B 3UTBD 3MGSC 1KX5B 3RELC 1P3AB 1A7WA 3UTBA 1U35D 4XUJA 2G5HC 4YS3D 4WU9C 3WA9C 4CSRB 3UTAB 3AZLC 3AV2A 5B2ID 5CPJC 3AZGC 4J8WD 4YS3A 3KUYD 3AZID 1P3IA 3REKA 3AZKD 4QLCA 5AV8D 4NE6A 3WAAA 1R4VA 4Z5TB 3AZMC 5JRGB 4YM6A 1ID3C 1P3AD 1P3PC 3AZKA 2JSSA 4H9OB 3LELC 5DNMA 1KX5A 3C1CB 2ZY5A 3UTAD 5B1LD 2CV5C 3MVDA 3A6NA 2YFWB 4UUZB 4R8PD 1W2EA 4CSRA 3UT9B 1P3KD 3MGPB 5AY8D 1S32A 2AROD 5JRGD 4CAYB 3AV1C 3REHA 4JJNA 5GT3B 4ZBJC 5BS7C 5BT1C 3REID 4Z5TA 5B31C 5CP6C 5JRGA 3LJAC 3C1CD 3P5JB 3AZFB 2FJ7C 2Y2JA 4H9OA 1TZYB 4AWLC 3W97C 5AV5B 3MGSB 3UT9D 3RELB 1N1JB 3AN2A 2F8NG 2Y2OA 3MGPD 2Y2IA 4UUZA 3UT9A 4WU9B 3WA9B 2PYOC 3VH5A 4Z66C 3MGPA 3AZLB 5G49A 5GT3D 5CPID 1ULYA 3O62C 1HQ3D 5AVCC 5CPJB 1M19D 4CAYA 2Y2PA 4HGAC 1P34B 3MGSD 3RELD 2W8SA 3AZFA 1TZYA 1P3PB 3C1BB 3LZ0C 2JCHA 3LELB 5AV5A 3KXBB 1N1JA 4WU9D 3RELA 3WA9D 3AZLD 5JA4B 1BH8B 4E44A 5DNNB 2ZM5A 5CPJD 5BNXB 3AZGD 3AZLA 1F66B 5B2JB 5AVBA 3AZMD 1ID3D 1P3PD 1P3LC 5B33C 3LELD 4ZBJB 5B1MC 1P34A 2LY8A 4LD9A 5B31B 5CP6B 3B6GC 3AZHC 1H3OB 3C1BA 5GT0C 2CV5D 3LELA 1P3FC 2UWXA 4AWLB 3WKJB 3KXBA 3W97B 4M6BA 1Z2CB 1P3OC 2FFFB 5DNNA 2HIOB 3REJA 2YFVB 1JFIB 4KGCC 1F66A 3B0DB 3AV1D 5B2JA 4Z66B 1M18C 3MGRB 3O62B 5BT1D 3AFAC 3B0BA 3TU4B 3WTPC 5B31D 5CP6D 2FJ7D 4HGAB 1ZLAC 5CPKC 1KU5A 2BYMB 1PZRA 1TAFB 2NQBA 3W97D 1H3OA 3H0LC 3KWQB 1KX3C 4WU8C 1AOIA 3NQUB 3EPJA 4WJ3C 3WKJA 1M1AC 2VQRA 3W97A 5C3IC 2PYOD 1HTAA 2HIOA 4Z66D 3MGRD 5E5AC 3O62D 2YFVA 1JFIA 1U35B 2NZDA 5AV9C 2Y2GA 4Z66A 3MGRA 3O62A 3AZNC 5B32C 3TU4A 4J8WB 3KUYB 3AZIB 1P3LB 4E45A 1TAFA 3B0CW 3MGQC 3KWQA 1WWIA 3AZHB 5GT0B 2L5AA 1P3FB 4ZUXC 3KSYA 5B1LB 1U35A 4EO5B 3X1TC 4R8PB 5GXQC 3EPLA 1P3LD 1M18B 5B2IA 5B33D 1P3KB 5B1MD 3MNNC 5AY8B 4J8WA 2AROB 4X23C 3KUYA 3AZIA 3AZHD 1P3LA 1ZLAB 5CPKB 5GT0D 3B6GD 5AV8A 1P3FD 3REIB 4G92C 3AZHA 1P3OD 1P3AA 5GT0A 1KX3B 4WU8B 1P3FA 4KGCD 5C3IB 1F1EA 3UTAA 5B1LA 1M18D 3IP4C 4R8PA 3AFAD 5AV9B 3WTPD 5CHLB 1ZLAD 3V9RB 5CPKD 1P3KA 5CPIB 1HQ3B 5AY8A 1M19B 2AROA 5CPKA 1KX3D 4WU8D 1M1AD 1T3UA 3REIA 4H9RB 3MGQB 3C1CA 4WU8A 5E5AD 2YFWA 3W99C 5AV9D 3AZEC 4ZUXB 2XD5A 3AZND 5B32D 5AV9A 3X1TB 3AZGB 5GXQB 3V9RA 1EQZC 3AZJC 5GT3A 5CPIA 1HQ3A 2CWEA 1P3MC 1M19A 3MGQD 3R45B 3AZMB 4X23B 3FDDA 1ID3B 4WNNB 3W98C 3MGQA 3EPKA 1P3GC 3MGSA 5B0ZC 4ZUXD 3X1SC 3AYWC 2CV5B 4H9PB 3X1TD 4NE3A 4WZSB 5GXQD 4NFTA 4ZUXA 5B0YC 4WU9A 3WA9A 5CPJA 1Q9CA 5AV6C 3X1TA 1B67A 3MNND 4J8VC 3AZGA 4X23D 3AV1B 4H9SC 3R45A 3AZMA 4X23A 1ID3A 3LJAB 4WNNA 1P3PA 2FJ7B 4XUJC 2IO5C 2Y2LA 4KHAB 5JA4A 1BH8A 3AV2C 5BNXA 2CV5A 2F8NB 4H9PA 5BNVB 3LZ1C 1P3IC 2PYOB 3REKC 4QLCC 5AVCB 3WAAC 3VH6W 1BFMA 3LJAD 4YM6C 5F99C 3AV1A 1EQZB 5KDMB 5BS7A 1P3MB 5DNMC 1KX5C 5B31A 5CP6A 3LJAA 2FJ7A 2F8ND 3MVDC 3LZ0B 3A6NC 3W99D 3W98B 1P3GB 3AZED 4KHAA 5B0ZB 2F8NA 1BH9B 5BNVA 5AVCD 3X1SB 3VH6T 1S32C 2PYOA 1EQZD 3AZJD 3REHC 4JJNC 5AVCA 1P3MD 5AV6B 4J8UC 4Z5TC 3KFUG 2BYMA 2BYKB 4DQYB 5KDMA 3LZ0D 3A1IA 5B33B 1P3MA 3W98D 5B1MB 1P3GD 5B0ZD 3AN2C 3B6GB 3NQUA 3LZ0A 3X1SD 3AYWD 3W98A 4XUJB 1P3GA 3X1VC 2IO5B 5B0YD 