5B10O

A mutant of ospa
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKVLADVKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title A mutant of OspA
rcsb
source organism Borrelia burgdorferi (strain atcc 35210 / b31 / cip 102532 / dsm 4680)
molecule tags Membrane protein
total genus 47
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2015-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 5b10O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 5b10O02
5B11O 1P4PA 2OY1O 2OY8A 2HKDA 2OYBO 3CKFA 5B2AO 1FJ1E 2G8CO 1OSPO 2I5ZO 2OL7A 2I5VO 3AUMO 5B10O 2FKGA 2FKJA 3CKGA 2OL8O 2OY7A 2OY5O 2PI3O 5B3MO 2AF5A 2OL6O 3EC5A
chains in the Genus database with same CATH superfamily
3D95A 4QQ1A 3C77X 1RXJA 1BJ7A 1NC9A 4A1HA 3PIOE 3CC4E 1YJNE 4IB8A 2FWVA 4BBOA 4I60A 1JMXA 1W2BE 1SXXA 3B2KA 4IOCE 4O4UA 3LTWA 1U0XA 3EC5A 1HMTA 4AZOA 3CC7E 5K68A 2RA6A 4BX5A 5B5GA 2W2AA 5JD2A 3VE1A 1KZXA 1GXAA 3D4RA 4COTA 1OBUA 3STNA 3ZW0A 2A2UA 4XMEA 1VWDB 1VWAB 3PH5A 2QOMA 2A13A 3F9DA 2ASNX 4ZH6A 1VWLB 3PIPE 1LUQA 4ARHA 5KIDA 3HOEA 1HY2A 5BVTA 2BSZA 1KQWA 2FR2A 4ZHHA 4AZMA 1KQXA 4CDEA 1AVGI 4TKBA 4AYHA 4DNEA 2MF6A 5D47A 4L3RA 3IG9A 4Z27A 2QCBA 4TNNA 4MISA 2IZDB 4JHQA 2RTMA 1GX9A 1L6MA 2N93A 1KZWA 1HBPA 4TQ2A 3B2JA 2G7BA 5CYBA 1M1KG 1VWPB 2YG2A 5FFHA 4K19A 4ORWA 5AJBA 2L5PA 1KQSE 2WUTA 2G8CO 1KL3A 1AQBA 5IO6A 3EMMA 2OZQA 2AH7X 4NNTA 1YITE 2CQLA 1VQME 5HZ5A 3WJDA 2QEXE 3SLJA 2A3FX 2AVIA 2RTAA 1I05A 4YDAA 4QZTA 3BDRA 3T2WA 5HCDC 1CRBA 5L8NA 1I9HA 4HPAA 2RN4A 3APUA 4PJ2A 2OYBO 1X8PA 3PEDA 4Z2PA 1TVQA 5JR8A 5GAGG 5LJKA 1VQKE 5HAEA 3RZYA 2BHVA 1NGLA 1VYGA 4ZGUA 1EXSA 4ORUA 2X8TA 1W4TA 4QYPA 4IB7A 1KT3A 2GC9A 3SAOA 1EIOA 1KOIA 1KT7A 5AEOA 3WJBA 2OF8A 5L8OA 5B2AO 1EQDA 4YFQA 4WHIA 1BLRA 3IGEA 3FIDA 3FR5A 1KL5A 4QZUA 3O19A 3CMEE 5HTEA 1GX8A 3CQNA 2OY8A 1YWDA 2RTCB 2QO4A 5F58A 2X46A 3BRNA 1EPBA 1LF7A 4FBOA 4ML7B 4JO6A 1B8EA 3MBTA 3LV4A 5HTDA 3BLGA 1SWKA 2UYWA 3KZAA 5EDBA 4ZR2A 4DCBA 2Q9SA 3WJFA 3WZNA 2I5ZO 1VYOA 3HWFA 1RXKA 1OBPA 1TXLA 4BX5B 3VG2A 1FE3A 2LKKA 3EYCA 4C5PA 5F6ZA 4AZPA 1GT5A 3FW4A 2HMBA 4EXZA 2QOSC 3RE6A 4GKCA 1PM1X 1G5WA 3ZW0B 4CK4A 5LJBA 4I9RA 1HBQA 3CC2E 1AVEA 1S72E 1OEEA 4QRLA 3EM0A 3RDXA 1YJWE 4CDDA 1Q7YG 4GH7A 2FS6A 3CKFA 4D6AA 2O62A 1P6PA 3S5XA 1SY3A 3WXQA 4LKTA 1RAVA 1SWEA 3B2IA 3QQ2A 2Q2PA 3OJYC 4Z2OA 1D2UA 1B56A 1UYOX 3AKMA 2X45A 3BY0A 2Y32A 1N0SA 4YFPA 1KC8G 3K3LA 5BVSA 1Y52X 2X56A 4EFGA 3STKA 3S60A 2F09A 5IRUA 1Q82G 3P6FA 3FIQA 4TLJA 5H9NA 3WZQA 1QWDA 1X8NA 3ELZA 2K23A 4YKMA 1ZNDA 1A18A 2AT0X 1YP7A 3CWKA 3RDSA 1KT6A 2OFRX 3P6DA 4BCSA 2Y3FA 1EIIA 1SLEB 5JVGE 4BGFA 3Q34A 1OPAA 1UZ2X 1PTSA 5LJEA 2JU3A 3BSZE 2IZGB 2FHNX 3BS2A 2KTSA 5HZ8A 2F01A 