5B11O

A mutation of ospa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSGEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title A mutation of OspA
rcsb
source organism Borrelia burgdorferi (strain atcc 35210 / b31 / cip 102532 / dsm 4680)
molecule tags Membrane protein
total genus 48
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2015-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 5b11O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 5b11O02
2PI3O 2AF5A 2FKJA 2I5ZO 5B10O 2HKDA 2FKGA 5B3MO 2I5VO 1FJ1E 3CKFA 3CKGA 2OY7A 2OL6O 5B2AO 1P4PA 2OY1O 2OYBO 5B11O 2OY5O 3AUMO 2G8CO 2OL7A 3EC5A 1OSPO 2OY8A 2OL8O
chains in the Genus database with same CATH superfamily
3I17A 5F2BA 2RTCB 3FEPA 1U0XA 1SREA 1LFOA 1JBHA 1IW2A 2HZQA 3SZHA 2L5PA 2AKQA 1I78A 2IZLB 3VHIA 3P02A 1BSOA 1RAVA 2CM4A 1JIWI 3FA6A 1HMTA 4EEJA 2GH7A 1VQ6E 4XMFA 4ZGUA 1ML7A 2OVEA 2KD2A 4Y0SA 3MG5A 1YWCA 4ZCBA 3CCJE 3SZJA 3FR5A 3H3IA 5IO5A 1CBSA 5H9NA 2W2AA 3SLJA 1JYJA 3FR4A 1HQQA 4BX5B 1VWBB 1FEMA 1CBQA 5L8OA 4YH0A 1SXYA 1U17A 3GAQA 2AT3X 3V8UA 1HY2A 1SMPI 2LA7A 2M4LA 5FQ8E 1KL4A 4KH8A 1Q81G 2JOZA 1RSUB 4PSQA 1SWFA 1SWOA 2G7BA 1BJ7A 3E3CA 3KFHA 1LKEA 2DJFA 2RTFB 1MX7A 4GGRA 1KGLA 1O1UA 2OFBA 4D6BA 5B5GA 2PY1A 2AT6X 1Q7YG 1IKJA 2MJIA 1EW3A 2AL0X 4MVLA 4ON1A 2JU3A 4GNWA 1U18A 1W5RA 1MOYA 4OS3A 2OZQA 3CCVE 4K19A 1I04A 1N8RG 2W2FA 1QFTA 1VWJB 1N9YA 2MWHA 4U8UM 4ORRA 4CPHA 4KC7A 1X8NA 1E06A 1WBIA 4I95A 1SRIA 1VWLB 3CC2E 4FQBB 1SRJA 3PECA 3MBTA 1TOWA 2DM5A 1OBQA 2X8SA 2RTBB 3WYQA 2A8GA 4CPEA 4Z6JA 2OL6O 5AQ6A 4HPAA 3HOEA 3EW1A 2EU7X 1JJUA 2A3FX 2QO6A 3VE2A 3STMX 5IRAA 1RSTB 1KFFA 3EMMA 1ADLA 4O3YA 1FJ1E 2WPUA 1TOUA 2GTFX 2QM9A 5DM7E 1YJWE 5FQ6E 3B2JA 2AT8X 2OL7A 1FTPA 3KFGA 1VWMB 2QOMA 5HWZA 3CD6E 1Y52X 4QYPA 3FA8A 1GM6A 1RL6A 4WF9E 3F9DA 1A57A 2G5LA 5KHPA 4WHIA 2RTQB 1SWUA 3PP6A 3SLOA 2A2GA 3DLLE 3DSZA 1RXKA 3FIQA 3X00A 3CCRE 3RZYA 3NPOA 5F7GA 1E02A 5HZQA 4IABA 3CPWE 2G78A 1LICA 2AVIA 2HMBA 1LDQA 1EI5A 4WFBE 1VWKB 3PK2A 2OFMX 4GJVA 3CCME 4YGHA 4CSBA 2X8FA 1SWSA 4QQ1A 3RDXA 1X8OA 1VYOA 5L8IA 1MEPA 1GXAA 4YBPA 4ZHHA 4TLJA 4BJ8A 1VWGB 1QQSA 1FENA 4O4XA 3S5VA 5IO7A 3CWKA 1FDQA 5HCCC 4YDBA 4MVKA 1SRGA 2R56A 2AT0X 1RLBE 2WSJA 3KVNA 2OVSA 3WJCA 3LTWA 2IZDB 2Q39A 4GK9A 3BY0A 1Q86G 1IFBA 4WBKA 5LKEA 2CZUA 1LIBA 1PEEA 3ZUOA 2UYWA 2WQ9A 3SZIA 3RDUA 1STRB 2OF8A 2FR3A 4GRJA 1K24A 1GT3A 5HAEA 2BC3A 2IZKA 1VWIB 1IJ8A 5LJEA 4OMXA 4DQ3A 1D2UA 4JGLA 3D95A 1KOIA 2A0AA 2RTRB 4TKHA 3TF6A 4M6SA 2WUTA 4ALOA 1YJ9E 2FT9A 2FHLA 4GGTA 1VWEB 1VQ7E 4GNYA 2L9CA 5FAZA 3RSWA 3PQUA 4CPIA 5L8NA 2OTJE 1RJLC 1IIUA 5EZ2A 2FS6A 1CRBA 2RD7C 4O4SA 4BX6B 4AYHA 4IAWA 4YBUA 1QY0A 4AZOA 4IAXA 4ZJ0A 5HZ5A 3RKGA 