1P3OB 3AV2B 5AV6D 2HUEC 4J8VD 3LZ1B 4KGCB 5GSUC 1B6WA 1P3IB 5AV6A 3B0CT 3WAAB 3AFAB 2BG1A 4UPKA 3WTPB 2BYKA 3AZFC 3B6FC 5F99B 1TZYC 5B33A 3A1KA 5B1MA 4XUJD 4H9SA 1P3BC 5AV5C 5DNMB 2Y2KA 3B6GA 4Z2MH 3AV2D 3MVDB 3A6NB 1M1AB 3LZ1D 3NQJB 1P3OA 1P3ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REK D;  5E5A B;  4QLC D;  5AVB C;  3LZ1 A;  3WAA D;  4KGC A;  1S32 B;  5F99 D;  4YM6 D;  1M18 A;  3REH B;  4JJN B;  3AZN B;  1P34 C;  5B32 B;  5DNM D;  3AFA A;  4H9N B;  1KX5 D;  3WTP A;  4J8U B;  4LD9 C;  5F99 A;  4G91 C;  1ZLA A;  3C1B C;  3MVD D;  3A6N D;  3KXB C;  3AN2 B;  4WV4 B;  1KX3 A;  5DNN C;  3REJ C;  1M1A A;  3X1V B;  5B40 C;  3NQJ A;  1S32 D;  1F66 C;  3W96 C;  4XZQ C;  1KX4 C;  2RVQ C;  5E5A A;  5B2J C;  3REH D;  4JJN D;  5G49 B;  2HUE B;  4J8U D;  4Z5T D;  4DRA A;  5GSU B;  3AZN A;  5B32 A;  4H9N A;  5B31 G;  4J8X C;  4J8U A;  2NQB C;  3MNN B;  4KUD C;  3VH5 W;  3B6F B;  3X1U C;  3AN2 D;  1AOI C;  5B24 C;  3WKJ C;  1P3B B;  3X1V D;  4H9R A;  4G92 B;  2HIO C;  4DRB A;  3X1V A;  2NZD C;  5GSU D;  3B0D C;  3MGR C;  5AVB B;  3TU4 C;  3VH5 T;  5GXQ A;  5GSU A;  3B6F D;  3AZF D;  1TZY D;  1P3B D;  2F8N H;  3MNN A;  5AV5 D;  4LD9 B;  3B6F A;  3KWQ C;  4G91 B;  1P3B A;  3UTB C;  4NE5 A;  3REJ B;  1U35 C;  5AVB D;  3W99 B;  4YS3 C;  5B40 B;  3AZE B;  3W96 B;  4XZQ B;  1KX4 B;  5B2I C;  1P34 D;  4LD9 D;  5BO0 B;  4J8W C;  3WTP E;  3KUY C;  3AZI C;  3C1B D;  3AZJ B;  3AZK C;  5AV8 C;  4J8X B;  3KXB D;  2NQB B;  4KUD B;  3X1U B;  1P3A C;  5DNN D;  3REJ D;  5B24 B;  1AOI B;  5B40 D;  1F66 D;  3W96 D;  4XZQ D;  3VH6 A;  3UTA C;  5B1L C;  2RVQ D;  1KX4 D;  5B2J D;  4EO5 C;  3AYW B;  3W99 A;  4R8P C;  2NZD B;  5B40 A;  3AZE A;  3W96 A;  4XZQ A;  1KX4 A;  5B0Y B;  1P3K C;  4J8X D;  5AY8 C;  5BO0 A;  5FUG B;  4H9Q B;  4J8V B;  2NQB D;  2ARO C;  4KUD D;  5JRG C;  3X1U D;  1EQZ A;  3AZJ A;  1AOI D;  5B24 D;  3WKJ D;  4J8X A;  3REI C;  4KUD A;  3C1C C;  3X1U A;  2HIO D;  5B24 A;  3UTB B;  2NZD D;  5B0Z A;  3UT9 C;  1BH9 A;  3MGP C;  3X1S A;  3AYW A;  3TU4 D;  4Z2M G;  1WWS A;  5B0Y A;  4YS3 B;  5B32 G;  5GT3 C;  5CPI C;  3REK B;  5B2I B;  1HQ3 C;  4QLC B;  5FUG A;  4H9Q A;  4J8V A;  1M19 C;  3KWQ D;  2F8N K;  4YM6 B;  3AZK B;  5AV8 B;  3UTB D;  3MGS C;  1KX5 B;  3REL C;  1P3A B;  1A7W A;  3UTB A;  1U35 D;  4XUJ A;  4YS3 D;  4WU9 C;  3WA9 C;  4CSR B;  3UTA B;  3AZL C;  3AV2 A;  5B2I D;  5CPJ C;  3AZG C;  4J8W D;  4YS3 A;  3KUY D;  3AZI D;  1P3I A;  3REK A;  3AZK D;  4QLC A;  5AV8 D;  4NE6 A;  3WAA A;  1R4V A;  4Z5T B;  3AZM C;  5JRG B;  4YM6 A;  1ID3 C;  1P3A D;  1P3P C;  3AZK A;  2JSS A;  4H9O B;  3LEL C;  5DNM A;  1KX5 A;  3C1C B;  3UTA D;  5B1L D;  2CV5 C;  3MVD A;  3A6N A;  2YFW B;  4UUZ B;  4R8P D;  4CSR A;  3UT9 B;  1P3K D;  3MGP B;  5AY8 D;  1S32 A;  2ARO D;  5JRG D;  4CAY B;  3AV1 C;  3REH A;  4JJN A;  5GT3 B;  4ZBJ C;  5BS7 C;  5BT1 C;  3REI D;  4Z5T A;  5B31 C;  5CP6 C;  5JRG A;  3LJA C;  3C1C D;  2FJ7 C;  3AZF B;  4H9O A;  1TZY B;  4AWL C;  