1SWUA 4YGHA 4KH8A 1XCAA 1O1VA 3SZIA 2F73A 3NR3A 2XSTA 4OKAA 2X34A 4HPDA 1HXZA 3RDUA 4GE1A 4MVEA 5DM6E 3OBLA 1SWFA 2DM5A 4QAEA 2RQ0A 1VQPE 3CQRA 1IKEA 1TOWA 3MX7A 5HZQA 4CDFA 1A57A 5EPQA 3CKGA 2LBAA 4N7CA 1KXOA 2R56A 5D8JA 3OE3A 4GDZA 1DFVA 3VG4A 1FEMA 1P4PA 3VG6A 1HMSA 1SLFB 1O1UA 3NQ3A 3FEPA 3AUMO 1SLDB 3G7XA 1SRHA 2YMSA 2NNQA 2CZTA 4RUUA 1VQNE 2JU7A 1MK5A 4KCAA 4IRWA 3KFIA 2HZRA 3JSQA 1IW2A 4OS3A 4Y5DA 3CCVE 5EZ2A 4GNYA 2KW1A 4INNA 5FQ7E 2WEWA 1CBQA 1ML7A 4UU2A 2WQAE 3FA9A 3CXCE 1EUOA 4N7DA 1QY2A 5B5FA 4ALOA 3WBGA 1SRGA 3ZQ3A 3S5VA 3FLLA 1T8VA 2MM3A 5DM7E 1HQQA 1PBYA 4OS0A 1ZNLA 5GAHG 1SWLA 5H8TA 3WJCA 3HWDA 2NNDA 2GH7A 1FJ1E 1SWOA 2AT6X 2RTNB 3ZI8A 1DZKA 4A60A 4Z28A 1VQ9E 1E5PA 2JW1A 1SWSA 3TGBA 1I4UA 2RTQB 1DZMA 3L4RA 3WYPA 1D3SA 1W6FA 3NX2A 2AT5X 2VFCA 3I0AA 3RY1A 2ACOA 3TGAA 2CM4A 2G5LA 4ODDA 1SREA 4YH0A 1EPAA 3BX8A 3FEKA 1NQNA 1RSTB 1AB0A 1DF8A 3AEHA 4KC7A 2RTRB 3DSZA 5D45A 2X55A 1QQSA 3VHMA 4HPBA 3CCSE 4FBVA 1LDQA 2PI3O 2RTPB 1JBHA 1W5RA 1DZJA 4Y0SA 4XMDA 1N43A 4ZH9A 1MVGA 2AL0X 5EDCA 1RBPA 1SMPI 3TGCA 3I56E 1K8AG 2FS7A 4GDAA 2GTLN 4BQUA 1JIWI 3V8UA 5FQ8E 4O4SA 1TW4A 2RTFB 3P6EA 4Y0RA 5K67A 3CCRE 4NNSA 3BX7A 1Y55X 1ZNHA 5L3YA 3WOVA 4ZHDA 5DG4A 3CCLE 3ZZVA 1VWOB 3HK1A 5F1EA 5C0NA 4YFRA 2OTLE 4U8UN 3GE2A 4O49A 4FBRA 3P6GA 3FYFA 5HA0A 3CMPA 3MVFA 4YGGA 3CR6A 4WF9E 1Q86G 4CPIA 1IFCA 2IFBA 3VHHA 1NQMA 2RTLA 2JGSA 4QGWA 2ZAIA 1AVDA 3VG3A 1QY0A 3EBWA 4IABA 3PH6A 2EU7X 4TKHA 4YGZA 4FGIB 4Z6JA 3RBYA 4O9SA 2IZCB 5K06A 1SWAA 3PQUA 4U3QA 1BBPA 5CHKA 1O8VA 1DV9A 1A2DA 4GK9A 4D6BA 3MM0A 2IZEB 4Z2VA 3FA7A 1YJ9E 4U9CA 3RY2A 4LKPA 1NJIG 4GU8A 4BX6A 4GJSA 5B11O 1S2PA 1EI5A 4M7MA 1VWFB 1SWBA 1DF3A 2IZHB 4ZCBA 1N4JA 3SZJA 1LPJA 1Q81G 4OS8A 4IO9E 2HLVA 3FW5A 1X71A 4U46A 4ORXA 1NBXA 3RDQA 1FELA 2DJGA 1YWAA 1NP4A 1QY1A 2BT9A 3WJGA 4EEJA 3NBXX 1JMZA 4PSQA 5LJDA 4ORRA 1RL6A 2CBRA 2W2BA 3CBCA 4NV7A 1SXYA 3WVMA 1VWMB 1GT3A 2RCTA 2OFAA 2RTJA 3P02A 4CV7A 2HYSA 1BEBA 3FENA 1YIJE 5B10O 3CD6E 1AELA 4YMYA 2QMIA 1E2TA 4QGXA 1SLGB 3IFBA 1VQ8E 1B0OA 2L9CA 1GGLA 4WFNE 3FR2A 3TZSA 4LZUA 5DPQA 1ZNEA 2POAA 4Y0QA 3T1DA 4WFBE 5F7GA 4GGTA 2A2GA 1DZPA 1VWNB 4NLJA 2BS6A 1KFFA 3HOLA 5FENA 1Z24A 2FT9A 4AZNA 5GADG 2OVAA 3DTQA 4BOEA 1OPBA 4I9SA 1KGLA 1VWCB 4A1YA 1ZNKA 1K24A 2GTFX 1HN2A 1STRB 2FHLA 2IZKA 4NLIA 2QO5A 5JVHE 2OVEA 4WCEE 1LCZA 2VFBA 1BRPA 3PPTA 1G7NA 1X8QA 1N9YA 2JN3A 3DLLE 3RE5A 1VQLE 4NYQA 1SWDA 1I78A 1ZNGA 3ZW1A 2HNXA 4AW8A 1S44A 1LIEA 3UEVA 1BM5A 5HL7E 2RTDB 1GX3A 2AKQA 1Y9TA 2WWPA 3VG7A 2C4IA 4CSBA 1ADLA 1JV4A 3KFFA 5H1SI 3IA8A 1VYFA 2BS5A 5FAZA 5HZ9A 1R0UA 1U17A 2RTOB 3CPWE 2A5BA 2WQ9A 2R73A 1PEEA 3FDCA 1A3YA 5H9AA 2OL6O 3HWGA 1Y0GA 3P6CA 2P8GA 1BWYA 3EW2A 4WFUA 1VWHB 