2KT4B 3AEHA 3JS1A 3NQKA 4NYRA 4TJZA 4KC8A 4U9CA 4GD9A 2A5CA 1X8PA 3RY2A 2C1SA 2ALLX 1CJ5A 1LDOA 3TGAA 3CCUE 4OMWA 3VE1A 3FEKA 4KT5A 3FELA 2C4IA 3G6EE 3NX1A 4QZTA 4Z28A 3T2WA 5F6ZA 4BCSA 1G74A 4YFPA 4AZRA 3C77X 2CBSA 1ALBA 2Q4NA 1SXUA 4O49A 5AEOA 3RDOA 1SWTA 4MVEA 3B2LA 1GX8A 2LKKA 4XMEA 1SWJA 1B4MA 4QYNA 3KFFA 5D45A 3T6LA 1AVDA 1NQNA 1SA8A 2G79A 2IZGB 1I4UA 1CBIA 4ZHDA 2F73A 1STSB 2F01A 4JNJA 2RTJA 2GC9A 4YFQA 2RCTA 2RTIB 1YWDA 4EKVA 1LPJA 1OPBA 3OE3A 1N0SA 3J7ZG 1A3YA 3EW2A 4ORWA 3UEXA 4IB6A 1K9MG 4GDZA 1D3SA 3C78X 3AUMO 4WCEE 4BGFA 1ZNGA 3TGCA 1MM9A 1HMSA 5LJBA 3FW5A 3CKFA 3OD9A 3CF5E 1ZNEA 3SOTA 1KT5A 5B27A 3WJEA 3U0DA 4R0BA 4TKJA 1DZJA 1SRHA 1SWPA 2AMMX 2ACPX 1VQNE 5KICA 1K3BA 1UZ2X 3KFIA 2K23A 3LHNA 5DPQA 2BHVA 1RXHA 3KZAA 1UREA 3BS2A 3PEDA 5KIDA 1SWLA 3PPTA 3TGBA 3HWGA 3NR3A 4ZFXA 2X46A 4ZGFA 1KT6A 1YIVA 5B3MO 1KQSE 1SXWA 3U9PC 1KT3A 4ML7B 4HPBA 3RBYA 1VWAB 1ZRYA 2X4MA 1K8AG 1T68X 2BS5A 5IRUA 3N91A 1JZUA 1KD1G 1YP6A 4HFOA 2GTLO 5F6BA 4D6AA 2R74A 4YDAA 3ELZA 4YMYA 4NLIA 5D47A 1GGLA 3ZW1A 3CCLE 4ZHGA 2JW1A 4KCAA 4I9SA 4Y59A 1GKAA 3O19A 4TQ2A 1BEBA 3BX7A 1K73G 3APXA 4CPFA 3Q6LA 2FHNX 4I9RA 1VYGA 3P6DA 1VQ5E 1KZWA 4IMOA 1EPAA 4XMGA 1NBXA 2QO4A 2RA6A 3BSZE 1VPRA 4EFGA 4WFNE 2IZCB 2QEXE 4IB9A 3PH6A 4IBAA 4DQ4A 1AB0A 1EIIA 2HZRA 4ODDA 1JMZA 2Y32A 2OFRX 1LNMA 3APUA 3ZQ3A 3RY1A 4RUNA 3S5XA 3FA7A 3S26A 1DFVA 1VQ8E 3NQ3A 4CDEA 1AELA 4AZPA 2BLGA 2QO5A 1VWOB 4ZH9A 3OBLA 1PBOA 1LIFA 4A8ZA 3G4SE 2L68A 1OEJA 5H8TA 3CBSA 1YP7A 1IKEA 1BSYA 1SY2A 4LQZA 1G5WA 2JMBA 1VQME 1GX3A 2ZAGA 2X56A 5F58A 3BLGA 1VQOE 2IZIA 5FQ7E 4Z2OA 4WFAE 4CDDA 1Y55X 4ZHCA 1AVEA 4U67E 3PH5A 5LJDA 1RXJA 1VQPE 1OBPA 3K3LA 4CPHB 1B56A 4YCEA 4GZVA 1E00A 1MDCA 4GDAA 1G85A 2N93A 1DC9A 5HCDC 3FLLA 5BVSA 3VG4A 3ZW2A 3MVFA 2IZHB 2VFCA 1SLEB 2BT9A 2PI3O 1AVGI 3P6HA 1E2TA 3GE2A 1KXOA 1SWAA 1QY2A 2Z4HA 4CK4A 2RTGB 3IG9A 2CM9A 3HK1A 2OVAA 4CDFA 4N7DA 2RCQA 4AZNA 1I05A 1DZKA 3EYCA 4BX7A 2FLJA 5DM6E 1LIDA 4EDEA 4QGWA 1G7NA 4GU8A 4C5PA 4YGGA 2NNEA 2BSZA 2OY1O 3BDRA 2QMIA 3NADA 1EXSA 3SAOA 2RTNB 1W6FA 1UYOX 2G8CO 2MF6A 3ZW0A 2JU8A 3P6CA 3PQSA 4OELA 2F09A 4GUZA 4DCBA 3FW4A 1X89A 3HOLA 3UAQA 1ZNKA 1SWNA 1LIEA 4DNEA 3FA9A 4IB8A 1OEEA 3S60A 2WEWA 2NP1A 1QG5A 2RTLA 4OEMA 2LBVA 3QKGA 3VG7A 2VDFA 3IA8A 4GH7A 3WZOA 1B0OA 3BU9A 1DZMA 1JJXA 1KZXA 1HBPA 3RE5A 2CZTA 1DZPA 2Q2MA 2CAMA 4YVBA 3P6GA 2FS7A 4INNA 1VQ4E 5AJBA 4TNNA 2AF5A 5CE4A 3VHMA 3HPEA 1QABE 3I56E 2FTBA 4HWMA 1L6MA 5HCEC 4M7MA 3ZZVA 4Z2PA 1GX9A 3P6FA 1YWAA 2XSTA 1ERBA 3WVMA 2FRSA 5IRWA 1OSPO 5EDBA 4PJ2A 1BBPA 1N4JA 3FYFA 5HA1A 1EALA 1QFVA 5LJGA 3CC7E 3I0AA 5EEEA 1X71A 4JO6A 5JVHE 4I3BA 1KC8G 5GADG 3SLTA 4HPDA 3UEUA 3CMAE 3ZW0B 3OJYC 1ERXA 4YGZA 