3W97 C;  5AV5 B;  3MGS B;  3UT9 D;  3REL B;  1N1J B;  3AN2 A;  2F8N G;  3MGP D;  4UUZ A;  3UT9 A;  4WU9 B;  3WA9 B;  2PYO C;  3VH5 A;  4Z66 C;  3MGP A;  3AZL B;  5G49 A;  5GT3 D;  5CPI D;  1ULY A;  3O62 C;  1HQ3 D;  5AVC C;  5CPJ B;  1M19 D;  4CAY A;  4HGA C;  1P34 B;  3MGS D;  3REL D;  3AZF A;  1TZY A;  1P3P B;  3C1B B;  3LZ0 C;  3LEL B;  5AV5 A;  3KXB B;  1N1J A;  4WU9 D;  3REL A;  3WA9 D;  3AZL D;  5JA4 B;  1BH8 B;  4E44 A;  5DNN B;  5CPJ D;  5BNX B;  3AZG D;  3AZL A;  1F66 B;  5B2J B;  5AVB A;  3AZM D;  1ID3 D;  1P3P D;  1P3L C;  5B33 C;  3LEL D;  4ZBJ B;  5B1M C;  1P34 A;  2LY8 A;  4LD9 A;  5B31 B;  5CP6 B;  3B6G C;  3AZH C;  1H3O B;  3C1B A;  5GT0 C;  2CV5 D;  3LEL A;  1P3F C;  4AWL B;  3WKJ B;  3KXB A;  3W97 B;  4M6B A;  1P3O C;  5DNN A;  2HIO B;  3REJ A;  2YFV B;  1JFI B;  4KGC C;  1F66 A;  3B0D B;  3AV1 D;  5B2J A;  4Z66 B;  1M18 C;  3MGR B;  3O62 B;  5BT1 D;  3AFA C;  3B0B A;  3TU4 B;  3WTP C;  5B31 D;  5CP6 D;  2FJ7 D;  4HGA B;  1ZLA C;  5CPK C;  1KU5 A;  2BYM B;  1TAF B;  2NQB A;  3W97 D;  1H3O A;  3KWQ B;  1KX3 C;  4WU8 C;  1AOI A;  3NQU B;  3WKJ A;  1M1A C;  3W97 A;  5C3I C;  2PYO D;  1HTA A;  2HIO A;  4Z66 D;  3MGR D;  5E5A C;  3O62 D;  2YFV A;  1JFI A;  1U35 B;  2NZD A;  5AV9 C;  4Z66 A;  3MGR A;  3O62 A;  3AZN C;  5B32 C;  3TU4 A;  4J8W B;  3KUY B;  3AZI B;  1P3L B;  4E45 A;  1TAF A;  3B0C W;  3MGQ C;  3KWQ A;  1WWI A;  3AZH B;  5GT0 B;  2L5A A;  1P3F B;  4ZUX C;  3KSY A;  5B1L B;  1U35 A;  4EO5 B;  3X1T C;  4R8P B;  5GXQ C;  1P3L D;  1M18 B;  5B2I A;  5B33 D;  1P3K B;  5B1M D;  3MNN C;  5AY8 B;  4J8W A;  2ARO B;  4X23 C;  3KUY A;  3AZI A;  3AZH D;  1P3L A;  1ZLA B;  5CPK B;  5GT0 D;  3B6G D;  5AV8 A;  1P3F D;  3REI B;  4G92 C;  3AZH A;  1P3O D;  1P3A A;  5GT0 A;  1KX3 B;  4WU8 B;  1P3F A;  4KGC D;  5C3I B;  1F1E A;  3UTA A;  5B1L A;  1M18 D;  4R8P A;  3AFA D;  5AV9 B;  3WTP D;  5CHL B;  1ZLA D;  3V9R B;  5CPK D;  1P3K A;  5CPI B;  1HQ3 B;  5AY8 A;  1M19 B;  2ARO A;  5CPK A;  1KX3 D;  4WU8 D;  1M1A D;  3REI A;  4H9R B;  3MGQ B;  3C1C A;  4WU8 A;  5E5A D;  2YFW A;  3W99 C;  5AV9 D;  3AZE C;  4ZUX B;  3AZN D;  5B32 D;  5AV9 A;  3X1T B;  3AZG B;  5GXQ B;  3V9R A;  1EQZ C;  3AZJ C;  5GT3 A;  5CPI A;  1HQ3 A;  2CWE A;  1P3M C;  1M19 A;  3MGQ D;  3R45 B;  3AZM B;  4X23 B;  1ID3 B;  4WNN B;  3W98 C;  3MGQ A;  1P3G C;  3MGS A;  5B0Z C;  4ZUX D;  3X1S C;  3AYW C;  2CV5 B;  4H9P B;  3X1T D;  4NE3 A;  4WZS B;  5GXQ D;  4NFT A;  4ZUX A;  5B0Y C;  4WU9 A;  3WA9 A;  5CPJ A;  1Q9C A;  5AV6 C;  3X1T A;  1B67 A;  3MNN D;  4J8V C;  3AZG A;  4X23 D;  3AV1 B;  4H9S C;  3R45 A;  3AZM A;  4X23 A;  1ID3 A;  3LJA B;  4WNN A;  1P3P A;  2FJ7 B;  4XUJ C;  2IO5 C;  4KHA B;  5JA4 A;  1BH8 A;  3AV2 C;  5BNX A;  2CV5 A;  2F8N B;  4H9P A;  5BNV B;  3LZ1 C;  1P3I C;  2PYO B;  3REK C;  4QLC C;  5AVC B;  3WAA C;  3VH6 W;  1BFM A;  3LJA D;  4YM6 C;  5F99 C;  3AV1 A;  1EQZ B;  5KDM B;  5BS7 A;  1P3M B;  5DNM C;  1KX5 C;  5B31 A;  5CP6 A;  3LJA A;  2FJ7 A;  