5B1HA

Crystal structure of cystathionine beta-synthase from lactobacillus plantarum
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
302
Chain Sequence
b'MLIQHVQELIGHTPLMALPIEVPNHSHIYAKLEMFNPGGSIDRLGAYLIEDGLQRGRVNAKTTIIEPTAGNTGIGLALATQAHHLRTILVVPEKFSMEKQVLMQALGAEIVHTPSEEGIKGAIRKAEALAATISNSYVPMQFKNPANPAAYYHTLAPEILADMPAPITAFVAGAGSGGTFAGVAAYLQAQDSATKAVVVEPEGSILNGGPAHAHRTEGIGVEFIPPFFDQVRIDQTLTIADNDAFAQVRHLARDHGLLIGSSSGAALAASLQLATNLPANSHIVTIFPDSSERYLSQKIYTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystathionine beta-synthase
publication title Crystallographic and mutational analyses of cystathionine beta-synthase in the H2 S-synthetic gene cluster in Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Lyase
total genus 108
structure length 302
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b1hA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b1hA02
2JC3A 3IAUA 3DWGA 4D9BA 1OASA 1WKVA 2CLHB 2GN0A 3FGPA 5D85A 4AECA 5B3AA 2ZR8A 3V7NA 4D9MA 2ZPUA 2D1FA 4HT3B 1CX9B 2GN1A 5D86A 5T6MA 3SS9X 1F2DA 1TTPB 3PC2A 1V71A 5B55A 1V8ZA 4IL5A 1RQXA 2TYSB 1A5BB 1TTQB 4Y6GB 5DBEX 5DW3A 1K7EB 3VBEA 5CVCA 4D9KA 1J0CA 1Z7YA 3VSDA 2DH6A 4D9IA 4L27A 2TRSB 4D9FA 5KINB 5JISA 5J5VA 1KFJB 1UIMA 1KL7A 1VB3A 2CLFB 4HPXB 4D92A 1A50B 2DH5A 2RKBA 1TDJA 4D8TA 1Z7WA 1A5AB 1X1QA 2CLEB 2ZSJA 5B53A 4D8WA 1WBJB 3PC3A 4HO1X 4L0DA 3SS7X 5I7HA 1J0BA 4D96A 1K8ZB 3L6CA 2O2EA 4WX2B 3VSCA 2BHSA 3CEPB 3ZEIA 3VSAA 2C2BA 1TJPB 2EGUA 5EY5B 3TBHA 4D9EA 2ECOA 3IQHX 1UBSB 2Q3CA 4F4FA 1C8VB 1TYZA 4D9NA 2RHGB 3SPXA 2CLOB 3AEYA 3X43A 1O58A 3RR2A 2WSYB 2J9YB 5E0KB 3HMKA 1A5SB 1V7CA 5IWCA 4JBNA 1P5JA 3T4PA 1K8YB 3L6RA 1VE1A 4NEGA 5DBHX 1JBQA 5BW6B 4PCUA 3L6BA 4JBLA 2ISQA 1TZJA 4D8UA 4D99A 1TZ2A 2CLMB 5D84A 2CLIB 3AEXA 5I7OA 2V03A 5JJCA 5I7RA 1Y7LA 1WTCA 4QYSA 1KFBB 4XUGB 2J9ZB 3PR2B 1TZMA 1J0EA 4LMBA 4I1YA 1FCJA 1KFKB 1TZKA 1VE5A 2PQMA 5D87A 3PC4A 2RH9B 4HPJB 1M54A 5DW0A 4LMAA 1C29B 5B1IA 1J0AA 1QOQB 4HN4B 1KFEB 1D6SA 1UINA 3FCAA 4D9CA 4ZU6X 1J0DA 2CLLB 5I7WA 1BKSB 2GN2A 2Q3BA 5IXJA 5C3UA 3R0ZA 1K7FB 3R0XA 1K3UB 5CGQB 4H27A 1CW2B 3IQIX 5IW8A 5I6DA 4D97A 4KKXB 1WDWB 5KZMB 4LI3X 5HBGA 4L28A 2O2JA 3IQGX 3X44A 1PWHA 1QOPB 2CLKB 1KFCB 1E5XA 2J9XB 4OREX 5DVZA 2EFYA 5B1HA 1BEUB 1C9DB 4COOA 3DKIA 4OFXA 4D9GA 5B36A 4ZQCB 4NU8X 5I7AA 1K8XB 1K7XB 2ECQA 4L3VA 2C2GA 5J43A 3VC3A 1PWEA 3BM5A 3DWIA 2Q3DA 4ZU1X 4AIRA 2TSYB 2BHTA 1FUYB
chains in the Genus database with same CATH superfamily
2WRZA 1IK4A 3GXBA 5C8XA 3PTLA 1DBIA 2XE7A 2R79A 3OM0A 2XB8A 4DVJA 4E2WA 4IEEA 1ZGBA 1UBCA 3IH5A 1DKQA 4D9MA 5J2TB 1FDTA 3M6XA 3DEZA 3CXRA 3KXPA 3B9BA 3RVKA 2AWOA 1VPLA 3EA4A 4NHOA 4RYLA 2XAUA 5G2OA 2A59A 3DO6A 2BH2A 2YJTD 3RARA 2XNKA 1V7QA 4NR0A 4MJ3A 4KQ6A 2W2OA 3G8BA 5DM1A 4MWTA 3PITA 4GEGA 3UMVA 1WMSA 2FRDA 3G1TA 1D2CA 2I33A 3G2QA 2WYHA 3JYLA 4QU0A 4CKEA 1E1CB 2I76A 5DM4A 1VHJA 4LMRA 2ODEA 2PWBA 4KCGA 4NBRA 1USKA 3UGJA 4KL8S 1ULAA 3OE5A 3RLFA 4YMSA 3T0GA 5IS2A 3WBJA 1WXEA 5H9VA 3Q7TA 5JXHA 3DFFA 3JZMA 4YP7A 2F3UA 2FN8A 1DNPA 2J6HA 3OZRA 5ECWA 5LXTF 4N6OA 4MS1A 2AOTA 4OXYA 5I8PA 3HBLA 1SHJA 2YQ4A 1TA0A 4W5RA 2JA1A 2WKPA 1D6JA 4W7IA 1JSRA 1PLLA 3KT6A 2DGDA 1ZDMA 4EIWA 1YI1A 4CLDA 3VSBA 3TLZA 1XZJA 3HXOA 1FFYA 1JKXA 1DUIA 4E2ZA 3AL0C 3KUKA 4AI6A 1UP6A 4YTEA 4JJ7A 8ATCA 1KKUA 1WSAA 3ESBA 3AM5A 2BJHA 3I39X 1YRHA 3MFQA 5EQFA 3ZZ1A 5AW4A 1QH8A 3OQPA 3NHBA 3IQEA 1UOEA 1JWBB 1QH1A 