2AH7X 4GGZA 1ICMA 3WYPA 2RTMA 4ORSA 1KQXA 5CHKA 4IRWA 3VG3A 1DF8A 3MM0A 1HXLA 1STPA 1YJNE 2X8TA 3WJFA 4I3CA 4OS8A 1A18A 1WUBA 5CYBA 2RN4A 2A13A 4FBOA 1NGLA 2KW1A 4FGIB 3RDQA 5CSEA 5C0NA 2AT5X 1Y9TA 4O4OA 1N7YA 1LF7A 1VWPB 5L3YA 4Y0RA 3WJDA 3PIPE 1YHQE 1YWBA 3DTQA 2FKJA 4I3DA 2HLVA 1HBQA 4Z27A 2RTHB 3CKGA 1P4PA 4A1YA 1KL3A 3BU1A 2HNXA 2IFBA 1NQMA 1VYFA 1IFCA 2RTOB 2OTLE 3PIOE 4UU2A 1LELA 3ELXA 2ASNX 1NC9A 4AW8A 2KTDA 2POAA 1EUOA 1I06A 2YMSA 4BX5A 4WFVA 1S72E 3ZI8A 4QRLA 4MVIA 4ALBA 4L3RA 4GETA 3FDCA 3WZQA 3CQRA 2OFAA 1BSQA 1SRFA 4U8UO 5BYPA 1X8QA 1ZNHA 4HPCA 1DV9A 1LCZA 4NLJA 3Q34A 4B55A 1EQDA 1O8VA 5HZ8A 2KTSA 2FR2A 5AJCA 2HYSA 2LFOA 2ZJRE 5F1EA 2VFBA 1NP1A 1GT1A 1SY0A 2ZJPE 3WOVA 5HZ9A 2X34A 4ORXA 2GTLN 3NBXX 1SY3A 3QQ2A 3P6EA 4IOCE 4RUUA 2FKGA 4YCHA 1W4TA 2OY7A 3LV4A 3VU1A 4CDCA 1SWKA 5GAEG 4UU3A 2GJ5A 4IO9E 3APWA 1N43A 4ZHFA 4A60A 3EC5A 4YKOA 4MISA 1VWHB 4COTA 1VQKE 2JGSA 3O22A 1Y0GA 1EPBA 3B2IA 4BBOA 3HTYA 2RTDB 5B11O 1MX8A 2ACOA 4NYQA 1SWDA 2K62A 2WR6A 5IXGA 1S44A 2IZFB 4MEEA 2ZJQE 2BS6A 2LB6A 2RTPB 2IZAA 1JV4A 2OY5O 2WQAE 1TW4A 5JD2A 3VHHA 4NV8A 1JJ2E 1JMXA 1GT4A 4KIIA 3BRNA 5HL7E 3IFBA 1SLFB 4O9SA 3IGEA 2C1QA 5HA0A 1NP4A 2Y3EA 4AZMA 5JR8A 1SLGB 5LKFA 3RDSA 2A2UA 2OL8O 3F6ZB 2HKDA 3D97A 1YI2E 4U46A 5B2AO 3VGWA 2ZAIA 4JHQA 1KT7A 1ZNDA 3EBWA 1CBRA 1O1VA 1VWFB 1B8EA 1PMPA 2L67A 1FELA 2R73A 4Y0QA 2NNQA 1VWRB 4TKBA 1VQLE 1Q82G 4QGVA 5MLCH 1FE3A 1SXXA 2RTEB 2LBAA 1BM5A 3WXQA 5D8JA 3B2KA 1VQ9E 1MVGA 2IZEB 3U03A 3BX8A 2Q9SA 1ACDA 1S7DA 1HN2A 4ZH6A 5DG4A 4XMDA 4GKCA 3ZW1B 5EDCA 3CC4E 2MO5A 5IO6A 3STNA 1GKAB 1SWQA 2NNDA 5LJHA 3WJGA 3JSQA 3AKNA 4EXZA 4O3ZA 5K06A 2RTKA 1QVGE 1YIJE 3FMZA 1VWQB 3AKMA 5H9LA 3WZNA 2X32A 2GTLM 5K68A 5D4AA 1DF3A 5AN9B 3I55E 2MM3A 1SWEA 2OYBO 5HTEA 1EIOA 1VWCB 2X45A 1BWYA 1PTSA 4GE1A 1OPAA 3G71E 3L4RA 1SWRA 2ANSA 2IZBA 3FIDA 1MUPA 4EQAC 5LJKA 3CR6A 1Y9LA 3CQNA 1R0UA 1BRQA 1NDJA 3VG5A 2X55A 4ID2A 1W2BE 1QVFE 3CMEE 3P24A 3EM0A 1HMRA 1KQWA 2WWPA 1SWGA 4UY8G 4AZQA 5FFHA 3T2XA 1ZNLA 4O4UA 3HWEA 2O62A 4NV7A 4NNTA 2CQLA 1OEKA 4BX6A 5HZ6A 3NX2A 3HWFA 4QGXA 4NP1A 3FR2A 4QAEA 4A1HA 3APVA 1TXLA 1P6PA 5D48A 4LZVA 2WEXA 5HTDA 1S2PA 4XMHA 5BVQA 3O2YA 4O3XB 1T8VA 4BOEA 2Q2PA 4CV7A 3CCSE 1YUPA 4U3QA 1VWNB 2MHDA 1I9HA 2OY8A 3WJBA 1SWHA 4I6SA 2Z4IA 3CMPA 2CBRA 4O3WA 2W2BA 4IB7A 3CXCE 1H91A 3T1DA 2UZ2A 3D96A 4Y0PA 4OKAA 2OVDA 2A5BA 4IMNA 3CCQE 5H9KA 3UEWA 1LCVA 4BX7B 4FBVA 1LCWA 4Y5DA 2FGSA 1OBUA 3HWDA 4BQUA 1KT4A 1BLRA 1PBYA 1QWDA 3NQ9A 1HXZA 1ICNA 2IZJA 1YITE 2XKLA 1N9MA 4WFUA 4Z2VA 3RWXA 3CCEE 1TVQA 2I5ZO 1XKIA 3C76X 5B29A 1GT5A 3F8AA 2ZSCA 3VG2A 5H1SI 1SY1A 2JU7A 3B2HA 3STKA 3ZWEA 5EEDA 5FENA 4NNSA 3RDMA 1SLDB 1JJJA 4ARHA 5H9AA 1AQBA 