4BX6B 4YDBA 1HQPA 3CCUE 1QVGE 2MWHA 2I5VO 2FKGA 3OW2E 1ERXA 1K9MG 4UU3A 2AF5A 1IFBA 3D9WA 4IOAE 5AQ6A 2C1QA 3WJEA 5IO5A 3EBKA 1CBRA 4KIIA 4RUNA 1JJXA 3B2HA 2AMMX 2ACPX 1KT5A 4I95A 3VPJE 4ZHFA 1SY2A 5CE4A 3T2XA 1DC9A 1I06A 2ZJRE 2FTBA 5AN9B 3N91A 5LJHA 3PDFA 4AZRA 1IJ8A 2FGSA 1LICA 5LJGA 1SWHA 2OY5O 3UAQA 3TF6A 4WFVA 2ANSA 4GUZA 3JQOA 2GJ5A 2RTBB 1FDQA 3VE2A 4TJZA 3NQKA 2QA4E 1PBOA 2RTHB 4U67E 1T68X 2KT4B 2X4MA 3B2LA 1X8UA 5HBSA 5LKEA 5AJCA 3CF5E 1GKAA 1X89A 3G4SE 3X00A 2CAMA 2RTIB 3ZUIA 1VWJB 1NDJA 1SA8A 3FELA 1U18A 4DQ3A 1RSUB 3T6FA 4ID2A 2CBSA 3BU1A 2WPUA 4ZGFA 3T6LA 1G74A 1K3BA 1SRIA 1VWGB 4ON1A 2Q39A 4YBPA 2FRSA 4ZHCA 1VWQB 2IZIA 5FQ6E 1EALA 2KD2A 1BRQA 4WFAE 3S26A 4TKJA 1N7YA 3D96A 3CCQE 3H3IA 1X8OA 1LCVA 1JJJA 1CBSA 4AZQA 1SWJA 4YKOA 1JQPA 4UY8G 3G71E 1VQOE 2ZSCA 3RDMA 2BC3A 3CCEE 2W2FA 1WUBA 5BVQA 3ZW1B 3NP1A 5EEEA 2ZJQE 5IXGA 2X8SA 1JZUA 1SWQA 2Z4IA 1N8RG 2CM9A 1QVFE 1ZRYA 3J7ZG 1VQ7E 4OMXA 1VWKB 4GETA 4IMNA 1N9MA 4GGRA 4Y59A 4EDEA 3I17A 2OL7A 2GTLM 5KICA 3VU1A 5IO7A 1SXWA 4CPHA 2E4JA 1LNMA 1QABE 1OEKA 2R74A 2RTGB 4M6SA 1MX7A 3HPEA 4ORSA 1YI2E 5MLCH 1CBIA 2MO5A 1LFOA 4IAXA 1T0VA 4JNJA 4ES7A 1RXHA 4CPEA 4LZVA 5IRWA 4U8UM 1CJ5A 1SXUA 1SWPA 2OFMX 3WZPA 1STSB 4YBUA 4EKVA 3WZOA 1SWCA 2FLJA 4BX7A 2VDFA 2IZLB 1QG5A 1PMPA 2JMBA 2A5CA 3SLOA 3KQ0A 5D48A 1WBIA 2HZQA 2IZAA 5B29A 1YWCA 3U03A 2LBVA 2RCQA 4XMGA 3U9PC 5HWZA 1BSQA 3GAQA 4LQZA 3PECA 4YVBA 1RJLC 1HMRA 4A8ZA 1SY0A 4MEEA 4JGLA 5LKFA 4OMWA 4FQBB 4QGVA 4NW4A 3APVA 1KL4A 1LELA 2MJIA 5H9KA 4IBAA 3PQSA 5HCEC 4OEMA 4GD9A 2HKDA 2ALLX 4ZFXA 2LB6A 1E06A 3C76X 1SRFA 2AT8X 4BJ8A 1GKAB 1ICNA 2RD7C 4MVIA 2WEXA 1OEJA 2L67A 4IB9A 2AT3X 4CPFA 3CCME 1JYDA 5IRAA 3RSWA 3LHNA 1NP1A 2IZFB 1YWBA 1MX8A 3U0DA 3ELXA 1H91A 3RDOA 1ERBA 1MM9A 3NADA 2A0AA 4QNIA 1GM6A 3FA6A 1YP6A 3MG5A 1STPA 2QM9A 4EQAC 3SZHA 3RKGA 2JU8A 1MOYA 1VWRB 3KVNA 3RWXA 3FMZA 3NX1A 4O3ZA 4GZVA 1HXLA 2Q2MA 1BSYA 2OL8O 4MVKA 4O4OA 4WBKA 2GTLO 5BYPA 1OBQA 4I3BA 1VQ4E 4R0BA 3UEWA 3BU9A 4XMFA 1ICMA 4GNWA 2LA7A 4ORYA 4OELA 3WYQA 3CBSA 1G85A 1FENA 1BSOA 3SOTA 1SWNA 2XKLA 4L1NA 1LIBA 1IKJA 1K73G 4IMOA 3VHIA 4KT5A 2OY1O 1TOUA 4O3XB 2CZUA 3E3CA 1YHQE 2G78A 3G6EE 1LIFA 3P6HA 3CCJE 4BVMA 3CMAE 2JOZA 4U8UO 5KHPA 2QO6A 1I04A 2NNEA 3ZUOA 1JJ2E 4O3YA 1B4MA 3HTYA 1ACDA 4CPHB 1IIUA 4ZHGA 2WR6A 3C78X 1LIDA 4B55A 4ZJ0A 1QFTA 1MDCA 2OFBA 2Y3EA 1GT1A 5H9LA 2KTDA 3PP6A 5D4AA 4MIRA 5L8IA 5LJCA 3NPOA 1KD1G 3I55E 3KFHA 1YUPA 1UREA 4KC8A 2FR3A 2OVSA 3STMX 1KT4A 3F8AA 5B3MO 3ZW2A 5B27A 4I3CA 1JYJA 1E02A 2ZJPE 1VQ6E 3UEUA 4GRJA 4BX7B 3HWEA 1XKIA 3F6ZB 2UZ2A 3ZWEA 5F2BA 1Y53X 3VGWA 4MVLA 5HCCC 5HZ6A 4YCEA 1RLBE 1VQ5E 4ALBA 2K62A 3FA8A 3D97A 1M90G 1YIVA 4GJVA 4DQ4A 1JJUA 