3WSVA 1MW8X 4LE2A 3PQ3A 1W36C 5JANA 5K05A 3NHFA 3QNMA 1E2UA 1Q3HA 4TZ0A 3NB0A 3ZN2A 1BTOA 4IJVA 1YH3A 4BNMA 1G16A 4Y2YA 4WJLA 1REQA 1V8BA 3WGTA 1NU8A 2GCOB 4KO4S 5DYYA 4I1OA 3DV2A 1OA1A 1MUUA 2PUWA 3Q0IA 3L1JA 4I1YA 4DSUA 3GZJA 1FJGB 2IS1A 1HYBA 4M49A 2IE8A 1IOVA 2B4AA 4KXMA 3CRNA 3WB9A 2XKKA 1GTMA 3NBFA 1AKEA 2FXIA 4JP5A 1I36A 2JKZA 4M98A 4FSDA 2ZXFA 2NUPB 3BT7A 3D54D 1OAKA 3K0CA 3L0IB 1XO1A 3VOBA 1WD7A 2VP2A 3B8HA 4L85A 3MJFA 4P31A 4ZICA 3WGVA 1F48A 3CNQS 1T1SA 1OAOC 5CVUA 5JJBA 3NM6B 2KSQA 1NL3A 1L7VC 4C43A 1T4MA 1GHTA 4X62B 1WHTB 5KYKA 2SKCA 5DN6A 1M5RA 4P1ZA 3LCVB 1QMPA 1O9HA 3UOAB 3TIVA 3AHJA 5K99A 1KE1A 2I8AA 4EP1A 4F6RB 2QT1A 2X9GA 2AIRA 4ARIA 2IEYA 4JC5A 1OT3A 3LPNA 1OBCA 1EM8A 2O52A 5ERGB 4M1EA 2Q1WA 1M5UA 4F7DA 3IALA 3DMRA 1DOHA 3I8SA 1RAHA 3FKSA 2H4JA 4LXXA 5KB3A 1IJBA 3HBFA 2H92A 4LC1A 3DZGA 4Q1AA 1JIJA 3ESXA 4ND1A 4Z54A 1JAXA 1II0A 2X0IA 2IODA 3QF4B 3QNWA 1HE4A 5A71A 2WJYA 2IZ7A 4J1SA 3R7AA 5EMKA 1Z16A 2G4VA 4IIVA 2HW8A 5F73A 3N74A 3GG9A 1SCNE 3RANA 3ANNA 4W1PA 1BFUA 1OVMA 1XEAA 4J0JA 3NYQA 4WXMA 4KYTA 1R6UA 2AG8A 2AYXA 2GXQA 3D6NB 5ALFA 2MHCA 4PC6A 4RDXA 4A5SA 5COQA 4AN1A 4M1OA 1RI1A 2COKA 3USCS 1E2BA 1XTJA 2QLNA 3AH8A 2D06A 3D5EA 1RD4A 4V3BA 3EOBI 1A8HA 3KSZO 1JXQA 4O4JA 4RJKA 1SCUB 4TRRA 4XPZA 3KWFA 1QX4A 1BVYF 1HI9A 4ZO8A 3LLUA 1OBOA 4L9SA 2GAOA 5J23A 1JDBC 3LY7A 5AYVA 3IDZA 4FYKA 5GONA 2H0QA 2P90A 4FEGA 1NQTA 1Q44A 3VSCA 4EMUA 3C3JA 2DCUA 4ZOLA 2HWKA 4KRFA 5FYDA 3OLVA 1LI4A 3MK31 1UEJA 2J3MA 3CH7A 1CS4C 2WPDA 3K2IA 4I5FA 4R69A 1NMSA 3FUCA 3ORFA 3TPCA 3DMPA 2C7RA 2V6GA 2PDAA 4FYHA 2Z9BA 4L08A 4JWTA 1ZHHA 2O2CA 3H2GA 3LI2A 3O47A 3QMMA 1OTYA 1J5EB 1VMDA 1EX9A 4WKGA 4LXGA 4S05A 1AQLA 3UJ9A 2RAPA 1OLXB 1Z0KA 2H9YA 3GBSA 4R41A 1E2EA 4COKA 3F4KA 3STUA 5KNCA 3HCRA 2CHGA 1HZJA 2O2SA 2DR3A 4RVOA 1ITZA 1X14A 5JPDA 5G0WA 3GJ8A 4LVCA 2Y1XA 5EG5A 1P0CA 3SBDA 1TF7A 2EBUA 2IA5A 2WWRA 4MUKA 4TUYB 5DBIA 3TTTA 1GNPA 3TPFA 1PWXA 3D3KA 2B20A 5A62A 4MTLA 2REOA 1QTNA 2CBZA 4P4SB 2X2PA 1RMQA 1YL6A 2ERXA 5DTEA 2I6FA 4YRZA 3LBFA 5LQJA 4DCUA 1GLNA 2H16A 2VRCA 1IBSA 3OAAA 4MA5A 4I1IA 3SJCA 4ENQA 2F59A 3WGUA 4GBMA 1I5OA 1YJAA 2I4TA 5ESDA 1G55A 3DOIA 1T9GS 4P3XA 2FF7A 2XAAA 2DR0A 4UDYX 3TX2A 3R0XA 2PGJA 4BTEA 4RF4A 2XCUA 3EBPA 4KJXA 3FLAA 2WFLA 3OTWA 1R16A 2FPUA 5JDIC 1W36B 2PJDA 1LBIA 1P60A 2PYZA 4N6NA 2LRHA 1QGOA 1ETUA 4IF4A 3V1YA 1QUEA 3I2YX 2OBNA 3CLUD 3UPDA 3BRWD 4TGLA 3BB1A 3OJXA 1M1XB 4TMTA 4EF4A 4IX1A 1TU0A 2B83A 3OZVA 2HRCA 4JI4B 2IX9A 4E2FA 1WPRA 1FPQA 1BEZA 1AS2A 2OFFA 1Y9DA 3AUJB 1PT8A 4KO3S 4TMZA 1WETA 1CEYA 2C1ZA 2YMQA 5JY1A 4AUMA 4UMFA 1SURA 3QK7A 2VAXA 1R6DA 2YVKA 2QNBA 1J39A 1U02A 1GADO 4QTUB 4EG4A 5K01A 1QS0A 2GN4A 5ED4A 1QR2A 3KS9A 4J91A 5AVZA 1NXVA 1MQ8B 3H5TA 3AVPA 5CNKA 5FA5A 3NG1A 5HCNA 5A04A 1UQRA 1YZQA 4DSTA 3SEZA 5L3QA 5IAAA 3N5CA 1T1GA 1U8ZA 1US8A 2JGNA 3PFGA 2FLWA 1RWWA 3K5WA 3M5DA 1ML4A 5CK4A 3QTTA 5B6PA 1GPDG 2EX0A 4KQXA 4MVJM 1YDEA 3ORQA 1LBHA 5J58A 5TY0A 3ZGLA 2XMZA 3BSSA 3CSUA 2NU8B 1TAUA 3FTEA 2HFJA 4UVIA 1NKSA 5KVAA 3QJGA 3QOXA 1DJNA 1Z33A 2FQYA 2ZI6A 3AEKB 2VZLA 3H5RA 3IR5A 4NTZA 1RXUA 4MS3A 1ZIXA 1K8ZB 1HT3A 2VH1A 1W19A 2AK2A 4IINA 4HZGA 2WHQA 3PKZA 2OBFA 4MVYA 5JNWA 1CUIA 5HMLA 1Z7GA 4X84A 1P8AA 5A5EA 4M6WA 1NJ2A 3I5YA 1U3WA 3IJPA 2OO5A 5EXDA 1VMIA 2GWRA 4F84A 2XZLA 4F8EA 5GOZA 5FCDA 3WNZA 1JW9B 4EHIA 3AP2A 4JAVC 5KNBA 4NV1A 5LU8A 4QTXA 4QYIB 1F6DA 3FTQA 3RAGA 4F97A 5JVDB 