2F8N D;  3MVD C;  3LZ0 B;  3A6N C;  3W99 D;  3W98 B;  1P3G B;  3AZE D;  4KHA A;  5B0Z B;  2F8N A;  1BH9 B;  5BNV A;  5AVC D;  3X1S B;  3VH6 T;  1S32 C;  2PYO A;  1EQZ D;  3AZJ D;  3REH C;  4JJN C;  5AVC A;  1P3M D;  5AV6 B;  4J8U C;  4Z5T C;  2BYM A;  2BYK B;  5KDM A;  3LZ0 D;  1P3M A;  5B33 B;  3W98 D;  5B1M B;  1P3G D;  5B0Z D;  3AN2 C;  3B6G B;  3NQU A;  3LZ0 A;  3X1S D;  3AYW D;  3W98 A;  4XUJ B;  1P3G A;  3X1V C;  2IO5 B;  5B0Y D;  1P3O B;  3AV2 B;  5AV6 D;  2HUE C;  4J8V D;  3LZ1 B;  4KGC B;  5GSU C;  1B6W A;  1P3I B;  5AV6 A;  3B0C T;  3WAA B;  3AFA B;  3WTP B;  3AZF C;  2BYK A;  3B6F C;  5F99 B;  1TZY C;  5B33 A;  5B1M A;  4XUJ D;  4H9S A;  1P3B C;  5AV5 C;  5DNM B;  3B6G A;  4Z2M H;  3AV2 D;  3MVD B;  3A6N B;  1M1A B;  3LZ1 D;  3NQJ B;  1P3O A;  1P3I D; 
#chains in the Genus database with same CATH topology
 3REK D;  5E5A B;  4QLC D;  3H0R C;  3EG5 B;  5AVB C;  3LZ1 A;  3WAA D;  4KGC A;  1S32 B;  5F99 D;  4YM6 D;  1M18 A;  3REH B;  4JJN B;  3AZN B;  1P34 C;  5B32 B;  5DNM D;  3AFA A;  4H9N B;  1KX5 D;  3WTP A;  4J8U B;  4LD9 C;  2Y2N A;  5F99 A;  4G91 C;  1ZLA A;  3F6T A;  3C1B C;  3MVD D;  3A6N D;  3KXB C;  2ZY2 A;  3AN2 B;  4WV4 B;  1KX3 A;  5DNN C;  3REJ C;  1M1A A;  3X1V B;  5B40 C;  3NQJ A;  1S32 D;  1F66 C;  3W96 C;  4XZQ C;  1KX4 C;  2RVQ C;  5E5A A;  5B2J C;  3REH D;  4JJN D;  5G49 B;  2HUE B;  4J8U D;  4Z5T D;  4DRA A;  5GSU B;  2G5I C;  3AZN A;  5B32 A;  4H9N A;  5B31 G;  4J8X C;  4J8U A;  2NQB C;  3MNN B;  4KUD C;  3VH5 W;  3B6F B;  3X1U C;  2Y2M A;  3AN2 D;  1AOI C;  5B24 C;  3WKJ C;  1P3B B;  2ZY3 A;  4H9R A;  3X1V D;  4G92 B;  3H0M C;  2HIO C;  4DRB A;  3X1V A;  2NZD C;  5GSU D;  3B0D C;  3MGR C;  5AVB B;  3TU4 C;  3VH5 T;  5GXQ A;  5GSU A;  3B6F D;  3AZF D;  1TZY D;  1P3B D;  2F8N H;  3MNN A;  5AV5 D;  4LD9 B;  3B6F A;  3KWQ C;  2RIQ A;  4G91 B;  2DF4 C;  1P3B A;  3UTB C;  2Y2Q A;  2J8P A;  4NE5 A;  2F2A C;  3REJ B;  1U35 C;  5AVB D;  3W99 B;  4YS3 C;  5B40 B;  3AZE B;  2ZY4 A;  3W96 B;  4XZQ B;  1KX4 B;  5B2I C;  1P34 D;  4LD9 D;  5BO0 B;  4J8W C;  2Y2H A;  3WTP E;  3KUY C;  3AZI C;  3C1B D;  3AZJ B;  3AZK C;  5AV8 C;  3EPH A;  4J8X B;  3KXB D;  2NQB B;  4KUD B;  3X1U B;  1P3A C;  5DNN D;  3REJ D;  5B24 B;  1AOI B;  2XD1 A;  5B40 D;  1F66 D;  3W96 D;  4XZQ D;  3VH6 A;  3UTA C;  5B1L C;  2RVQ D;  1KX4 D;  5B2J D;  4EO5 C;  3AYW B;  3W99 A;  4R8P C;  2NZD B;  5B40 A;  2JE5 A;  3AZE A;  3W96 A;  4XZQ A;  1KX4 A;  5B0Y B;  1P3K C;  4J8X D;  5AY8 C;  5BO0 A;  5FUG B;  4H9Q B;  4J8V B;  2NQB D;  2ARO C;  4KUD D;  5JRG C;  3X1U D;  1EQZ A;  3AZJ A;  1AOI D;  5B24 D;  3WKJ D;  4J8X A;  3REI C;  4KUD A;  3C1C C;  3X1U A;  2HIO D;  5B24 A;  3UTB B;  2NZD D;  5B0Z A;  3UT9 C;  1BH9 A;  2DQN C;  3MGP C;  3X1S A;  3AYW A;  3AL0 C;  3TU4 D;  4Z2M G;  1WWS A;  5B0Y A;  4YS3 B;  5B32 G;  5GT3 C;  5CPI C;  3REK B;  5B2I B;  1HQ3 C;  4QLC B;  5FUG A;  4H9Q A;  4J8V A;  1M19 C;  3KWQ D;  2F8N K;  4YM6 B;  3AZK B;  5AV8 B;  3UTB