5GAGG 1JYDA 3D9WA 3WBGA 1UYNX 4YKMA 5K67A 3ZUIA 3EBKA 3TZSA 1M1KG 3UEVA 4NW4A 3MX7A 1HQPA 4I60A 4IOAE 5BVTA 2QCBA 1M90G 5EPQA 1QY1A 1JQPA 2Y3FA 1Y53X 1SWCA 5B10O 4ZR2A 4U8UN 1Z24A 2I5VO 4XMCA 3WZPA 3OW2E 2RTAA 4ORUA 1T0VA 4LKTA 4LKPA 3CBCA 4QZUA 4BVMA 3PDFA 2E4JA 1X8UA 3D4RA 4FBRA 2QOSC 1XCAA 4GJSA 1SWBA 1A2DA 5HBSA 5B5FA 4OS0A 3RE6A 2JN3A 3VG6A 2QA4E 4ES7A 2DJGA 1VWDB 4LZUA 4ORYA 3T6FA 1PM1X 3G7XA 1KL5A 3FENA 4YFRA 1E5PA 3NP1A 2OF9A 1RBPA 3JQOA 4L1NA 4MIRA 3KQ0A 2FWVA 3VPJE 2RQ0A 2YG2A 4QNIA 1LUQA 2P8GA 5JVGE 1NJIG 1MK5A 1BRPA 4N7CA 5LJCA 5GAHG
chains in the Genus database with same CATH topology
2PI3O 2AF5A 2FKJA 2I5ZO 5B10O 2HKDA 2FKGA 5B3MO 2I5VO 1FJ1E 3CKFA 3CKGA 2OY7A 2OL6O 5B2AO 1P4PA 3IG9A 2OY1O 2OYBO 3IGEA 5B11O 1RJLC 2OY5O 3AUMO 2G8CO 2OL7A 3EC5A 1OSPO 2OY8A 2OL8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI3 O;  2AF5 A;  2FKJ A;  2I5Z O;  5B10 O;  2HKD A;  2FKG A;  5B3M O;  2I5V O;  1FJ1 E;  3CKF A;  3CKG A;  2OY7 A;  2OL6 O;  5B2A O;  1P4P A;  2OY1 O;  2OYB O;  5B11 O;  2OY5 O;  3AUM O;  2G8C O;  2OL7 A;  3EC5 A;  1OSP O;  2OY8 A;  2OL8 O; 
#chains in the Genus database with same CATH topology
 3I17 A;  5F2B A;  2RTC B;  3FEP A;  1U0X A;  1SRE A;  1LFO A;  1JBH A;  1IW2 A;  2HZQ A;  3SZH A;  2L5P A;  2AKQ A;  1I78 A;  2IZL B;  3VHI A;  3P02 A;  1BSO A;  1RAV A;  2CM4 A;  1JIW I;  3FA6 A;  1HMT A;  4EEJ A;  2GH7 A;  1VQ6 E;  4XMF A;  4ZGU A;  1ML7 A;  2OVE A;  2KD2 A;  4Y0S A;  3MG5 A;  1YWC A;  4ZCB A;  3CCJ E;  3SZJ A;  3FR5 A;  3H3I A;  5IO5 A;  1CBS A;  5H9N A;  2W2A A;  3SLJ A;  1JYJ A;  3FR4 A;  1HQQ A;  4BX5 B;  1VWB B;  1FEM A;  1CBQ A;  5L8O A;  4YH0 A;  1SXY A;  1U17 A;  3GAQ A;  2AT3 X;  3V8U A;  1HY2 A;  1SMP I;  2LA7 A;  2M4L A;  5FQ8 E;  1KL4 A;  4KH8 A;  1Q81 G;  2JOZ A;  1RSU B;  4PSQ A;  1SWF A;  1SWO A;  2G7B A;  1BJ7 A;  3E3C A;  3KFH A;  1LKE A;  2DJF A;  2RTF B;  1MX7 A;  4GGR A;  1KGL A;  1O1U A;  2OFB A;  4D6B A;  5B5G A;  2PY1 A;  2AT6 X;  1Q7Y G;  1IKJ A;  2MJI A;  1EW3 A;  2AL0 X;  4MVL A;  4ON1 A;  2JU3 A;  4GNW A;  1U18 A;  1W5R A;  1MOY A;  4OS3 A;  2OZQ A;  3CCV E;  4K19 A;  1I04 A;  1N8R G;  2W2F A;  1QFT A;  1VWJ B;  1N9Y A;  2MWH A;  4U8U M;  4ORR A;  4CPH A;  4KC7 A;  1X8N A;  1E06 A;  1WBI A;  4I95 A;  1SRI A;  1VWL B;  3CC2 E;  4FQB B;  1SRJ A;  3PEC A;  3MBT A;  1TOW A;  2DM5 A;  1OBQ A;  2X8S A;  2RTB B;  3WYQ A;  2A8G A;  4CPE A;  4Z6J A;  2OL6 O;  5AQ6 A;  4HPA A;  3HOE A;  3EW1 A;  2EU7 X;  1JJU A;  2A3F X;  2QO6 A;  3VE2 A;  3STM X;  5IRA A;  1RST B;  1KFF A;  3EMM A;  1ADL A;  4O3Y A;  1FJ1 E;  2WPU A;  1TOU A;  2GTF X;  2QM9 A;  5DM7 E;  1YJW E;  5FQ6 E;  3B2J A;  2AT8 X;  2OL7 