1SWRA 2X8FA 1SWTA 2G79A 3APWA 1SRJA 2ZAGA 1SY1A 4I3DA 3NQ9A 1VWBB 3P24A 4I6SA 5GAEG 3AKNA 1LCWA 3VG5A 4QYNA 3EW1A 5HA1A 5F6BA 2NP1A 3Q6LA 3UEXA 1SWGA 3APXA 4CDCA 1VWEB 5EEDA 2OVDA 2Q4NA 4HWMA 1OSPO 2OTJE 2Z4HA 4HPCA 3FR4A 2FKJA 4O4XA 5CSEA 2OY7A 3OD9A 3KFGA 1Y9LA 3SLTA 2WSJA 2L68A 1GT4A 1S7DA 2LFOA 4NP1A 2RTKA 4IB6A 1QFVA 2MHDA 2IZJA 3QKGA 4XMHA 4O3WA 1EW3A 2A8GA 1FTPA 3PK2A 2IZBA 2OF9A 2RTEB 1E00A 2M4LA 3O2YA 1UYNX 1LDOA 2BLGA 4HFOA 2X32A 4Y0PA 1ALBA 4IAWA 4NYRA 1MUPA 1LKEA 1MEPA 3O22A 4YCHA 2C1SA 2DJFA 4GGZA 4NV8A 2PY1A 1VWIB 4XMCA 1VPRA 3JS1A
chains in the Genus database with same CATH topology
5B11O 1P4PA 1RJLC 2OY1O 2OY8A 2HKDA 2OYBO 3CKFA 5B2AO 1FJ1E 2G8CO 1OSPO 2I5ZO 2OL7A 2I5VO 3IG9A 3AUMO 5B10O 2FKGA 2FKJA 3CKGA 2OL8O 2OY7A 2OY5O 3IGEA 2PI3O 5B3MO 2AF5A 2OL6O 3EC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B11 O;  1P4P A;  2OY1 O;  2OY8 A;  2HKD A;  2OYB O;  3CKF A;  5B2A O;  1FJ1 E;  2G8C O;  1OSP O;  2I5Z O;  2OL7 A;  2I5V O;  3AUM O;  5B10 O;  2FKG A;  2FKJ A;  3CKG A;  2OL8 O;  2OY7 A;  2OY5 O;  2PI3 O;  5B3M O;  2AF5 A;  2OL6 O;  3EC5 A; 
#chains in the Genus database with same CATH topology
 3D95 A;  4QQ1 A;  3C77 X;  1RXJ A;  1BJ7 A;  1NC9 A;  4A1H A;  3PIO E;  3CC4 E;  1YJN E;  4IB8 A;  2FWV A;  4BBO A;  4I60 A;  1JMX A;  1W2B E;  1SXX A;  3B2K A;  4IOC E;  4O4U A;  3LTW A;  1U0X A;  3EC5 A;  1HMT A;  4AZO A;  3CC7 E;  5K68 A;  2RA6 A;  4BX5 A;  5B5G A;  2W2A A;  5JD2 A;  3VE1 A;  1KZX A;  1GXA A;  3D4R A;  4COT A;  1OBU A;  3STN A;  3ZW0 A;  2A2U A;  4XME A;  1VWD B;  1VWA B;  3PH5 A;  2QOM A;  2A13 A;  3F9D A;  2ASN X;  4ZH6 A;  1VWL B;  3PIP E;  1LUQ A;  4ARH A;  5KID A;  3HOE A;  1HY2 A;  5BVT A;  2BSZ A;  1KQW A;  2FR2 A;  4ZHH A;  4AZM A;  1KQX A;  4CDE A;  1AVG I;  4TKB A;  4AYH A;  4DNE A;  2MF6 A;  5D47 A;  4L3R A;  3IG9 A;  4Z27 A;  2QCB A;  4TNN A;  4MIS A;  2IZD B;  4JHQ A;  2RTM A;  1GX9 A;  1L6M A;  2N93 A;  1KZW A;  1HBP A;  4TQ2 A;  3B2J A;  2G7B A;  5CYB A;  1M1K G;  1VWP B;  2YG2 A;  5FFH A;  4K19 A;  4ORW A;  5AJB A;  2L5P A;  1KQS E;  2WUT A;  2G8C O;  1KL3 A;  1AQB A;  5IO6 A;  3EMM A;  2OZQ A;  2AH7 X;  4NNT A;  1YIT E;  2CQL A;  1VQM E;  5HZ5 A;  3WJD A;  2QEX E;  3SLJ A;  2A3F X;  2AVI A;  2RTA A;  1I05 A;  4YDA A;  4QZT A;  3BDR A;  3T2W A;  5HCD C;  1CRB A;  5L8N A;  1I9H A;  4HPA A;  2RN4 A;  3APU A;  4PJ2 A;  2OYB O;  1X8P A;  3PED A;  4Z2P A;  1TVQ A;  5JR8 A;  5GAG G;  5LJK A;  1VQK E;  5HAE A;  3RZY A;  2BHV A;  1NGL A;  1VYG A;  4ZGU A;  1EXS A;  4ORU A;  2X8T A;  1W4T A;  4QYP A;  4IB7 A;  1KT3 A;  2GC9 A;  3SAO A;  1EIO A;  1KOI A;  1KT7 A;  5AEO A;  3WJB A;  2OF8 A;  5L8O A;  5B2A