D;  3MGS C;  1KX5 B;  3REL C;  1P3A B;  1A7W A;  3UTB A;  1U35 D;  4XUJ A;  2G5H C;  4YS3 D;  4WU9 C;  3WA9 C;  4CSR B;  3UTA B;  3AZL C;  3AV2 A;  5B2I D;  5CPJ C;  3AZG C;  4J8W D;  4YS3 A;  3KUY D;  3AZI D;  1P3I A;  3REK A;  3AZK D;  4QLC A;  5AV8 D;  4NE6 A;  3WAA A;  1R4V A;  4Z5T B;  3AZM C;  5JRG B;  4YM6 A;  1ID3 C;  1P3A D;  1P3P C;  3AZK A;  2JSS A;  4H9O B;  3LEL C;  5DNM A;  1KX5 A;  3C1C B;  2ZY5 A;  3UTA D;  5B1L D;  2CV5 C;  3MVD A;  3A6N A;  2YFW B;  4UUZ B;  4R8P D;  1W2E A;  4CSR A;  3UT9 B;  1P3K D;  3MGP B;  5AY8 D;  1S32 A;  2ARO D;  5JRG D;  4CAY B;  3AV1 C;  3REH A;  4JJN A;  5GT3 B;  4ZBJ C;  5BS7 C;  5BT1 C;  3REI D;  4Z5T A;  5B31 C;  5CP6 C;  5JRG A;  3LJA C;  3C1C D;  3P5J B;  3AZF B;  2FJ7 C;  2Y2J A;  4H9O A;  1TZY B;  4AWL C;  3W97 C;  5AV5 B;  3MGS B;  3UT9 D;  3REL B;  1N1J B;  3AN2 A;  2F8N G;  2Y2O A;  3MGP D;  2Y2I A;  4UUZ A;  3UT9 A;  4WU9 B;  3WA9 B;  2PYO C;  3VH5 A;  4Z66 C;  3MGP A;  3AZL B;  5G49 A;  5GT3 D;  5CPI D;  1ULY A;  3O62 C;  1HQ3 D;  5AVC C;  5CPJ B;  1M19 D;  4CAY A;  2Y2P A;  4HGA C;  1P34 B;  3MGS D;  3REL D;  2W8S A;  3AZF A;  1TZY A;  1P3P B;  3C1B B;  3LZ0 C;  2JCH A;  3LEL B;  5AV5 A;  3KXB B;  1N1J A;  4WU9 D;  3REL A;  3WA9 D;  3AZL D;  5JA4 B;  1BH8 B;  4E44 A;  5DNN B;  2ZM5 A;  5CPJ D;  5BNX B;  3AZG D;  3AZL A;  1F66 B;  5B2J B;  5AVB A;  3AZM D;  1ID3 D;  1P3P D;  1P3L C;  5B33 C;  3LEL D;  4ZBJ B;  5B1M C;  1P34 A;  2LY8 A;  4LD9 A;  5B31 B;  5CP6 B;  3B6G C;  3AZH C;  1H3O B;  3C1B A;  5GT0 C;  2CV5 D;  3LEL A;  1P3F C;  2UWX A;  4AWL B;  3WKJ B;  3KXB A;  3W97 B;  4M6B A;  1Z2C B;  1P3O C;  2FFF B;  5DNN A;  2HIO B;  3REJ A;  2YFV B;  1JFI B;  4KGC C;  1F66 A;  3B0D B;  3AV1 D;  5B2J A;  4Z66 B;  1M18 C;  3MGR B;  3O62 B;  5BT1 D;  3AFA C;  3B0B A;  3TU4 B;  3WTP C;  5B31 D;  5CP6 D;  2FJ7 D;  4HGA B;  1ZLA C;  5CPK C;  1KU5 A;  2BYM B;  1PZR A;  1TAF B;  2NQB A;  3W97 D;  1H3O A;  3H0L C;  3KWQ B;  1KX3 C;  4WU8 C;  1AOI A;  3NQU B;  3EPJ A;  4WJ3 C;  3WKJ A;  1M1A C;  2VQR A;  3W97 A;  5C3I C;  2PYO D;  1HTA A;  2HIO A;  4Z66 D;  3MGR D;  5E5A C;  3O62 D;  2YFV A;  1JFI A;  1U35 B;  2NZD A;  5AV9 C;  2Y2G A;  4Z66 A;  3MGR A;  3O62 A;  3AZN C;  5B32 C;  3TU4 A;  4J8W B;  3KUY B;  3AZI B;  1P3L B;  4E45 A;  1TAF A;  3B0C W;  3MGQ C;  3KWQ A;  1WWI A;  3AZH B;  5GT0 B;  2L5A A;  1P3F B;  4ZUX C;  3KSY A;  5B1L B;  1U35 A;  4EO5 B;  3X1T C;  4R8P B;  5GXQ C;  3EPL A;  1P3L D;  1M18 B;  5B2I A;  5B33 D;  1P3K B;  5B1M D;  3MNN C;  5AY8 B;  4J8W A;  2ARO B;  4X23 C;  3KUY A;  3AZI A;  3AZH D;  1P3L A;  1ZLA B;  5CPK B;  5GT0 D;  3B6G D;  5AV8 A;  1P3F D;  3REI B;  4G92 C;  3AZH A;  1P3O D;  1P3A A;  5GT0 A;  1KX3 B;  4WU8 B;  1P3F A;  4KGC D;  5C3I B;  1F1E A;  3UTA A;  5B1L A;  1M18 D;  3IP4 C;  4R8P A;  3AFA D;  5AV9 B;  3WTP D;  5CHL B;  1ZLA D;  3V9R B;  5CPK D;  1P3K A;  5CPI B;  1HQ3 B;  5AY8 A;  1M19 B;  2ARO A;  5CPK A;  1KX3 D;  4WU8 D;  1M1A D;  1T3U A;  3REI