A;  1FTP A;  3KFG A;  1VWM B;  2QOM A;  5HWZ A;  3CD6 E;  1Y52 X;  4QYP A;  3FA8 A;  1GM6 A;  1RL6 A;  4WF9 E;  3F9D A;  1A57 A;  2G5L A;  5KHP A;  4WHI A;  2RTQ B;  1SWU A;  3PP6 A;  3SLO A;  2A2G A;  3DLL E;  3DSZ A;  1RXK A;  3FIQ A;  3X00 A;  3CCR E;  3RZY A;  3NPO A;  5F7G A;  1E02 A;  5HZQ A;  4IAB A;  3CPW E;  2G78 A;  1LIC A;  2AVI A;  2HMB A;  1LDQ A;  1EI5 A;  4WFB E;  1VWK B;  3PK2 A;  2OFM X;  4GJV A;  3CCM E;  4YGH A;  4CSB A;  2X8F A;  1SWS A;  4QQ1 A;  3RDX A;  1X8O A;  1VYO A;  5L8I A;  1MEP A;  1GXA A;  4YBP A;  4ZHH A;  4TLJ A;  4BJ8 A;  1VWG B;  1QQS A;  1FEN A;  4O4X A;  3S5V A;  5IO7 A;  3CWK A;  1FDQ A;  5HCC C;  4YDB A;  4MVK A;  1SRG A;  2R56 A;  2AT0 X;  1RLB E;  2WSJ A;  3KVN A;  2OVS A;  3WJC A;  3LTW A;  2IZD B;  2Q39 A;  4GK9 A;  3BY0 A;  1Q86 G;  1IFB A;  4WBK A;  5LKE A;  2CZU A;  1LIB A;  1PEE A;  3ZUO A;  2UYW A;  2WQ9 A;  3SZI A;  3RDU A;  1STR B;  2OF8 A;  2FR3 A;  4GRJ A;  1K24 A;  1GT3 A;  5HAE A;  2BC3 A;  2IZK A;  1VWI B;  1IJ8 A;  5LJE A;  4OMX A;  4DQ3 A;  1D2U A;  4JGL A;  3D95 A;  1KOI A;  2A0A A;  2RTR B;  4TKH A;  3TF6 A;  4M6S A;  2WUT A;  4ALO A;  1YJ9 E;  2FT9 A;  2FHL A;  4GGT A;  1VWE B;  1VQ7 E;  4GNY A;  2L9C A;  5FAZ A;  3RSW A;  3PQU A;  4CPI A;  5L8N A;  2OTJ E;  1RJL C;  1IIU A;  5EZ2 A;  2FS6 A;  1CRB A;  2RD7 C;  4O4S A;  4BX6 B;  4AYH A;  4IAW A;  4YBU A;  1QY0 A;  4AZO A;  4IAX A;  4ZJ0 A;  5HZ5 A;  3RKG A;  2KT4 B;  3AEH A;  3JS1 A;  3NQK A;  4NYR A;  4TJZ A;  4KC8 A;  4U9C A;  4GD9 A;  2A5C A;  1X8P A;  3RY2 A;  2C1S A;  2ALL X;  1CJ5 A;  1LDO A;  3TGA A;  3CCU E;  4OMW A;  3VE1 A;  3FEK A;  4KT5 A;  3FEL A;  2C4I A;  3G6E E;  3NX1 A;  4QZT A;  4Z28 A;  3T2W A;  5F6Z A;  4BCS A;  1G74 A;  4YFP A;  4AZR A;  3C77 X;  2CBS A;  1ALB A;  2Q4N A;  1SXU A;  4O49 A;  5AEO A;  3RDO A;  1SWT A;  4MVE A;  3B2L A;  1GX8 A;  2LKK A;  4XME A;  1SWJ A;  1B4M A;  4QYN A;  3KFF A;  5D45 A;  3T6L A;  1AVD A;  1NQN A;  1SA8 A;  2G79 A;  2IZG B;  1I4U A;  1CBI A;  4ZHD A;  2F73 A;  1STS B;  2F01 A;  4JNJ A;  2RTJ A;  2GC9 A;  4YFQ A;  2RCT A;  2RTI B;  1YWD A;  4EKV A;  1LPJ A;  1OPB A;  3OE3 A;  1N0S A;  3J7Z G;  1A3Y A;  3EW2 A;  4ORW A;  3UEX A;  4IB6 A;  1K9M G;  4GDZ A;  1D3S A;  3C78 X;  3AUM O;  4WCE E;  4BGF A;  1ZNG A;  3TGC A;  1MM9 A;  1HMS A;  5LJB A;  3FW5 A;  3CKF A;  3OD9 A;  3CF5 E;  1ZNE A;  3SOT A;  1KT5 A;  5B27 A;  3WJE A;  3U0D A;  4R0B A;  4TKJ A;  1DZJ A;  1SRH A;  1SWP A;  2AMM X;  2ACP X;  1VQN E;  5KIC A;  1K3B A;  1UZ2 X;  3KFI A;  2K23 A;  3LHN A;  5DPQ A;  2BHV A;  1RXH A;  3KZA A;  1URE A;  3BS2 A;  3PED A;  5KID A;  1SWL A;  3PPT A;  3TGB A;  3HWG A;  3NR3 A;  4ZFX A;  