O;  1EQD A;  4YFQ A;  4WHI A;  1BLR A;  3IGE A;  3FID A;  3FR5 A;  1KL5 A;  4QZU A;  3O19 A;  3CME E;  5HTE A;  1GX8 A;  3CQN A;  2OY8 A;  1YWD A;  2RTC B;  2QO4 A;  5F58 A;  2X46 A;  3BRN A;  1EPB A;  1LF7 A;  4FBO A;  4ML7 B;  4JO6 A;  1B8E A;  3MBT A;  3LV4 A;  5HTD A;  3BLG A;  1SWK A;  2UYW A;  3KZA A;  5EDB A;  4ZR2 A;  4DCB A;  2Q9S A;  3WJF A;  3WZN A;  2I5Z O;  1VYO A;  3HWF A;  1RXK A;  1OBP A;  1TXL A;  4BX5 B;  3VG2 A;  1FE3 A;  2LKK A;  3EYC A;  4C5P A;  5F6Z A;  4AZP A;  1GT5 A;  3FW4 A;  2HMB A;  4EXZ A;  2QOS C;  3RE6 A;  4GKC A;  1PM1 X;  1G5W A;  3ZW0 B;  4CK4 A;  5LJB A;  4I9R A;  1HBQ A;  3CC2 E;  1AVE A;  1S72 E;  1OEE A;  4QRL A;  3EM0 A;  3RDX A;  1YJW E;  4CDD A;  1Q7Y G;  4GH7 A;  2FS6 A;  3CKF A;  4D6A A;  2O62 A;  1P6P A;  3S5X A;  1SY3 A;  3WXQ A;  4LKT A;  1RAV A;  1SWE A;  3B2I A;  3QQ2 A;  2Q2P A;  3OJY C;  4Z2O A;  1D2U A;  1B56 A;  1UYO X;  3AKM A;  2X45 A;  3BY0 A;  2Y32 A;  1N0S A;  4YFP A;  1KC8 G;  3K3L A;  5BVS A;  1Y52 X;  2X56 A;  4EFG A;  3STK A;  3S60 A;  2F09 A;  5IRU A;  1Q82 G;  3P6F A;  3FIQ A;  4TLJ A;  5H9N A;  3WZQ A;  1QWD A;  1X8N A;  3ELZ A;  2K23 A;  4YKM A;  1ZND A;  1A18 A;  2AT0 X;  1YP7 A;  3CWK A;  3RDS A;  1KT6 A;  2OFR X;  3P6D A;  4BCS A;  2Y3F A;  1EII A;  1SLE B;  5JVG E;  4BGF A;  3Q34 A;  1OPA A;  1UZ2 X;  1PTS A;  5LJE A;  2JU3 A;  3BSZ E;  2IZG B;  2FHN X;  3BS2 A;  2KTS A;  5HZ8 A;  2F01 A;  1SWU A;  4YGH A;  4KH8 A;  1XCA A;  1O1V A;  3SZI A;  2F73 A;  3NR3 A;  2XST A;  4OKA A;  2X34 A;  4HPD A;  1HXZ A;  3RDU A;  4GE1 A;  4MVE A;  5DM6 E;  3OBL A;  1SWF A;  2DM5 A;  4QAE A;  2RQ0 A;  1VQP E;  3CQR A;  1IKE A;  1TOW A;  3MX7 A;  5HZQ A;  4CDF A;  1A57 A;  5EPQ A;  3CKG A;  2LBA A;  4N7C A;  1KXO A;  2R56 A;  5D8J A;  3OE3 A;  4GDZ A;  1DFV A;  3VG4 A;  1FEM A;  1P4P A;  3VG6 A;  1HMS A;  1SLF B;  1O1U A;  3NQ3 A;  3FEP A;  3AUM O;  1SLD B;  3G7X A;  1SRH A;  2YMS A;  2NNQ A;  2CZT A;  4RUU A;  1VQN E;  2JU7 A;  1MK5 A;  4KCA A;  4IRW A;  3KFI A;  2HZR A;  3JSQ A;  1IW2 A;  4OS3 A;  4Y5D A;  3CCV E;  5EZ2 A;  4GNY A;  2KW1 A;  4INN A;  5FQ7 E;  2WEW A;  1CBQ A;  1ML7 A;  4UU2 A;  2WQA E;  3FA9 A;  3CXC E;  1EUO A;  4N7D A;  1QY2 A;  5B5F A;  4ALO A;  3WBG A;  1SRG A;  3ZQ3 A;  3S5V A;  3FLL A;  1T8V A;  2MM3 A;  5DM7 E;  1HQQ A;  1PBY A;  4OS0 A;  1ZNL A;  5GAH G;  1SWL A;  5H8T A;  3WJC A;  3HWD A;  2NND A;  2GH7 A;  1FJ1 E;  1SWO A;  2AT6 X;  2RTN B;  3ZI8 A;  1DZK A;  4A60 A;  4Z28 A;  1VQ9 E;  1E5P A;  2JW1 A;  1SWS A;  3TGB A;  1I4U A;  2RTQ B;  1DZM A;  3L4R A;  3WYP A;  1D3S A;  1W6F A;  3NX2 A;  2AT5 X;  2VFC A;  3I0A A;  3RY1 A;  2ACO A;  3TGA A;  2CM4 A;  2G5L A;  