A;  4H9R B;  3MGQ B;  3C1C A;  4WU8 A;  5E5A D;  2YFW A;  3W99 C;  5AV9 D;  3AZE C;  4ZUX B;  2XD5 A;  3AZN D;  5B32 D;  5AV9 A;  3X1T B;  3AZG B;  5GXQ B;  3V9R A;  1EQZ C;  3AZJ C;  5GT3 A;  5CPI A;  1HQ3 A;  2CWE A;  1P3M C;  1M19 A;  3MGQ D;  3R45 B;  3AZM B;  4X23 B;  3FDD A;  1ID3 B;  4WNN B;  3W98 C;  3MGQ A;  3EPK A;  1P3G C;  3MGS A;  5B0Z C;  4ZUX D;  3X1S C;  3AYW C;  2CV5 B;  4H9P B;  3X1T D;  4NE3 A;  4WZS B;  5GXQ D;  4NFT A;  4ZUX A;  5B0Y C;  4WU9 A;  3WA9 A;  5CPJ A;  1Q9C A;  5AV6 C;  3X1T A;  1B67 A;  3MNN D;  4J8V C;  3AZG A;  4X23 D;  3AV1 B;  4H9S C;  3R45 A;  3AZM A;  4X23 A;  1ID3 A;  3LJA B;  4WNN A;  1P3P A;  2FJ7 B;  4XUJ C;  2IO5 C;  2Y2L A;  4KHA B;  5JA4 A;  1BH8 A;  3AV2 C;  5BNX A;  2CV5 A;  2F8N B;  4H9P A;  5BNV B;  3LZ1 C;  1P3I C;  2PYO B;  3REK C;  4QLC C;  5AVC B;  3WAA C;  3VH6 W;  1BFM A;  3LJA D;  4YM6 C;  5F99 C;  3AV1 A;  1EQZ B;  5KDM B;  5BS7 A;  1P3M B;  5DNM C;  1KX5 C;  5B31 A;  5CP6 A;  3LJA A;  2FJ7 A;  2F8N D;  3MVD C;  3LZ0 B;  3A6N C;  3W99 D;  3W98 B;  1P3G B;  3AZE D;  4KHA A;  5B0Z B;  2F8N A;  1BH9 B;  5BNV A;  5AVC D;  3X1S B;  3VH6 T;  1S32 C;  2PYO A;  1EQZ D;  3AZJ D;  3REH C;  4JJN C;  5AVC A;  1P3M D;  5AV6 B;  4J8U C;  4Z5T C;  3KFU G;  2BYM A;  2BYK B;  4DQY B;  5KDM A;  3LZ0 D;  3A1I A;  5B33 B;  1P3M A;  3W98 D;  5B1M B;  1P3G D;  5B0Z D;  3AN2 C;  3B6G B;  3NQU A;  3LZ0 A;  3X1S D;  3AYW D;  3W98 A;  4XUJ B;  1P3G A;  3X1V C;  2IO5 B;  5B0Y D;  1P3O B;  3AV2 B;  5AV6 D;  2HUE C;  4J8V D;  3LZ1 B;  4KGC B;  5GSU C;  1B6W A;  1P3I B;  5AV6 A;  3B0C T;  3WAA B;  3AFA B;  2BG1 A;  4UPK A;  3WTP B;  2BYK A;  3AZF C;  3B6F C;  5F99 B;  1TZY C;  5B33 A;  3A1K A;  5B1M A;  4XUJ D;  4H9S A;  1P3B C;  5AV5 C;  5DNM B;  2Y2K A;  3B6G A;  4Z2M H;  3AV2 D;  3MVD B;  3A6N B;  1M1A B;  3LZ1 D;  3NQJ B;  1P3O A;  1P3I D; 
#chains in the Genus database with same CATH homology
 3REK D;  5E5A B;  4QLC D;  3H0R C;  3EG5 B;  5AVB C;  3LZ1 A;  3WAA D;  4KGC A;  1S32 B;  5F99 D;  4YM6 D;  1M18 A;  3REH B;  4JJN B;  3AZN B;  1P34 C;  5B32 B;  5DNM D;  3AFA A;  4H9N B;  1KX5 D;  3WTP A;  4J8U B;  4LD9 C;  2Y2N A;  5F99 A;  4G91 C;  1ZLA A;  3F6T A;  3C1B C;  3MVD D;  3A6N D;  3KXB C;  2ZY2 A;  3AN2 B;  4WV4 B;  1KX3 A;  5DNN C;  3REJ C;  1M1A A;  3X1V B;  5B40 C;  3NQJ A;  1S32 D;  1F66 C;  3W96 C;  4XZQ C;  1KX4 C;  2RVQ C;  5E5A A;  5B2J C;  3REH D;  4JJN D;  5G49 B;  2HUE B;  4J8U D;  4Z5T D;  4DRA A;  5GSU B;  2G5I C;  3AZN A;  5B32 A;  4H9N A;  5B31 G;  4J8X C;  4J8U A;  2NQB C;  3MNN B;  4KUD C;  3VH5 W;  3B6F B;  3X1U C;  2Y2M A;  3AN2 D;  1AOI C;  5B24 C;  3WKJ C;  1P3B B;  2ZY3 A;  4H9R A;  3X1V D;  4G92 B;  3H0M C;  2HIO C;  4DRB A;  3X1V A;  2NZD C;  5GSU D;  3B0D C;  3MGR C;  5AVB B;  3TU4 C;  3VH5 T;  5GXQ A;  5GSU A;  3B6F D;  3AZF D;  1TZY D;  1P3B D;  2F8N H;  3MNN A;  5AV5 D;  4LD9 B;  3B6F A;  3KWQ C;  2RIQ A;  4G91 B;  2DF4 C;  1P3B A;  3UTB C;  2Y2Q A;  2J8P A;  4NE5 A;  