4CIDA 4JA2A 1VHLA 4OMUA 4D46A 3KPJA 3WWYA 4DR7B 4Y6SA 1HQCA 4IJKA 5HIAA 5DT2A 1KJQA 1SCDA 2E0IA 4XFJA 4TYNA 3R9XB 2Y27A 2DQYA 1AQIA 3IIIA 3EIFA 4OQDA 4NCKA 1O08A 1XHFA 4OQMA 4C2UA 3EEYA 4BHTA 1PR5A 2X3FA 1ODJA 5G02A 1CUXA 3SR3A 3U9LA 3CX3A 4F72A 5JBQA 1T8UA 3PCXA 1J0EA 3LPCA 3CLTD 4ZRNA 5BSEA 3KQPA 3I5XA 3BOSA 1DTWA 1X92A 2XUKA 1EH5A 4L74A 3ZBQA 2IOFK 2O8FB 2I54A 3TVYA 4W5OA 2VPTA 4UJ5A 2I6TA 3C6ZA 1PGOA 3LDAA 1UBTS 1OUMA 3ZOZA 3C8MA 2JJ2D 1NA5A 2VXYA 1KU0A 2PGNA 1ZUNB 3K4HA 1SELA 4H7FA 2C97A 3VUFA 1GUYA 3N76A 1EUCB 1ODIA 2R4UA 2X5OA 4DJFC 2OFOA 4L8GA 2YOFA 1UCFA 3OIGA 4MGHA 3WADA 3KLBA 3D6VA 2FZCA 3NIDB 4F6CA 2ZSIA 5LYJB 1QVVA 1DBWA 1IBLB 2FFQA 2WF6A 2CLKB 4RESA 1LJUA 4HZUB 1XP5A 2ZB7A 2R1TA 3PU6A 3PI7A 4N82A 2BBWA 5JI2E 1X7ZB 5DGTA 1BCRA 1E94E 3GCZA 4RTNA 2Z57A 4LRXA 2I29A 3PLAE 1K9SA 1N75A 2P68A 4S1WA 3C74A 4WXYB 1GEGA 3EXFB 1ISPA 3G2JA 3N8DA 1Z0FA 5DRYA 4DJTA 4EQ6B 4BWGA 2C4WA 2JPDA 3EDYA 4QQKA 4A8JA 1SU6A 2EHJA 2PX2A 7ADHA 1NDQA 1ACJA 3STYA 3DLAA 3DHYA 1E69A 1DVRA 3EH1A 4G1UC 1E2GA 3HJCA 3AEQA 2YDXA 3FNRA 4BRZA 2B78A 1GQSA 1WXFA 1B6TA 1PJAA 4TV9B 1QFMA 1BOFA 2Z5GA 2C03A 4HLUC 4HNAA 4YRMA 3OC6A 5F3WB 4XARA 2AYYA 1NPYA 2RGEA 4WUTA 1M2OA 4QTTB 4YCCA 1VE6A 1D09A 3RVPA 4N01A 3VVCA 5BR8B 1T9DA 3G59A 5J2UA 4QXOA 1QVAA 2DE0X 1W0KD 3GZ4A 5IJ0B 1L3IA 1MC5A 3C6QA 1XOIA 2XCQA 1U5BB 2D4AA 1M67A 4IKPA 3PR3A 1EX7A 3DEIA 1NNSA 2PD6A 2NU6A 1FNDA 4OHXA 1UJCA 4FGLA 1QGYA 1ORRA 4DARA 3VC1A 3ER6A 4DIMA 3FZNA 1OLOA 2GJKA 2GXSA 3QLUC 1XNJA 5AKZA 2NVBA 3D4BA 1K8RA 1U04A 5HS4A 3H2ZA 4XIFA 2VI5A 3QJYA 5JPCA 1Z0JA 4FB5A 1N7GA 5CB4B 3J81k 3HG7A 3TEJA 3NCTA 4HDOB 1ZC4A 3ZY4A 1V16A 1KEUA 5I7EA 4IUDS 2QAIA 4I4NA 2AFHB 1UJ6A 2RIRA 1ENPA 2QSZA 4IZIA 1M7BA 2OZLB 1HC7A 3O1IC 1H2HA 1SO8A 4B82A 1N25A 1RHMA 2A94A 3E9EA 1SXIA 3BH0A 4DAEA 2VQ6A 1TB4A 1DAFA 3S1AB 5JXGA 3ZJ4A 1OILA 4GVLA 5AVRA 1KJZA 3M6AA 3ZDQA 1SKQA 1WB6A 3PDIA 4TS4A 3UFBA 1R0WA 1YB2A 3DMHA 3IYLW 3QBDA 4YRNA 4G5YA 3BWDD 4HAVA 1FYDA 5DTIA 4AXBA 4F2PA 2XNDA 2AFHE 3IDSA 3ADCA 2EHDA 2WWFA 1XTRA 1PNQA 4PNHA 3DDSA 4XQCA 2DPMA 4AUEA 5F98A 1QHGA 3KZXA 1J21A 1KFBB 4J6FA 1G7RA 1YMUA 5EWMB 3D2BA 4US0R 4JVLA 1D9ZA 4XB1A 5CURA 2WM9B 3UH0A 2VJNA 3T99A 4BATA 3VKFA 2YRXA 2DQKA 2G8NA 2RJNA 5KKCA 2XUIA 4IHQA 5DT9A 3RUHA 3UJAA 5BV2P 1KK3A 5EIBC 2A57A 3I72A 1RRFA 4RACA 3TJZA 5LDHA 1DBPA 2FW6A 3EHDA 2ZREA 3IILA 4FD2A 4IAOA 3OX2A 2X0NA 4KQ9A 3VYUB 4DJJA 4GQIA 3HO8A 4YRQA 1RP7A 1R0XA 1YRBA 2WNIA 1AZWA 1C0EA 4CG1A 2GM4A 1BWSA 2VC2B 2HSZA 1U28A 2YOGA 3FFBA 3ICCA 3IDAA 1L5ZA 2YV2A 4FJ0A 1URPA 3TLXA 2AOWA 2G17A 4P8RA 3SXUB 3L1UA 1HL7A 1X38A 4U7PB 3BREA 2JS7A 1IZ7A 1E20A 2AGVA 2YBDA 1O4VA 2Q7DA 3WK8A 4GUDA 1EQAA 1GWNA 1TCVA 1T8YA 3BMOA 3QLVC 4WLOA 3U4HA 2YRFA 4Z8XA 1JKIA 2ZAMA 1YZLA 3G0OA 1XEWX 4LCEA 3CGGA 3WL4A 2BKVA 4Z4EA 4FR5A 2V7BA 1TKRA 3EYAA 2CL7X 3AC0A 4ZQBA 2AUTA 3GFBA 4R2KA 3W8EA 1O5TA 3L9WA 1GVHA 3RS3A 3NHYA 4OGWA 2QQ5A 1KHHA 3QQPA 3RC7A 4MR8B 1Z12A 2BTQB 2FWIA 3M6LA 4MWSA 4TKUA 5EP2A 1L4EA 1VPDA 2JC3A 1IJKA 4DN6A 4K9OA 4KGDA 1GU1A 2C58A 3LQ4A 3ZJTA 4OQZA 3JS5A 2R00C 2UUPA 3KYJB 4UAUA 2NT3A 3DM9B 3V8EA 4FMDB 5CRIA 1OVGA 2PLRA 2XUDA 5TPZD 1CUDA 1ZHOA 4QFBA 2NO4A 2I1WA 4Q9IA 3HPRA 5JAOA 4HCJA 3E7FA 2GSDA 1ZVMA 4M38A 5FTLA 1O8CA 1YFKA 2C9YA 5EXPA 4JQYA 5AOBA 4KIWA 1UDCA 5C0OE 3QX9A 1DT5A 2EX4A 3W2GA 1Q20A 2ZAOA 3KOMA 3U0VA 4WBNA 1SHUX 4YRGA 1MFZA 2Z9DA 2YRWA 3QKUA 4V3CA 3VZQA 4DMRA 1FFSA 3F2IA 