4ODD A;  1SRE A;  4YH0 A;  1EPA A;  3BX8 A;  3FEK A;  1NQN A;  1RST B;  1AB0 A;  1DF8 A;  3AEH A;  4KC7 A;  2RTR B;  3DSZ A;  5D45 A;  2X55 A;  1QQS A;  3VHM A;  4HPB A;  3CCS E;  4FBV A;  1LDQ A;  2PI3 O;  2RTP B;  1JBH A;  1W5R A;  1DZJ A;  4Y0S A;  4XMD A;  1N43 A;  4ZH9 A;  1MVG A;  2AL0 X;  5EDC A;  1RBP A;  1SMP I;  3TGC A;  3I56 E;  1K8A G;  2FS7 A;  4GDA A;  2GTL N;  4BQU A;  1JIW I;  3V8U A;  5FQ8 E;  4O4S A;  1TW4 A;  2RTF B;  3P6E A;  4Y0R A;  5K67 A;  3CCR E;  4NNS A;  3BX7 A;  1Y55 X;  1ZNH A;  5L3Y A;  3WOV A;  4ZHD A;  5DG4 A;  3CCL E;  3ZZV A;  1VWO B;  3HK1 A;  5F1E A;  5C0N A;  4YFR A;  2OTL E;  4U8U N;  3GE2 A;  4O49 A;  4FBR A;  3P6G A;  3FYF A;  5HA0 A;  3CMP A;  3MVF A;  4YGG A;  3CR6 A;  4WF9 E;  1Q86 G;  4CPI A;  1IFC A;  2IFB A;  3VHH A;  1NQM A;  2RTL A;  2JGS A;  4QGW A;  2ZAI A;  1AVD A;  3VG3 A;  1QY0 A;  3EBW A;  4IAB A;  3PH6 A;  2EU7 X;  4TKH A;  4YGZ A;  4FGI B;  4Z6J A;  3RBY A;  4O9S A;  2IZC B;  5K06 A;  1SWA A;  3PQU A;  4U3Q A;  1BBP A;  5CHK A;  1O8V A;  1DV9 A;  1A2D A;  4GK9 A;  4D6B A;  3MM0 A;  2IZE B;  4Z2V A;  3FA7 A;  1YJ9 E;  4U9C A;  3RY2 A;  4LKP A;  1NJI G;  4GU8 A;  4BX6 A;  4GJS A;  5B11 O;  1S2P A;  1EI5 A;  4M7M A;  1VWF B;  1SWB A;  1DF3 A;  2IZH B;  4ZCB A;  1N4J A;  3SZJ A;  1LPJ A;  1Q81 G;  4OS8 A;  4IO9 E;  2HLV A;  3FW5 A;  1X71 A;  4U46 A;  4ORX A;  1NBX A;  3RDQ A;  1FEL A;  2DJG A;  1YWA A;  1NP4 A;  1QY1 A;  2BT9 A;  3WJG A;  4EEJ A;  3NBX X;  1JMZ A;  4PSQ A;  5LJD A;  4ORR A;  1RL6 A;  2CBR A;  2W2B A;  3CBC A;  4NV7 A;  1SXY A;  3WVM A;  1VWM B;  1GT3 A;  2RCT A;  2OFA A;  2RTJ A;  3P02 A;  4CV7 A;  2HYS A;  1BEB A;  3FEN A;  1YIJ E;  5B10 O;  3CD6 E;  1AEL A;  4YMY A;  2QMI A;  1E2T A;  4QGX A;  1SLG B;  3IFB A;  1VQ8 E;  1B0O A;  2L9C A;  1GGL A;  4WFN E;  3FR2 A;  3TZS A;  4LZU A;  5DPQ A;  1ZNE A;  2POA A;  4Y0Q A;  3T1D A;  4WFB E;  5F7G A;  4GGT A;  2A2G A;  1DZP A;  1VWN B;  4NLJ A;  2BS6 A;  1KFF A;  3HOL A;  5FEN A;  1Z24 A;  2FT9 A;  4AZN A;  5GAD G;  2OVA A;  3DTQ A;  4BOE A;  1OPB A;  4I9S A;  1KGL A;  1VWC B;  4A1Y A;  1ZNK A;  1K24 A;  2GTF X;  1HN2 A;  1STR B;  2FHL A;  2IZK A;  4NLI A;  2QO5 A;  5JVH E;  2OVE A;  4WCE E;  1LCZ A;  2VFB A;  1BRP A;  3PPT A;  1G7N A;  1X8Q A;  1N9Y A;  2JN3 A;  3DLL E;  3RE5 A;  1VQL E;  4NYQ A;  1SWD A;  1I78 A;  1ZNG A;  3ZW1 A;  2HNX A;  4AW8 A;  1S44 A;  1LIE A;  3UEV A;  1BM5 A;  5HL7 E;  2RTD B;  1GX3 A;  2AKQ A;  1Y9T A;  2WWP A;  3VG7 A;  2C4I A;  4CSB A;  1ADL A;  1JV4 A;  3KFF A;  5H1S I;  3IA8 A;  1VYF A;  2BS5 A;  5FAZ A;  5HZ9 A;  1R0U A;  1U17 A;  2RTO B;  3CPW E;  2A5B A;  2WQ9 A;  2R73 A;  1PEE A;  3FDC A;  1A3Y