2F2A C;  3REJ B;  1U35 C;  5AVB D;  3W99 B;  4YS3 C;  5B40 B;  3AZE B;  2ZY4 A;  3W96 B;  4XZQ B;  1KX4 B;  5B2I C;  1P34 D;  4LD9 D;  5BO0 B;  4J8W C;  2Y2H A;  3WTP E;  3KUY C;  3AZI C;  3C1B D;  3AZJ B;  3AZK C;  5AV8 C;  3EPH A;  4J8X B;  3KXB D;  2NQB B;  4KUD B;  3X1U B;  1P3A C;  5DNN D;  3REJ D;  5B24 B;  1AOI B;  2XD1 A;  5B40 D;  1F66 D;  3W96 D;  4XZQ D;  3VH6 A;  3UTA C;  5B1L C;  2RVQ D;  1KX4 D;  5B2J D;  4EO5 C;  3AYW B;  3W99 A;  4R8P C;  2NZD B;  5B40 A;  2JE5 A;  3AZE A;  3W96 A;  4XZQ A;  1KX4 A;  5B0Y B;  1P3K C;  4J8X D;  5AY8 C;  5BO0 A;  5FUG B;  4H9Q B;  4J8V B;  2NQB D;  2ARO C;  4KUD D;  5JRG C;  3X1U D;  1EQZ A;  3AZJ A;  1AOI D;  5B24 D;  3WKJ D;  4J8X A;  3REI C;  4KUD A;  3C1C C;  3X1U A;  2HIO D;  5B24 A;  3UTB B;  2NZD D;  5B0Z A;  3UT9 C;  1BH9 A;  2DQN C;  3MGP C;  3X1S A;  3AYW A;  3AL0 C;  3TU4 D;  4Z2M G;  1WWS A;  5B0Y A;  4YS3 B;  5B32 G;  5GT3 C;  5CPI C;  3REK B;  5B2I B;  1HQ3 C;  4QLC B;  5FUG A;  4H9Q A;  4J8V A;  1M19 C;  3KWQ D;  2F8N K;  4YM6 B;  3AZK B;  5AV8 B;  3UTB D;  3MGS C;  1KX5 B;  3REL C;  1P3A B;  1A7W A;  3UTB A;  1U35 D;  4XUJ A;  2G5H C;  4YS3 D;  4WU9 C;  3WA9 C;  4CSR B;  3UTA B;  3AZL C;  3AV2 A;  5B2I D;  5CPJ C;  3AZG C;  4J8W D;  4YS3 A;  3KUY D;  3AZI D;  1P3I A;  3REK A;  3AZK D;  4QLC A;  5AV8 D;  4NE6 A;  3WAA A;  1R4V A;  4Z5T B;  3AZM C;  5JRG B;  4YM6 A;  1ID3 C;  1P3A D;  1P3P C;  3AZK A;  2JSS A;  4H9O B;  3LEL C;  5DNM A;  1KX5 A;  3C1C B;  2ZY5 A;  3UTA D;  5B1L D;  2CV5 C;  3MVD A;  3A6N A;  2YFW B;  4UUZ B;  4R8P D;  1W2E A;  4CSR A;  3UT9 B;  1P3K D;  3MGP B;  5AY8 D;  1S32 A;  2ARO D;  5JRG D;  4CAY B;  3AV1 C;  3REH A;  4JJN A;  5GT3 B;  4ZBJ C;  5BS7 C;  5BT1 C;  3REI D;  4Z5T A;  5B31 C;  5CP6 C;  5JRG A;  3LJA C;  3C1C D;  3P5J B;  3AZF B;  2FJ7 C;  2Y2J A;  4H9O A;  1TZY B;  4AWL C;  3W97 C;  5AV5 B;  3MGS B;  3UT9 D;  3REL B;  1N1J B;  3AN2 A;  2F8N G;  2Y2O A;  3MGP D;  2Y2I A;  4UUZ A;  3UT9 A;  4WU9 B;  3WA9 B;  2PYO C;  3VH5 A;  4Z66 C;  3MGP A;  3AZL B;  5G49 A;  5GT3 D;  5CPI D;  1ULY A;  3O62 C;  1HQ3 D;  5AVC C;  5CPJ B;  1M19 D;  4CAY A;  2Y2P A;  4HGA C;  1P34 B;  3MGS D;  3REL D;  2W8S A;  3AZF A;  1TZY A;  1P3P B;  3C1B B;  3LZ0 C;  2JCH A;  3LEL B;  5AV5 A;  3KXB B;  1N1J A;  4WU9 D;  3REL A;  3WA9 D;  3AZL D;  5JA4 B;  1BH8 B;  4E44 A;  5DNN B;  2ZM5 A;  5CPJ D;  5BNX B;  3AZG D;  3AZL A;  1F66 B;  5B2J B;  5AVB A;  3AZM D;  1ID3 D;  1P3P D;  1P3L C;  5B33 C;  3LEL D;  4ZBJ B;  5B1M C;  1P34 A;  2LY8 A;  4LD9 A;  5B31 B;  5CP6 B;  3B6G C;  3AZH C;  1H3O B;  3C1B A;  5GT0 C;  2CV5 D;  3LEL A;  1P3F C;  2UWX A;  4AWL B;  3WKJ B;  3KXB A;  3W97 B;  4M6B A;  1Z2C B;  1P3O C;  2FFF B;  5DNN A;  2HIO B;  3REJ A;  2YFV B;  1JFI B;  4KGC C;  1F66 A;  3B0D B;  3AV1 D;  5B2J A;  4Z66 B;  1M18 C;  3MGR B;  3O62 B;  5BT1 D;  3AFA C;  3B0B A;  3TU4 B;  3WTP C;  5B31 D;  5CP6 D;  2FJ7 D;  4HGA B;  1ZLA C;  5CPK C;  1KU5 A;  2BYM B;  1PZR A;  1TAF B;  