5C81A 1XGKA 2JLXA 2OGUA 1VBNA 5TQ0A 1I51A 1VKZA 1YZYA 1ZAKA 4HWPA 1OC4A 1OIVA 1SKUA 5EQDA 3W1VA 4XCQA 3VA7A 3TTWA 4CW7A 2HRQA 1KKMA 1W29A 3GHHA 3E9NA 2FFRA 1DEKA 1OWNA 1V47A 2BL4A 3LYAA 4J3NA 4IJ5A 3ZWMA 3P0JA 5LR6A 1ZXBA 4DSZA 3IC5A 3O7WA 4QFMA 5E6RA 1ZM4A 5EMHA 3RV3A 1CEXA 4HDQB 1RRVA 2VSXA 5EAIA 4TYYA 4CEIB 3LQ2A 1MX9A 4X94A 2W2TA 2J6BA 1ZITA 3PE4A 4BCCA 2O0HA 4E5PA 4FFLA 4IHAA 4JVNA 2WIBA 4B75A 2QZ4A 3VJKA 1EFKA 1JG7A 3B5JA 3QKRB 1LWNA 3CRVA 2HJHA 4BUZA 3B9PA 4R7GA 1T29A 4ZCIA 1KY5A 3GQBA 4NABA 1QUFA 2OAGA 1VE1A 3DOFA 4NEGA 4UTZA 1F3OA 1QXSA 1P5HA 2X8JB 4WGFA 4EUSA 2LXNA 4UTNA 4RJTA 1YA8A 5KQSA 2IXEA 4GL4A 3UAWA 3ZNPA 4TTAA 3OZXA 4X92A 5IBQA 3FTCA 4D3XA 5IF9A 2IUYA 2UKDA 2VUTA 2ZJ5A 1JTVA 3EFBA 3KWJA 4R68A 4PO9A 2Q2QA 1BCSB 1QPZA 1QRUA 2IXGA 1VYHA 2QMQA 3V1LA 3X0DA 1QRDA 4EG7A 1Y5MA 2V1XA 4EW1A 2OAQ1 4UMEA 1ML3A 4I4IA 2C3OA 4QDUA 1MO2A 2PVCA 4Y6OA 3SHTA 3SYTA 2Q8NA 4P7FA 4DQXA 2X9NA 2D5CA 3RU2A 2C4TA 2PV0A 1RYMA 2D5BA 3ANXA 7REQB 2AJBA 5H68A 2RB4A 2ZGVA 3D3NA 1M1YA 4IRMA 4Q16A 1RXCA 2RAVA 1Z4QA 4Z7NB 2VJAA 1CQXA 1MB3A 2PKEA 1XL0A 2Z2JA 3BDIA 3DAYA 3FMGA 3CS3A 2E87A 2QTWB 5HBGA 5FDFA 4FM9A 1BMDA 1T36A 3VR2D 1CNMA 5COBA 5EN4A 4OIFA 3SKXA 2QP3A 3GUYA 2RI6A 2VPQA 5AJXA 4ZYWA 5FIUA 1K9VF 4MARA 5IASA 3KZKA 4PLVA 5CVEA 1MOQA 1QCDA 1XEFA 5DGCA 2HPHA 1KETA 4EYQA 5I9BA 2NOAA 3F90A 3E1KA 3ENQA 1M6NA 4DYHA 2K87A 2ZTUA 3HR8A 3GA5A 3SVTA 1ESCA 3OPMA 3DL0A 2KWIA 3TB6A 4EG3A 4Q3EA 4C7OB 2PEZA 1Z28A 3BZWA 4HVTA 4M7RA 3BXHA 1I9CA 4RK1A 4RVDA 3ESCA 4H0FA 1BWRA 4KLAA 4QOJA 4X6LA 4DLRA 1GNRA 4MRNA 3D3EA 3H84A 1CVIA 2C9BA 1Y5NA 4GC5A 5BV8A 4D4LA 1DAEA 2HJGA 3LUJA 1FU7A 1EUQA 4LJKA 2OHFA 5JZVA 2Q62A 2WMNB 4FDTA 3S2YA 4H18A 1IUOA 1U1IA 2ODPA 1UIMA 2G40A 1VB3A 1PW7A 2OLEA 3ABIA 3DQPA 2R6FA 3BVPA 1KJYA 1NP3A 4HB4A 3AWDA 4QLBA 4RPJA 1FLNA 3ZQUA 3Q1KA 1SXHA 4MWZA 1N9GA 2GPYA 1MB2A 2ERCA 5CCDA 1OH8A 1LTKA 1V1RA 1S2LA 1YU9A 2P9FA 1OX6A 3CLUC 4HDMA 5TDHA 3SM3A 3HU3A 1JT9A 4H1UA 4YACA 3UJ6A 4QJ5A 3T9BA 1V4BA 2AW3A 3WL7A 2PIDA 2J0SA 4CKYA 4D9NA 2Z1NA 3JQ8A 4K9KA 1SAYA 5ELMA 3F6SA 1CQZA 1W6RA 4WOCA 1A98A 1OC2A 1OWLA 4KQIA 1ULBA 3WKAA 3V8NA 2CFCA 4CMIB 5BMOA 4MDEA 3QWAA 2R65A 1E8DA 1WBBA 1P29A 1NXWA 2Z9CA 1WXHA 4JK3A 3FBGA 2B69A 3DXZA 4HHEA 3I76A 3C3XA 3OE1A 3AIIA 2WHPB 4FLMA 4MVJP 5AWFC 1P4AA 2WYWA 2XSZD 1V6AA 4GX0A 3T12A 4AUNA 4B34A 2DWCA 2O2YA 2O20A 3BMXA 1TO2E 1PX2A 5I9TA 3VPAA 3G88A 4BNWA 1H93A 4PYQA 4RFSB 3RGWS 1A4IA 1EAYA 4D0RA 2PQMA 1TVCA 1GSHA 1Z36A 4DB4A 2ZQZA 2VXCA 3D6UA 1CR2A 2H51A 3H11B 4FBGA 2V0CA 3ORRA 2W2LD 3AETA 5AOAA 2R97A 3ZBPA 5KWIA 1QWSA 2WVJA 1U9IA 2VL7A 2GCNA 4ENUA 3DDUA 4MEJA 2AZMA 5I8ZA 1A8QA 5BSUA 4QM7A 2HU8A 4RH3A 1HE1C 4B3XA 3ERCA 2P11A 1F6BA 3INTA 3A4NA 1TA4A 3PXDA 1AXEA 4URFA 4XCVA 2XA2A 3K8QA 3A1UA 1XAGA 2W83A 4K05A 1S2IA 1UC9A 3NNSA 3RYHA 1KY3A 4EYKA 4RZXA 4CIYA 1RM5A 2X0KA 2CCGA 3O3CA 4PRZA 2PQ0A 1OYYA 1ZRMA 3L01A 4QPNA 4LWQA 1TAHA 3AB8A 4IG9A 4DEYA 4J94A 1QNLA 2REBA 4JYPA 4PHCA 4V03A 4B2YA 2UU9B 4AL4A 4MKFA 4HQ6A 5J43A 5B4UA 2A1TS 3UHPA 4YUVA 4JUFA 3H6GA 4WY8A 4E7OA 1AUQA 2Y1LA 3CLVA 4BJ3A 2HF9A 2X5KO 4EHAA 3B6EA 1XZLA 2ZIEA 4AECA 5BWOA 1N2IA 2B99A 4HJXA 2E1PA 2R5WA 3HY6A 2Z2YA 2F67A 5SYNA 2PVPA 4DA0A 1FZTA 2D1FA 3WMFA 1BDIA 5JLJA 3C7AA 4UBJA 5L9AA 4RWZA 5ALSA 4AWXA 3FOEC 3B60A 1QQ5A 3ZWKA 4CFSA 5HDBB 4A0HA 1GRNA 4B3IA 2QI9C 1AKWA 3EZGA 1KA9H 3AUFA 2QTGA 1HEYA 1EX6A 2LP4Y 3AF3A 3F8SA 3HH8A 4FILA 3EUAA 