2X46 A;  4ZGF A;  1KT6 A;  1YIV A;  5B3M O;  1KQS E;  1SXW A;  3U9P C;  1KT3 A;  4ML7 B;  4HPB A;  3RBY A;  1VWA B;  1ZRY A;  2X4M A;  1K8A G;  1T68 X;  2BS5 A;  5IRU A;  3N91 A;  1JZU A;  1KD1 G;  1YP6 A;  4HFO A;  2GTL O;  5F6B A;  4D6A A;  2R74 A;  4YDA A;  3ELZ A;  4YMY A;  4NLI A;  5D47 A;  1GGL A;  3ZW1 A;  3CCL E;  4ZHG A;  2JW1 A;  4KCA A;  4I9S A;  4Y59 A;  1GKA A;  3O19 A;  4TQ2 A;  1BEB A;  3BX7 A;  1K73 G;  3APX A;  4CPF A;  3Q6L A;  2FHN X;  4I9R A;  1VYG A;  3P6D A;  1VQ5 E;  1KZW A;  4IMO A;  1EPA A;  4XMG A;  1NBX A;  2QO4 A;  2RA6 A;  3BSZ E;  1VPR A;  4EFG A;  4WFN E;  2IZC B;  2QEX E;  4IB9 A;  3PH6 A;  4IBA A;  4DQ4 A;  1AB0 A;  1EII A;  2HZR A;  4ODD A;  1JMZ A;  2Y32 A;  2OFR X;  1LNM A;  3APU A;  3ZQ3 A;  3RY1 A;  4RUN A;  3S5X A;  3FA7 A;  3S26 A;  1DFV A;  1VQ8 E;  3NQ3 A;  4CDE A;  1AEL A;  4AZP A;  2BLG A;  2QO5 A;  1VWO B;  4ZH9 A;  3OBL A;  1PBO A;  1LIF A;  4A8Z A;  3G4S E;  2L68 A;  1OEJ A;  5H8T A;  3CBS A;  1YP7 A;  1IKE A;  1BSY A;  1SY2 A;  4LQZ A;  1G5W A;  2JMB A;  1VQM E;  1GX3 A;  2ZAG A;  2X56 A;  5F58 A;  3BLG A;  1VQO E;  2IZI A;  5FQ7 E;  4Z2O A;  4WFA E;  4CDD A;  1Y55 X;  4ZHC A;  1AVE A;  4U67 E;  3PH5 A;  5LJD A;  1RXJ A;  1VQP E;  1OBP A;  3K3L A;  4CPH B;  1B56 A;  4YCE A;  4GZV A;  1E00 A;  1MDC A;  4GDA A;  1G85 A;  2N93 A;  1DC9 A;  5HCD C;  3FLL A;  5BVS A;  3VG4 A;  3ZW2 A;  3MVF A;  2IZH B;  2VFC A;  1SLE B;  2BT9 A;  2PI3 O;  1AVG I;  3P6H A;  1E2T A;  3GE2 A;  1KXO A;  1SWA A;  1QY2 A;  2Z4H A;  4CK4 A;  2RTG B;  3IG9 A;  2CM9 A;  3HK1 A;  2OVA A;  4CDF A;  4N7D A;  2RCQ A;  4AZN A;  1I05 A;  1DZK A;  3EYC A;  4BX7 A;  2FLJ A;  5DM6 E;  1LID A;  4EDE A;  4QGW A;  1G7N A;  4GU8 A;  4C5P A;  4YGG A;  2NNE A;  2BSZ A;  2OY1 O;  3BDR A;  2QMI A;  3NAD A;  1EXS A;  3SAO A;  2RTN B;  1W6F A;  1UYO X;  2G8C O;  2MF6 A;  3ZW0 A;  2JU8 A;  3P6C A;  3PQS A;  4OEL A;  2F09 A;  4GUZ A;  4DCB A;  3FW4 A;  1X89 A;  3HOL A;  3UAQ A;  1ZNK A;  1SWN A;  1LIE A;  4DNE A;  3FA9 A;  4IB8 A;  1OEE A;  3S60 A;  2WEW A;  2NP1 A;  1QG5 A;  2RTL A;  4OEM A;  2LBV A;  3QKG A;  3VG7 A;  2VDF A;  3IA8 A;  4GH7 A;  3WZO A;  1B0O A;  3BU9 A;  1DZM A;  1JJX A;  1KZX A;  1HBP A;  3RE5 A;  2CZT A;  1DZP A;  2Q2M A;  2CAM A;  4YVB A;  3P6G A;  2FS7 A;  4INN A;  1VQ4 E;  5AJB A;  4TNN A;  2AF5 A;  5CE4 A;  3VHM A;  3HPE A;  1QAB E;  3I56 E;  2FTB A;  4HWM A;  1L6M A;  5HCE C;  4M7M A;  3ZZV A;  4Z2P A;  1GX9 A;  3P6F A;  1YWA A;  2XST A;  1ERB A;  3WVM A;  2FRS A;  5IRW A;  1OSP O;  5EDB A;  4PJ2 A;  1BBP A;  1N4J A;  3FYF A;  5HA1 A;  1EAL A;  1QFV A;  5LJG A;  3CC7 E;  3I0A A;  5EEE A;  1X71 A;  4JO6 A;  5JVH E;  4I3B