A;  5H9A A;  2OL6 O;  3HWG A;  1Y0G A;  3P6C A;  2P8G A;  1BWY A;  3EW2 A;  4WFU A;  1VWH B;  4BX6 B;  4YDB A;  1HQP A;  3CCU E;  1QVG E;  2MWH A;  2I5V O;  2FKG A;  3OW2 E;  1ERX A;  1K9M G;  4UU3 A;  2AF5 A;  1IFB A;  3D9W A;  4IOA E;  5AQ6 A;  2C1Q A;  3WJE A;  5IO5 A;  3EBK A;  1CBR A;  4KII A;  4RUN A;  1JJX A;  3B2H A;  2AMM X;  2ACP X;  1KT5 A;  4I95 A;  3VPJ E;  4ZHF A;  1SY2 A;  5CE4 A;  3T2X A;  1DC9 A;  1I06 A;  2ZJR E;  2FTB A;  5AN9 B;  3N91 A;  5LJH A;  3PDF A;  4AZR A;  1IJ8 A;  2FGS A;  1LIC A;  5LJG A;  1SWH A;  2OY5 O;  3UAQ A;  3TF6 A;  4WFV A;  2ANS A;  4GUZ A;  3JQO A;  2GJ5 A;  2RTB B;  1FDQ A;  3VE2 A;  4TJZ A;  3NQK A;  2QA4 E;  1PBO A;  2RTH B;  4U67 E;  1T68 X;  2KT4 B;  2X4M A;  3B2L A;  1X8U A;  5HBS A;  5LKE A;  5AJC A;  3CF5 E;  1GKA A;  1X89 A;  3G4S E;  3X00 A;  2CAM A;  2RTI B;  3ZUI A;  1VWJ B;  1NDJ A;  1SA8 A;  3FEL A;  1U18 A;  4DQ3 A;  1RSU B;  3T6F A;  4ID2 A;  2CBS A;  3BU1 A;  2WPU A;  4ZGF A;  3T6L A;  1G74 A;  1K3B A;  1SRI A;  1VWG B;  4ON1 A;  2Q39 A;  4YBP A;  2FRS A;  4ZHC A;  1VWQ B;  2IZI A;  5FQ6 E;  1EAL A;  2KD2 A;  1BRQ A;  4WFA E;  3S26 A;  4TKJ A;  1N7Y A;  3D96 A;  3CCQ E;  3H3I A;  1X8O A;  1LCV A;  1JJJ A;  1CBS A;  4AZQ A;  1SWJ A;  4YKO A;  1JQP A;  4UY8 G;  3G71 E;  1VQO E;  2ZSC A;  3RDM A;  2BC3 A;  3CCE E;  2W2F A;  1WUB A;  5BVQ A;  3ZW1 B;  3NP1 A;  5EEE A;  2ZJQ E;  5IXG A;  2X8S A;  1JZU A;  1SWQ A;  2Z4I A;  1N8R G;  2CM9 A;  1QVF E;  1ZRY A;  3J7Z G;  1VQ7 E;  4OMX A;  1VWK B;  4GET A;  4IMN A;  1N9M A;  4GGR A;  4Y59 A;  4EDE A;  3I17 A;  2OL7 A;  2GTL M;  5KIC A;  3VU1 A;  5IO7 A;  1SXW A;  4CPH A;  2E4J A;  1LNM A;  1QAB E;  1OEK A;  2R74 A;  2RTG B;  4M6S A;  1MX7 A;  3HPE A;  4ORS A;  1YI2 E;  5MLC H;  1CBI A;  2MO5 A;  1LFO A;  4IAX A;  1T0V A;  4JNJ A;  4ES7 A;  1RXH A;  4CPE A;  4LZV A;  5IRW A;  4U8U M;  1CJ5 A;  1SXU A;  1SWP A;  2OFM X;  3WZP A;  1STS B;  4YBU A;  4EKV A;  3WZO A;  1SWC A;  2FLJ A;  4BX7 A;  2VDF A;  2IZL B;  1QG5 A;  1PMP A;  2JMB A;  2A5C A;  3SLO A;  3KQ0 A;  5D48 A;  1WBI A;  2HZQ A;  2IZA A;  5B29 A;  1YWC A;  3U03 A;  2LBV A;  2RCQ A;  4XMG A;  3U9P C;  5HWZ A;  1BSQ A;  3GAQ A;  4LQZ A;  3PEC A;  4YVB A;  1RJL C;  1HMR A;  4A8Z A;  1SY0 A;  4MEE A;  4JGL A;  5LKF A;  4OMW A;  4FQB B;  4QGV A;  4NW4 A;  3APV A;  1KL4 A;  1LEL A;  2MJI A;  5H9K A;  4IBA A;  3PQS A;  5HCE C;  4OEM A;  4GD9 A;  2HKD A;  2ALL X;  4ZFX A;  2LB6 A;  1E06 A;  3C76 X;  1SRF A;  2AT8 X;  4BJ8 A;  1GKA B;  1ICN A;  2RD7 C;  4MVI A;  2WEX A;  1OEJ A;  2L67 A;  4IB9 A;  2AT3 X;  4CPF A;  3CCM E;  1JYD A;  5IRA A;  3RSW A;  3LHN A;  1NP1 A;  2IZF B;  1YWB A;  1MX8 A;  