1ZBQA 4I19A 5CVCA 4E5VA 3FFXA 4LXYA 1KI6B 3ZLVA 4PY2A 2C0CA 3FPKA 3IL2A 4PICA 3P9ZA 2GKOA 2AQIA 4L27A 4W1SA 4AKSA 4F1JA 1OIWA 2YQZA 4NNPA 2HADA 1R66A 1XVAA 1UMBA 2HZBA 3D6JA 3W5IA 2XECA 4F45A 5KPDA 2QE6A 3I9FA 2NT4A 4L5JA 1YZ3A 1Z7WA 1KPHA 2J7PD 3QIAA 1NHWA 2VP5A 3L5OA 3DYVA 3BXGA 5FL7D 1MPXA 4Z4GA 1QRTA 1WCV1 2FMXA 2QUAA 5KIAA 5IFKA 4IFEA 3HZRA 4WX2B 2PSJA 1VKRA 5T41A 4KAXA 2HMAA 3RASA 4DCJA 5HF9A 4ZK6A 5BV0A 4IX9A 4L51A 1VCMA 1AURA 1UXOA 2C4NA 2GRJA 4MICA 5HUHA 3HCPA 3U4IA 1JAYA 3GDGA 2O8CB 4EDFA 2W90A 2W6NA 1DKOA 5LDDC 1ZWLA 2PU7A 2MCFA 1E61A 4EB6B 2Q4TA 4I9NA 2RKWA 4JJKA 3H13A 4HNRA 4NCIA 4DY4A 1QONA 2H08A 4AMVA 5LIRA 2GI4A 2EYQA 3NANA 4XJTA 4BMSA 1ZJWA 4Z1MD 4Z4IA 2IYFA 3Q3IA 4RNDB 4Q3KA 2VQEB 4HF7A 1M83A 2PD3A 1T35A 4CKBA 4YV7A 1XLWA 2EJCA 4KTVE 3UJ8A 5CG1A 3GFRA 2OBXA 3H6HA 2ZUWA 4G56A 3VZPA 1EDEA 3G9UA 3IVCA 3WB2A 4RTOA 1E79D 2JFQA 4WXEA 3RSLA 2GK3A 3ILXA 4NFYA 1TK9A 3ZLUA 2P4EA 2Q6TA 1EHCA 2VDRB 2VZ8A 1OE0A 4AU1A 4WFIA 3LMKA 4YRLA 5FNVF 5G0SA 1QTQA 1YS2X 3EVCA 1ENZA 2OL4A 3PC8A 3M4YA 4RK4A 2CXNA 2YINC 3CBQA 5FUQA 1XD2A 4OSOA 1L5QA 2QN3A 4ZKEA 3WDLA 3BIFA 3GT0A 2ZBGA 4JYAB 3CMMA 3GJYA 1CDDA 4FKBA 5IJWA 4FS8A 1GAJA 2HL6A 3O8OB 1LQTA 3DPUA 4W8HA 3A1TA 5GJVC 3QELB 1YZNA 2PA3A 1S8OA 2WMYA 4C0JA 4X65B 5BUZA 1FX0A 5AXDA 5F12A 2C1EA 2E6UX 2QZSA 3QF7A 2PH1A 4KX5A 5KDLA 5AHRA 5FHRA 1KEPA 3PGMA 4MGIR 4QGHA 1C9DB 3RNOA 3VDMA 3FDJA 3VI3B 1RWXA 1XZGA 3IESA 4B2IA 2G1UA 1IULA 2WC1A 1U9CA 3GLHE 4RPHA 3WOHA 2V9ZA 4JGIA 3K9WA 1ZNXA 2R25B 2OENG 1M0EA 3Q5DA 3RT7A 5MDHA 4MQEA 3F6EX 3KOZA 4QAQA 2PUBA 2E85A 4UHHA 2GN0A 2OD9A 3MMPA 5CBPB 5E7MA 3EDMA 5TJHA 4A8HA 5HF6A 4WXRA 4Q9AA 5LZ7A 1Q1BA 1U3CA 2NU7B 3N6RA 4K6FA 2AXEA 4QJ4A 3QA3E 5BSHA 4C2BA 2V3VA 4L7QA 1V48A 3QY0A 3KP1A 2X22A 3PZBA 4OQ4A 1A8IA 4L8FA 3GLGA 1GTJ1 3FNFA 4EI8A 3VPFA 2ZJ6A 1UP7A 4P80A 2WMDA 3LPAA 1RWPA 4K9MA 1J8MF 3CVWA 1CLUA 3E4CA 3PEVA 4P3KA 1P4RA 1XAIA 2OKCA 2XEDA 5EZYB 4HWOA 3S5UA 2KMLA 4GLJA 1V3UA 3NVKI 3DVRX 2PWPA 4GGMX 3TIIA 4CN8A 2V4ZA 1BEEA 2D54A 2O06A 1NNEA 4R1NA 5CW1A 2EJTA 2C9CA 4I1UA 1JR3D 1PL0A 3R76A 3CT6A 2BCEA 5A5FA 2QTZA 5T4EA 2G9VA 1T5OA 1Q0SA 5AJTA 3G7UA 4QTZA 3V6MA 1FUEA 3E9DA 2BFFB 3D9QX 4GKAA 3KU1A 1I01A 1PJBA 2QM3A 3G7SA 1A7UA 2ECOA 5EQTA 4MUMA 2ZEJA 2PKRA 2Q3CA 4C5CA 1NOIA 4MUEA 4B79A 2DUMA 5JW6A 4XDHA 2JFNA 1C3OB 2YNMA 2RHOA 3NOVA 1YZFA 2P9TA 3PXEA 5ITZB 4KSBA 4M0CA 4WY5A 3T7RA 5AESA 1JG4A 5FWYB 1NMZA 1FXSA 2QTLA 2RSLA 3UPTA 1L5YA 2B35A 2QL6A 5FR1A 2VPWA 2W9XA 2P40A 3DOJA 3ETDA 2QR5A 4S1TA 4TMWA 2QLLA 2I4MA 2HNBA 4CT5A 1ODTC 1KQOA 3JALA 2WU8A 3WZLA 2PGOA 3W0LB 9LDTA 3ZVLA 2QN9A 1T9AA 3EF1A 4CV2A 1OB5A 4R1TA 3BEOA 3KNZA 1XWFA 1Y4UA 4RULA 3VVLA 2CNWA 1STOA 4OK6A 1RKVA 3H5WA 2BFMA 3LA8A 4DRXA 4ZOCA 4YCNA 3E3OA 4W9MC 1Y63A 3SYMA 3FPFA 3HWSA 3IUEA 2CWWA 2DWOA 1OXMA 5JAHA 1GN8A 4Z1OA 3VOAA 3JVEA 2I2WA 3K5HA 2EQAA 3FUVA 3GLTA 4INZA 4I3HA 3PJDA 4MUFA 5BWBA 5FA6A 5ARCA 3JQAD 3SSOA 2PKQO 1G8AA 1J7JA 3RC9A 5I7WA 3O0DA 3CJRA 4O2LA 5AR1A 1Y8QB 2PSFA 2AYZA 3WB0A 2WFZA 1X1SA 4Y0NA 5K0EA 1ZQ1A 1MP0A 2VJCA 4JC4A 4V0MA 2NV0A 1EFPA 3ZE0B 3LLVA 1LRKA 2BUBA 2X1MA 4KBGA 1BJRE 5FTJA 2J5RA 3FAKA 3FGZA 3M49A 4IF6A 3KLNA 3TO5A 4YXWD 5IHXA 3PJGA 1G8FA 1QPBA 4O2AA 4NXMB 3FR7A 2C5BA 2W11A 3OFNA 3F4BA 3OEEA 1T1RA 1VOTA 3N7AA 5B7PA 1DPFA 1K8XB 2D13A 3II6X 4DC0A 5CM2Z 2Y3IA 5BQPA 1AU9A 2BKUA 4OQXA 2N42A 4PZCA 3BMNB 1AUVA 2XPCA 4P0PB 1YB1A 4F9TA 3MWKA 5D85A 4U2KA 