A;  1KC8 G;  5GAD G;  3SLT A;  4HPD A;  3UEU A;  3CMA E;  3ZW0 B;  3OJY C;  1ERX A;  4YGZ A;  2AH7 X;  4GGZ A;  1ICM A;  3WYP A;  2RTM A;  4ORS A;  1KQX A;  5CHK A;  4IRW A;  3VG3 A;  1DF8 A;  3MM0 A;  1HXL A;  1STP A;  1YJN E;  2X8T A;  3WJF A;  4I3C A;  4OS8 A;  1A18 A;  1WUB A;  5CYB A;  2RN4 A;  2A13 A;  4FBO A;  1NGL A;  2KW1 A;  4FGI B;  3RDQ A;  5CSE A;  5C0N A;  2AT5 X;  1Y9T A;  4O4O A;  1N7Y A;  1LF7 A;  1VWP B;  5L3Y A;  4Y0R A;  3WJD A;  3PIP E;  1YHQ E;  1YWB A;  3DTQ A;  2FKJ A;  4I3D A;  2HLV A;  1HBQ A;  4Z27 A;  2RTH B;  3CKG A;  1P4P A;  4A1Y A;  1KL3 A;  3BU1 A;  2HNX A;  2IFB A;  1NQM A;  1VYF A;  1IFC A;  2RTO B;  2OTL E;  3PIO E;  4UU2 A;  1LEL A;  3ELX A;  2ASN X;  1NC9 A;  4AW8 A;  2KTD A;  2POA A;  1EUO A;  1I06 A;  2YMS A;  4BX5 A;  4WFV A;  1S72 E;  3ZI8 A;  4QRL A;  4MVI A;  4ALB A;  4L3R A;  4GET A;  3FDC A;  3WZQ A;  3CQR A;  2OFA A;  1BSQ A;  1SRF A;  4U8U O;  5BYP A;  1X8Q A;  1ZNH A;  4HPC A;  1DV9 A;  1LCZ A;  4NLJ A;  3Q34 A;  4B55 A;  1EQD A;  1O8V A;  5HZ8 A;  2KTS A;  2FR2 A;  5AJC A;  2HYS A;  2LFO A;  2ZJR E;  5F1E A;  2VFB A;  1NP1 A;  1GT1 A;  1SY0 A;  2ZJP E;  3WOV A;  5HZ9 A;  2X34 A;  4ORX A;  2GTL N;  3NBX X;  1SY3 A;  3QQ2 A;  3P6E A;  4IOC E;  4RUU A;  2FKG A;  4YCH A;  1W4T A;  2OY7 A;  3LV4 A;  3VU1 A;  4CDC A;  1SWK A;  5GAE G;  4UU3 A;  2GJ5 A;  4IO9 E;  3APW A;  1N43 A;  4ZHF A;  4A60 A;  3EC5 A;  4YKO A;  4MIS A;  1VWH B;  4COT A;  1VQK E;  2JGS A;  3O22 A;  1Y0G A;  1EPB A;  3B2I A;  4BBO A;  3HTY A;  2RTD B;  5B11 O;  1MX8 A;  2ACO A;  4NYQ A;  1SWD A;  2K62 A;  2WR6 A;  5IXG A;  1S44 A;  2IZF B;  4MEE A;  2ZJQ E;  2BS6 A;  2LB6 A;  2RTP B;  2IZA A;  1JV4 A;  2OY5 O;  2WQA E;  1TW4 A;  5JD2 A;  3VHH A;  4NV8 A;  1JJ2 E;  1JMX A;  1GT4 A;  4KII A;  3BRN A;  5HL7 E;  3IFB A;  1SLF B;  4O9S A;  3IGE A;  2C1Q A;  5HA0 A;  1NP4 A;  2Y3E A;  4AZM A;  5JR8 A;  1SLG B;  5LKF A;  3RDS A;  2A2U A;  2OL8 O;  3F6Z B;  2HKD A;  3D97 A;  1YI2 E;  4U46 A;  5B2A O;  3VGW A;  2ZAI A;  4JHQ A;  1KT7 A;  1ZND A;  3EBW A;  1CBR A;  1O1V A;  1VWF B;  1B8E A;  1PMP A;  2L67 A;  1FEL A;  2R73 A;  4Y0Q A;  2NNQ A;  1VWR B;  4TKB A;  1VQL E;  1Q82 G;  4QGV A;  5MLC H;  1FE3 A;  1SXX A;  2RTE B;  2LBA A;  1BM5 A;  3WXQ A;  5D8J A;  3B2K A;  1VQ9 E;  1MVG A;  2IZE B;  3U03 A;  3BX8 A;  2Q9S A;  1ACD A;  1S7D A;  1HN2 A;  4ZH6 A;  5DG4 A;  4XMD A;  4GKC A;  3ZW1 B;  5EDC A;  3CC4 E;  2MO5 A;  5IO6 A;  3STN A;  1GKA B;  1SWQ A;  2NND A;  5LJH A;  3WJG A;  3JSQ A;  3AKN A;  4EXZ A;  4O3Z A;  5K06 A;  2RTK A;  1QVG E;  1YIJ E;  3FMZ A;  1VWQ B;  3AKM A;  5H9L A;  3WZN A;  2X32 A;  2GTL M;  5K68 A;  5D4A A;  1DF3 A;  