2NQB A;  3W97 D;  1H3O A;  3H0L C;  3KWQ B;  1KX3 C;  4WU8 C;  1AOI A;  3NQU B;  3EPJ A;  4WJ3 C;  3WKJ A;  1M1A C;  2VQR A;  3W97 A;  5C3I C;  2PYO D;  1HTA A;  2HIO A;  4Z66 D;  3MGR D;  5E5A C;  3O62 D;  2YFV A;  1JFI A;  1U35 B;  2NZD A;  5AV9 C;  2Y2G A;  4Z66 A;  3MGR A;  3O62 A;  3AZN C;  5B32 C;  3TU4 A;  4J8W B;  3KUY B;  3AZI B;  1P3L B;  4E45 A;  1TAF A;  3B0C W;  3MGQ C;  3KWQ A;  1WWI A;  3AZH B;  5GT0 B;  2L5A A;  1P3F B;  4ZUX C;  3KSY A;  5B1L B;  1U35 A;  4EO5 B;  3X1T C;  4R8P B;  5GXQ C;  3EPL A;  1P3L D;  1M18 B;  5B2I A;  5B33 D;  1P3K B;  5B1M D;  3MNN C;  5AY8 B;  4J8W A;  2ARO B;  4X23 C;  3KUY A;  3AZI A;  3AZH D;  1P3L A;  1ZLA B;  5CPK B;  5GT0 D;  3B6G D;  5AV8 A;  1P3F D;  3REI B;  4G92 C;  3AZH A;  1P3O D;  1P3A A;  5GT0 A;  1KX3 B;  4WU8 B;  1P3F A;  4KGC D;  5C3I B;  1F1E A;  3UTA A;  5B1L A;  1M18 D;  3IP4 C;  4R8P A;  3AFA D;  5AV9 B;  3WTP D;  5CHL B;  1ZLA D;  3V9R B;  5CPK D;  1P3K A;  5CPI B;  1HQ3 B;  5AY8 A;  1M19 B;  2ARO A;  5CPK A;  1KX3 D;  4WU8 D;  1M1A D;  1T3U A;  3REI A;  4H9R B;  3MGQ B;  3C1C A;  4WU8 A;  5E5A D;  2YFW A;  3W99 C;  5AV9 D;  3AZE C;  4ZUX B;  2XD5 A;  3AZN D;  5B32 D;  5AV9 A;  3X1T B;  3AZG B;  5GXQ B;  3V9R A;  1EQZ C;  3AZJ C;  5GT3 A;  5CPI A;  1HQ3 A;  2CWE A;  1P3M C;  1M19 A;  3MGQ D;  3R45 B;  3AZM B;  4X23 B;  3FDD A;  1ID3 B;  4WNN B;  3W98 C;  3MGQ A;  3EPK A;  1P3G C;  3MGS A;  5B0Z C;  4ZUX D;  3X1S C;  3AYW C;  2CV5 B;  4H9P B;  3X1T D;  4NE3 A;  4WZS B;  5GXQ D;  4NFT A;  4ZUX A;  5B0Y C;  4WU9 A;  3WA9 A;  5CPJ A;  1Q9C A;  5AV6 C;  3X1T A;  1B67 A;  3MNN D;  4J8V C;  3AZG A;  4X23 D;  3AV1 B;  4H9S C;  3R45 A;  3AZM A;  4X23 A;  1ID3 A;  3LJA B;  4WNN A;  1P3P A;  2FJ7 B;  4XUJ C;  2IO5 C;  2Y2L A;  4KHA B;  5JA4 A;  1BH8 A;  3AV2 C;  5BNX A;  2CV5 A;  2F8N B;  4H9P A;  5BNV B;  3LZ1 C;  1P3I C;  2PYO B;  3REK C;  4QLC C;  5AVC B;  3WAA C;  3VH6 W;  1BFM A;  3LJA D;  4YM6 C;  5F99 C;  3AV1 A;  1EQZ B;  5KDM B;  5BS7 A;  1P3M B;  5DNM C;  1KX5 C;  5B31 A;  5CP6 A;  3LJA A;  2FJ7 A;  2F8N D;  3MVD C;  3LZ0 B;  3A6N C;  3W99 D;  3W98 B;  1P3G B;  3AZE D;  4KHA A;  5B0Z B;  2F8N A;  1BH9 B;  5BNV A;  5AVC D;  3X1S B;  3VH6 T;  1S32 C;  2PYO A;  1EQZ D;  3AZJ D;  3REH C;  4JJN C;  5AVC A;  1P3M D;  5AV6 B;  4J8U C;  4Z5T C;  3KFU G;  2BYM A;  2BYK B;  4DQY B;  5KDM A;  3LZ0 D;  3A1I A;  5B33 B;  1P3M A;  3W98 D;  5B1M B;  1P3G D;  5B0Z D;  3AN2 C;  3B6G B;  3NQU A;  3LZ0 A;  3X1S D;  3AYW D;  3W98 A;  4XUJ B;  1P3G A;  3X1V C;  2IO5 B;  5B0Y D;  1P3O B;  3AV2 B;  5AV6 D;  2HUE C;  4J8V D;  3LZ1 B;  4KGC B;  5GSU C;  1B6W A;  1P3I B;  5AV6 A;  3B0C T;  3WAA B;  3AFA B;  2BG1 A;  4UPK A;  3WTP B;  2BYK A;  3AZF C;  3B6F C;  5F99 B;  1TZY C;  5B33 A;  3A1K A;  5B1M A;  4XUJ D;  4H9S A;  1P3B C;  5AV5 C;  5DNM B;  2Y2K A;  3B6G A;  4Z2M H;  3AV2 D;  3MVD B;  3A6N B;  1M1A B;  3LZ1 D;  3NQJ B;  1P3O A;  1P3I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...