5KSPA 2MYTA 5D2CA 1U7TA 4ZV9A 4ZIRB 5EIXA 4IGIA 1FP4B 1RMTA 1W47A 2ANCA 1VL2A 5AQEA 1PTJA 2O0LA 3C1OA 3F47A 5B55A 4YCLA 3HRHA 4ZI7B 2AE2A 3T7AA 3HEAA 1T34A 2PYIA 3FDXA 4QXQA 4RVGA 3D2AA 4NCBA 3RKSA 4C87A 1WX1A 1YZGA 4KODA 3WLKX 1U8CB 1NHGA 4RENA 4GMFA 4M1MA 5JH7A 3T41A 1VJ5A 2CT8A 3P9PA 4OUDA 3UANA 2EJVA 5J63A 2MYNA 4JBGA 1W34A 3FETA 3L5KA 1S9HA 2E4YA 4OXNA 1SY7A 2NAFA 5ED0A 4NY1A 2V3CC 5LJLA 1T9CA 3H1TA 1LSOA 2NMVA 2HM7A 2V97A 3F5FA 4E4YA 4GAEA 5BUSA 1D3AA 3LQKA 1P4GA 5AM0A 4FLEA 1T6ZA 2V0NA 4M1YA 1JU4A 3RTCA 2FWPA 3JATB 4EYOA 3CZPA 3OOEA 2H18A 3MF4A 1TIBA 5IC5A 3AI1A 2NPFA 1E1DA 1E2FA 5ALTA 3SYKA 3IPCA 2QT9A 4JB8A 2F3QA 1ECFA 1Z18A 3CEAA 5ISMA 1JEQA 2LR0A 1VJ1A 3QVGA 1BW9B 5C8VA 5JYCA 1II9A 3CTMA 2Q9AA 5AFSA 5KYGA 2Q29A 3B1JA 4Q3DA 3U61B 1XU7A 2ZDQA 3SIRA 3U1VA 1YJXA 2RB5A 5THXA 2D7DA 3A2KA 2BDEA 4TTPA 2CNKA 3F7NA 5DP1A 1EG7A 3CRMA 4IMPA 1K97A 1HLGA 1LVHA 2GJ9A 3NHMA 4WFQA 1FFEA 4BVEA 1F3LA 1Z4LA 5B4TA 4L72A 3JV7A 2DSNA 1U2DA 5H16A 1DJPA 1BVRA 1SUWA 3IHTA 3SI7A 3UAXA 4HPWA 1P1IA 1ODCA 1KC3A 1JAZA 3H86A 5DCUA 1IBMB 4YRJA 3U3KA 1UZLA 4QELA 2AG0A 2NADA 1NYRA 5KJEA 5TMDA 5EJAA 1SEPA 1G3UA 1Y3CE 1K8QA 3ZDXB 1Z6PA 4L0MA 1HNXB 4B7XA 4PYKA 3HL0A 5H70A 1R1DA 1J1ZA 2WTAA 4YAFA 3T3DA 3TKYA 3CN7A 1WMAA 2JH8A 2QPTA 4RCYA 3UTDA 4OH7A 1ABFA 3WKCA 2X7JA 1FFWA 1JBEA 4YMTA 3GUCA 1T15A 3ZJVA 2J3HA 1PJ3A 3A1FA 1CJMA 1BO6A 4R9RA 1KMHB 3BZBA 3KSDO 3AJAA 2QRHA 3JD0A 3ZKWB 4YJHB 4EM6A 4FYPA 2DLCX 1CUBA 3BEDA 3KV1A 1UJ2A 2GT1A 3KKPA 1L7NA 3FGNA 4I50B 4F4UA 5KC9A 5U9CA 1KMQA 5ICSA 4CQNA 1LK7A 2G6TA 1P9WA 1BA3A 1DWOA 2HAEA 2O3JA 2TSYB 3WYBA 2BSXA 3F73A 2WJWA 3K31A 3FNQA 4HNGA 4B35A 4B85A 5HQ3B 3UF0A 3MJVA 4ALKA 1FMCA 3DL4A 3TTVA 1CE8B 1YRQA 2NSDA 4AX8A 4IXTA 3GVIA 2QW8A 3DXFA 2QJTA 2ISCA 4UFPA 3M1AA 1I8TA 2ZT8A 1IB0A 5K3BA 4JVSB 1JB9A 3UMRA 4FDUA 4JEIA 2PTGA 3F9RA 4RIHA 2Z5LA 4V38A 4UCFA 3TZCA 3ZR4B 5CITA 2O8DB 2AZ4A 2V6IA 1QF7A 2WM2A 1QKIA 1Z7YA 4JJ6A 1EJ0A 1E7WA 1H1LA 3OZSA 3JWEA 3OZBA 4Z4CA 2GD6A 1W1UA 3KKLA 3DP9A 1IB6A 4Q3AA 1ORHA 2J3QA 4BO8A 2FPPB 4QDKA 5JISA 5TLSA 1ABBA 3PV0A 1MG0A 3DNFA 3DZHA 2YYZA 3S2SA 3U1TA 3GK3A 2BEUA 2ORED 2YBEA 4KUEA 2P75A 3HP1A 3MTQA 3TL3A 4H4CA 2OGZA 1RKQA 5IYZA 4C3OB 3HBMA 3SD7A 4EEXA 3OT5A 2GZ1A 3ZQJA 1J9EA 1EP2B 1AUOA 2WF8A 4NZNA 4RPGA 1RXEA 4AZ3B 1NJGA 5BSVA 2ID9A 1WD5A 3C6MA 4OJTA 4GOOD 4N7BA 5K0ZA 1JKJB 5P8WA 1KBQA 2AJ8A 1XD9A 3COYA 1H9BA 1Z06A 5E8JA 1XZPA 4HUJA 5HDQA 1EXMA 3UVEA 3ZUGA 2JCBA 4ETWA 3ZK7A 4F5DA 1KDPA 2D8MA 1AX9A 4ZO4A 3FF1A 2QZPA 4WECA 2G7ZA 2ZZKA 4FLFA 4X8LA 3S2EA 4I4TF 5HKKD 4X6YA 4D43A 2EBHX 5KYWB 3Q9SA 4UTXA 2HQ1A 4B0OA 2C8VA 4JU9A 4N65A 3BC1A 4OBWA 5KDDA 1A9XA 4JI7B 4H7IA 5JPIA 2XT0A 2N1MA 4JT9A 2HHHB 1RCFA 5DO9A 3MS2A 4IVPA 3MNFA 1EVYA 2CXSA 2HTEA 5LOVA 3BB4A 3M89A 3PR1A 1W0JA 1SBIA 2DF8A 2MMGA 3RLIA 3PHLA 3O8BA 3ON5A 2FFHA 1VHWA 2QG9A 2FSSA 3VNAA 1BYIA 2AR0A 2GZAA 3C4QA 3JVIA 5KHAA 5IUJC 1GGVA 1C29B 4WEQA 4XVUA 1GKYA 5AKEA 4BNZA 2E7ZA 4YT5A 2NYVA 3Q6IA 1GZSA 4UU0A 5LZ2A 2VR1A 3DE7X 1GO2A 1NNI1 2OBYA 3B12A 1E5DA 5JYDA 1FP7A 2Y6UA 1TEVA 1AT1A 3ST7A 1GNQA 2ZWMA 2P8JA 2QIPA 1W87A 1KK1A 1GYRA 1NM5C 1TYEB 2G09A 3RSHA 4ZPJA 2HJSA 2FF5A 1BQ3A 1ZK4A 2VJMB 3AJ9A 3EWIA 1SD1A 2C4HA 3F3KA 2OHHA 3WWDA 3CVVA 1C2YA 1ZH6A 3U80A 2W2QA 3E81A 3SYRA 1V41E 3A1CA 3FPAA 3RAEC 4E4RA 2VHVA 4LQ4A 3N3BC 5BVGA 3O3OB 5CFRA 2IDKA 3ZZUA 4MO2A 4EO4A 2I8LA 1GFIA 4BMZA 1IQ0A 3LIPA 3PXCX 3SX2A 1KGSA 5BR1A 