5AN9 B;  3I55 E;  2MM3 A;  1SWE A;  2OYB O;  5HTE A;  1EIO A;  1VWC B;  2X45 A;  1BWY A;  1PTS A;  4GE1 A;  1OPA A;  3G71 E;  3L4R A;  1SWR A;  2ANS A;  2IZB A;  3FID A;  1MUP A;  4EQA C;  5LJK A;  3CR6 A;  1Y9L A;  3CQN A;  1R0U A;  1BRQ A;  1NDJ A;  3VG5 A;  2X55 A;  4ID2 A;  1W2B E;  1QVF E;  3CME E;  3P24 A;  3EM0 A;  1HMR A;  1KQW A;  2WWP A;  1SWG A;  4UY8 G;  4AZQ A;  5FFH A;  3T2X A;  1ZNL A;  4O4U A;  3HWE A;  2O62 A;  4NV7 A;  4NNT A;  2CQL A;  1OEK A;  4BX6 A;  5HZ6 A;  3NX2 A;  3HWF A;  4QGX A;  4NP1 A;  3FR2 A;  4QAE A;  4A1H A;  3APV A;  1TXL A;  1P6P A;  5D48 A;  4LZV A;  2WEX A;  5HTD A;  1S2P A;  4XMH A;  5BVQ A;  3O2Y A;  4O3X B;  1T8V A;  4BOE A;  2Q2P A;  4CV7 A;  3CCS E;  1YUP A;  4U3Q A;  1VWN B;  2MHD A;  1I9H A;  2OY8 A;  3WJB A;  1SWH A;  4I6S A;  2Z4I A;  3CMP A;  2CBR A;  4O3W A;  2W2B A;  4IB7 A;  3CXC E;  1H91 A;  3T1D A;  2UZ2 A;  3D96 A;  4Y0P A;  4OKA A;  2OVD A;  2A5B A;  4IMN A;  3CCQ E;  5H9K A;  3UEW A;  1LCV A;  4BX7 B;  4FBV A;  1LCW A;  4Y5D A;  2FGS A;  1OBU A;  3HWD A;  4BQU A;  1KT4 A;  1BLR A;  1PBY A;  1QWD A;  3NQ9 A;  1HXZ A;  1ICN A;  2IZJ A;  1YIT E;  2XKL A;  1N9M A;  4WFU A;  4Z2V A;  3RWX A;  3CCE E;  1TVQ A;  2I5Z O;  1XKI A;  3C76 X;  5B29 A;  1GT5 A;  3F8A A;  2ZSC A;  3VG2 A;  5H1S I;  1SY1 A;  2JU7 A;  3B2H A;  3STK A;  3ZWE A;  5EED A;  5FEN A;  4NNS A;  3RDM A;  1SLD B;  1JJJ A;  4ARH A;  5H9A A;  1AQB A;  5GAG G;  1JYD A;  3D9W A;  3WBG A;  1UYN X;  4YKM A;  5K67 A;  3ZUI A;  3EBK A;  3TZS A;  1M1K G;  3UEV A;  4NW4 A;  3MX7 A;  1HQP A;  4I60 A;  4IOA E;  5BVT A;  2QCB A;  1M90 G;  5EPQ A;  1QY1 A;  1JQP A;  2Y3F A;  1Y53 X;  1SWC A;  5B10 O;  4ZR2 A;  4U8U N;  1Z24 A;  2I5V O;  4XMC A;  3WZP A;  3OW2 E;  2RTA A;  4ORU A;  1T0V A;  4LKT A;  4LKP A;  3CBC A;  4QZU A;  4BVM A;  3PDF A;  2E4J A;  1X8U A;  3D4R A;  4FBR A;  2QOS C;  1XCA A;  4GJS A;  1SWB A;  1A2D A;  5HBS A;  5B5F A;  4OS0 A;  3RE6 A;  2JN3 A;  3VG6 A;  2QA4 E;  4ES7 A;  2DJG A;  1VWD B;  4LZU A;  4ORY A;  3T6F A;  1PM1 X;  3G7X A;  1KL5 A;  3FEN A;  4YFR A;  1E5P A;  3NP1 A;  2OF9 A;  1RBP A;  3JQO A;  4L1N A;  4MIR A;  3KQ0 A;  2FWV A;  3VPJ E;  2RQ0 A;  2YG2 A;  4QNI A;  1LUQ A;  2P8G A;  5JVG E;  1NJI G;  1MK5 A;  1BRP A;  4N7C A;  5LJC A;  5GAH G; 
#chains in the Genus database with same CATH homology
 2PI3 O;  2AF5 A;  2FKJ A;  2I5Z O;  5B10 O;  2HKD A;  2FKG A;  5B3M O;  2I5V O;  1FJ1 E;  3CKF A;  3CKG A;  2OY7 A;  2OL6 O;  5B2A O;  1P4P A;  3IG9 A;  2OY1 O;  2OYB O;  3IGE A;  5B11 O;  1RJL C;  2OY5 O;  3AUM O;  2G8C O;  2OL7 A;  3EC5 A;  1OSP O;  2OY8 A;  2OL8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...