3U0D A;  3ELX A;  1H91 A;  3RDO A;  1ERB A;  1MM9 A;  3NAD A;  2A0A A;  4QNI A;  1GM6 A;  3FA6 A;  1YP6 A;  3MG5 A;  1STP A;  2QM9 A;  4EQA C;  3SZH A;  3RKG A;  2JU8 A;  1MOY A;  1VWR B;  3KVN A;  3RWX A;  3FMZ A;  3NX1 A;  4O3Z A;  4GZV A;  1HXL A;  2Q2M A;  1BSY A;  2OL8 O;  4MVK A;  4O4O A;  4WBK A;  2GTL O;  5BYP A;  1OBQ A;  4I3B A;  1VQ4 E;  4R0B A;  3UEW A;  3BU9 A;  4XMF A;  1ICM A;  4GNW A;  2LA7 A;  4ORY A;  4OEL A;  3WYQ A;  3CBS A;  1G85 A;  1FEN A;  1BSO A;  3SOT A;  1SWN A;  2XKL A;  4L1N A;  1LIB A;  1IKJ A;  1K73 G;  4IMO A;  3VHI A;  4KT5 A;  2OY1 O;  1TOU A;  4O3X B;  2CZU A;  3E3C A;  1YHQ E;  2G78 A;  3G6E E;  1LIF A;  3P6H A;  3CCJ E;  4BVM A;  3CMA E;  2JOZ A;  4U8U O;  5KHP A;  2QO6 A;  1I04 A;  2NNE A;  3ZUO A;  1JJ2 E;  4O3Y A;  1B4M A;  3HTY A;  1ACD A;  4CPH B;  1IIU A;  4ZHG A;  2WR6 A;  3C78 X;  1LID A;  4B55 A;  4ZJ0 A;  1QFT A;  1MDC A;  2OFB A;  2Y3E A;  1GT1 A;  5H9L A;  2KTD A;  3PP6 A;  5D4A A;  4MIR A;  5L8I A;  5LJC A;  3NPO A;  1KD1 G;  3I55 E;  3KFH A;  1YUP A;  1URE A;  4KC8 A;  2FR3 A;  2OVS A;  3STM X;  1KT4 A;  3F8A A;  5B3M O;  3ZW2 A;  5B27 A;  4I3C A;  1JYJ A;  1E02 A;  2ZJP E;  1VQ6 E;  3UEU A;  4GRJ A;  4BX7 B;  3HWE A;  1XKI A;  3F6Z B;  2UZ2 A;  3ZWE A;  5F2B A;  1Y53 X;  3VGW A;  4MVL A;  5HCC C;  5HZ6 A;  4YCE A;  1RLB E;  1VQ5 E;  4ALB A;  2K62 A;  3FA8 A;  3D97 A;  1M90 G;  1YIV A;  4GJV A;  4DQ4 A;  1JJU A;  1SWR A;  2X8F A;  1SWT A;  2G79 A;  3APW A;  1SRJ A;  2ZAG A;  1SY1 A;  4I3D A;  3NQ9 A;  1VWB B;  3P24 A;  4I6S A;  5GAE G;  3AKN A;  1LCW A;  3VG5 A;  4QYN A;  3EW1 A;  5HA1 A;  5F6B A;  2NP1 A;  3Q6L A;  3UEX A;  1SWG A;  3APX A;  4CDC A;  1VWE B;  5EED A;  2OVD A;  2Q4N A;  4HWM A;  1OSP O;  2OTJ E;  2Z4H A;  4HPC A;  3FR4 A;  2FKJ A;  4O4X A;  5CSE A;  2OY7 A;  3OD9 A;  3KFG A;  1Y9L A;  3SLT A;  2WSJ A;  2L68 A;  1GT4 A;  1S7D A;  2LFO A;  4NP1 A;  2RTK A;  4IB6 A;  1QFV A;  2MHD A;  2IZJ A;  3QKG A;  4XMH A;  4O3W A;  1EW3 A;  2A8G A;  1FTP A;  3PK2 A;  2IZB A;  2OF9 A;  2RTE B;  1E00 A;  2M4L A;  3O2Y A;  1UYN X;  1LDO A;  2BLG A;  4HFO A;  2X32 A;  4Y0P A;  1ALB A;  4IAW A;  4NYR A;  1MUP A;  1LKE A;  1MEP A;  3O22 A;  4YCH A;  2C1S A;  2DJF A;  4GGZ A;  4NV8 A;  2PY1 A;  1VWI B;  4XMC A;  1VPR A;  3JS1 A; 
#chains in the Genus database with same CATH homology
 5B11 O;  1P4P A;  1RJL C;  2OY1 O;  2OY8 A;  2HKD A;  2OYB O;  3CKF A;  5B2A O;  1FJ1 E;  2G8C O;  1OSP O;  2I5Z O;  2OL7 A;  2I5V O;  3IG9 A;  3AUM O;  5B10 O;  2FKG A;  2FKJ A;  3CKG A;  2OL8 O;  2OY7 A;  2OY5 O;  3IGE A;  2PI3 O;  5B3M O;  2AF5 A;  2OL6 O;  3EC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...