3G02A 2R6AA 3KQHA 4K5QA 2BEVA 4IOKA 3D6MA 3ILYA 1IBRA 4XM0A 1RC8A 1M66A 2ANBA 4RVSA 4BBJA 3BE5A 1U81A 3B2EA 1N1EA 1PZFA 3CR8A 1SQSA 2EV9A 2H2HA 2VQ3A 5DEOA 5K4HA 3NTUA 5KWJA 1D2NA 2OV2A 5EJEA 5BNZA 4I55A 4AJIA 1XMJA 2FUNB 2I67A 1FS4A 4QPDA 4A6DA 2XRMA 3OESA 4RKRA 5AW5A 3HYLA 4K87A 4K8RB 1JHYA 3OQBA 1P2GA 3QX8A 4KQWA 4ER3A 1JH9A 1TTQB 4MAMA 2FMKA 4PG4A 2XE8A 4QUHA 1B6GA 1NRIA 5E6SA 5GVRA 3JD2A 1LNZA 1IN7A 2BN4A 4N7MA 4MIEA 2L17A 3WZMA 4OMCA 1NIPA 1BXRA 2WQ6A 3FUUA 1KAOA 5FPPA 4B7AA 1NDUA 4PZZA 1TD1A 4X45A 1ICEA 3GJ3A 3GMDA 1PR3A 3I09A 4GLLA 3RIYA 5K9ZA 4ACAA 4ZALA 5KOJA 1FS5A 3S81A 1PWYE 4YEDA 3OFVA 4FQ5A 4W9NA 1KKLA 3EZ2A 2X8BA 1FTYA 4MKRA 1PFQA 1X74A 1SIBE 4UM5A 1XCLA 3CUWA 3CZ4A 1E0DA 4LOIA 2YIJA 5K0CA 5JQGF 3IT3A 2J9GA 4MPDA 4E46A 2JVIA 1QORA 2GCOA 2WWIA 3OUUA 2VBIA 4DUPA 3EA0A 1I5RA 4N41A 1RJWA 5EIEA 2QIOA 1PCXA 1UBSB 1ZU4A 1GJRA 1PI3A 4JKYA 3ZWXA 3JQQA 3M6VA 4B73A 3UKJA 3FWPA 3DKVA 4RBNA 5B7QA 2HJ9A 4G67A 1CY8A 2C5LA 5D01A 1GTZA 2NXEA 1FYWA 1SBQA 4IDOA 2OPHA 4CTJA 2HUNA 2V7PA 1H4SA 3QXCA 3Q40A 5L6MB 5JC1A 5BYJA 1J5XA 1MB4A 4FOSA 4JMLA 1JHVA 2HDNB 1GZUA 2AQKA 4JBLA 4FDMA 2SKDA 1C7ZA 1N9KA 1R7RA 4PGFA 4CM1A 4PLGA 5JSQA 3NWEA 4DGQA 3PEFA 4LJYA 3ZE8A 2O3UA 3EA5A 5CMLA 1U8XX 3KHSA 4GOND 4TS3A 5IJAA 4BIMA 2RGRA 1H5QA 2GBLA 4J1NA 3O75A 3ZU2A 1NNUA 5F76A 1XHEA 1I6MA 1YWGO 4YT8A 3UMBA 3ZVMA 3ND6A 3FTDA 3AU9A 1DEHA 5DF1A 2FUCA 2I22A 3SHOA 1ZJ6A 4RYDA 2ATIA 1F2VA 1TGYA 5JRZA 2VHZA 3HSYA 2GR9A 1X1AA 3QOFA 2ZIGA 1T9HA 1RBYA 2FP3A 3N59A 3HM9A 4AN0A 2CJFA 2MYPA 3G9QA 2YVLA 3AP3A 1JEOA 2QVCA 1B3BA 5GMOA 2O8NA 3ZCSA 1Q7GA 5JTUA 2X6TA 3ZX4A 4ON9A 4KRYA 5K09A 3NATA 4EZBA 4QM6A 4XRRA 5EXTA 1VIVA 2UUOA 1UAYA 1V4VA 3HLYA 2CV2A 3V97A 4WZAB 4EHJA 3X2SA 1XDBA 4KIFA 4I1SA 2WU3A 1SB9A 2XA9A 1NMQA 4OXRA 1YFJA 4WKNA 1FJXA 1YIDA 4JA0A 5IX8A 1X3SA 3FNIA 5FBZA 3ZGXA 1MCZA 4ZGBA 2O59A 1O96A 3RG8A 2HIMA 1JN0A 2HEGA 2QM8A 3SVLA 2KM1A 2J0UB 4Q6WA 1WUJS 2YASA 1G59A 2GTHA 2WUEA 4FGJA 4GWGA 4LJ4A 1JS1X 1SN7A 4BVKA 3MJTA 1B6RA 4WZAE 5L3RA 1EESA 1COWA 2GFIA 3VTKA 3Q7QA 2VJLA 4OHFA 1KVTA 4HTFB 1TVKB 1G2OA 3KSMA 4UAJA 1BFKA 3A4TA 1W1WA 3JCZA 3O4HA 2ZRMA 1N4AA 2QX8A 2FSGA 3RFXA 3AF2A 4WLVA 3FHTA 2DZDA 3OHPA 3PEUA 1T0BA 4E5YA 3PL1A 2HKIA 2AMJA 3HADA 2C5HA 1YASA 2O3RA 3DOHA 3ELUA 5G40A 3WBBA 5HRCA 2IFTA 4G65A 3EXIB 5ALEA 1JEEA 5J4YA 1DX6A 2BMAA 2NTJA 3PWKA 3U09A 2POQX 3K6SA 2JW5A 4NZPA 4OO3A 3RS2A 1X1DA 2HF8A 1OLXA 4HPXB 3ZK9A 5KYTA 1HFJA 5A3VA 4F9FA 1ODFA 2CXHA 1M8FA 4L2IA 5JXIA 2GVZC 2Q5IA 1CDZA 3GRVA 2Z6QA 4A0FA 4U02A 1AUPA 2ATEA 1J8QA 2CYBA 1UBEA 3FSGD 4HR7A 3K53A 5DGIA 2IV2X 1N3LA 4WNCA 4ZT3A 1TM3E 1K66A 3PUZA 5H80A 3T5AA 1XRPA 1TM7E 4NESA 4BKOA 5KYYB 3R7BA 4B9EA 2Y0EA 4ND4A 1Y6ZA 3L6UA 1A8PA 3L0YA 4MYDA 1TCBA 3HFRA 2C4UA 2WZCA 3QJ5A 4MWBA 4ZYLA 2QUBA 4AX4A 1XRLA 5HILA 3A32A 2Q0XA 1TT7A 5ALWA 2O8BB 3TLAA 3UWKA 2UV8A 4OB8A 4JOBA 4W8GA 1I7QB 1JWLA 1A5SB 3PWZA 3HB4X 2DY0A 4A15A 2WSIA 1NUSA 1RLUA 1E8NA 1RAAA 4P2GA 4RKWA 1HBJA 3OF3A 3K4QA 3FTFA 3OHSX 3NBMA 1IEQA 4A0SA 1WXQA 1U2PA 4K3VA 5CB8A 5LP6C 1UBKS 1XTTA 2IXDA 4AMZA 5JNRA 3RWBA 4PC3A 1P3JA 1U98A 5ECYA 3C8HA 5IUKC 1XG5A 1ZMTA 3GYGA 2CWDA 4DL9A 2ZR0A 4UD2A 1HYGA 2XW6A 3ED5A 4RY0A 4C3ZA 1JXAA 2OAP1 4XR9A 2FDRA 5KJ6A 1OZGA 4OVKA 1ULHA 5EPEA 2BJWA 1O8BA 3HYRA 4MB0A 1XROA 4LVUA 1GUAA 1EGHA 1U1EA 3WMGA 3X2EA 1XL1A 4FT4A 4KXFB 3T6KA 2IS2A 3L02A 2HWXA 2JI6A 5PGMA 1H0KA 1OWMA 3FNEA 4HDCA 2BV3A 1H65A 2GS9A 5IYZF 5G3YA 1YNOA 1TW2A 2WU0A 1RHKA 3C5CA 4ALJA 4PN7A 5FPKA 3FTPA 5FUVA 4BNUA 3CR7A 4H1WA 4JI0B 5KVQA 4XJXA 3R3JA 1CJCA 3DFZA 4D1YA 4J4TA 3ZY2A 2XDWA 3DZFA 2OQVA 3UHFA 4K26A 1EZ1A 1NLUA 3IPXA 4FFRA 1H1DA 1Z73A 1W88B 4X95A 2CNDA 3D7SA 5CDGA 1RBMA 1VQ1A 3B2QA 5FWNA 3FBWA 2FWMX 4YCAA 4MQFA 3IHKA 2WIDA 1P1CA 1JYEA 1MJGA 1U7WA 2QU7A 2R1VB 1V11A 3A9RA 4I6GA 4KH1A 4TYMA 5DCYA 4BMXA 5JSHA 2OTCA 2AN4A 1UOQA 1IPEA 1JI0A 1IVSA 3MIZA 5CPBA 4NZMA 1E6MA 4J7UA 5LA6B 4B44A 4C0XA 4Z7QB 6ABPA 2GZ2A 5EWJA 3AEKA 4YC7A 2PA0A 2VRBA 4ZVLA 2H7VA 1KQGA 4EATA 5F2OA 1RMYA 1LV8A 2W8BA 4XB2A 5FWDA 4LDNA 4S1PA 1VSBA 3P45A 3PK0A 4RABA 3IQZA 3RRXA 4QICA 5JJ5A 1TTHA 1WNFA 3WGOA 1N32B 5BYAA 3INRA 2WLSA 4E15A 1MVNA 3U4QA 5JSKA 1CUCA 2H85A 4IFBA 2L69A 3Q7PA 2Z6VA 2XUZA 2WYVA 1JR3E 2BR3A 3U40A 5KINB 4XFKA 5JVDA 3QVVA 4H3SA 5T4HA 3LX6A 2D5AA 3ITKA 3KLPX 1XCOA 3NAGA 2VDNB 1JMYA 4KMSA 4PX2A 1JKFA 3GRUA 1JJIA 1HDXA 4W6ZA 3R9XA 3F46A 2IE0A 4N5NA 2CVFA 4UUMA 1GN9A 2C07A 1Z6YA 3A1EA 5KS2A 2FA9A 4MVJF 3LG2A 3L6DA 4LKRA 2B30A 2M6RA 2VPIA 3D31A 4D0GA 1TNDA 2CMFA 3EIQA 1HK7A 4FR2A 3L1IA 3U6BA 3KSAC 1N1GA 4KGZA 3EGIA 1C14A 1QNFA 5DYIA 2DWUA 4EENA 1TX4B 5JQWA 4DW8A 4F4JA 4QGBA 3O0TA 2O8FA 3NKFA 1KO1A 2F1HA 4NMHA 1T3ZA 2BOVA 3OH8A 4Z9BA 4B43A 2IEDA 3CG4A 3NBAA 5U4XA 1P5JA 4RTQA 1COZA 1HNWB 4QXPA 2GAFA 5EUQB 3D5TA 3JQAB 1Z82A 1QVWA 3PNLA 4P54A 2XWSA 1EUCA 1B43A 4I55F 1B14A 2ORVA 5F3DA 4D99A 1HZZC 1C4KA 2FEMA 1MV8A 3EOZA 4KN6A 3KJNA 3LVQE 3FHJA 5LYJA 2CV0A 1DO2A 1GFWA 4KXYA 2P69A 4FJ2A 4MRPA 2XX3A 4HZUA 4QQRA 3LTEA 4ZEVA 5KSYA 4P4GA 1FNBA 3SKVA 1OD6A 2IWHA 2NW6A 2Q1UA 2AB0A 4WHMA 5G0TA 2Q5HA 4IDDA 3UBMA 2XNJA 3QLJA 2JKVA 5HIIA 5J40A 2VDVE 2V7UA 1DLIA 1EB8A 3I1FA 3MOIA 3O4IA 1ZLYA 5FNZA 1P0MA 3PF9A 4X90A 2OHOA 2XVZA 4BO7A 1Z75A 4RKYA 1VLQA 3NKVA 2UUCB 3DAHA 3WDMA 1DIOB 5EMNA 5DM2A 3KEGA 4J2HA 1K7FB 2ABWA 3LSYA 4TRNA 2JGMA 5HCUA 3CH5A 2ZVPX 2K2QB 4NK4A 3C3DA 5JD4A 4CUZA 4K6KA 3ENZA 1P2SA 3KQSA 1Q19A 3ZV6A 4PF1A 5IF3A 1Y80A 1MPTA 3KYDB 3PUXA 3OZUA 1KFCB 2QJWA 4N3AA 2AOUA 1R9MA 5LP6B 3MW8A 3OKPA 4WN3A 3MRSA 3LC7O 1DELA 4DA9A 2CDBA 4R1SA 3DW1X 1C9MA 4UEOA 3E1SA 2C94A 3VNQA 5K3FB 2EGGA 3AB3A 3N87A 1SCBA 4S1OA 1M6EX 3OQNA 1LNQA 1QIKA 2ZETA 3ICVA 4QG7A 3SOZA 2W8ZA 3ZU4A 4NMMA 1X42A 3MRXA 1CUEA 1R8SA 1YQQA 3CNLA 5IVHA 4Q24A 4FW9A 4NSNA 3TPZA 2FOIA 2WJZB 4PYNA 5SYMA 4B4OA 4GR5A 5DN6D 1B8PA 1E0JA 3JRXA 2LCFA 2XOEA 3UCEA 3KB2A 1AGPA 1H0SA 1GAQA 5ICEA 5TF0A 3SSMA 2A0YA 2DECA 3QEKA 1M2NA 1PYOA 2ZBQA 4CM8B 4CUJA 3TFOA 3CWQA 3N2LA 4HH3C 4EGCB 1MAUA 2UXDB 1QV9A 3IIKA 5CT8A 2AFHA 4PX3A 4EKYA 1PVDA 3OP4A 1S3FA 1ZO8A 3RS5A 4K9SA 4INOA 1OFGA 1HWYA 4WZ6A 4OJNA 2XIJA 2AL7A 4AQDA 3FKSD 3EG5A 2O05A 3H3JA 3OZAA 3THWA 4E7PA 4X66B 3LD9A 1W581 2P9GA 2GEVA 4RDCA 2E5LB 1YDHA 2A88A 1ABEA 3NU1A 4H0NA 1P19A 3A6HA 4QDXA 4ALIA 4AUKA 2VP4A 3LT1A 2GPSA 2XUQA 3LNCA 2H2DA 3IOBA 4UXHA 3VR4A 3LHIA 4ER7A 1QGDA 4IIJA 3IURA 3M4XA 4FTWA 2IKQA 4HL6A 4REQB 4NRDA 2GYWA 5TMBA 2CSUA 3C6BA 4LJ7A 5F2NA 4YV1A 1MU0A 2HCJB 5I7FA 2H07A 1PF7E 2H2FA 2HA3A 4L07A 4QWMA 4ZZ3A 4JWKA 1TGVA 4GD3Q 5G53C 3T7KA 2QRMA 2ZB3A 2JF0A 5F1PA 1FUIA 5G3ZA 4C78A 3D8BA 3QENA 1T91A 3C6KA 1E2LA 4MLPA 1D1SA 4BN0A 4XQEA 1YSCA 4FK8A 4BX9A 2O14A 4CLOB 4CMEA 2CV1A 2G5PA 2ECFA 4ZZIA 2V1UA 1TZCA 3UJ7A 1K3FA 3KXDA 1SXJD 3S7TA 4DDKA 1XZFA 1QLHA 3BFPA 4V0NA 3N1UA 3U26A 1A9YA 1S02A 5L7TA 3SXUA 3IO5A 2D2VA 2DT5A 4PSVA 4KW7A 3F67A 4LXIA 1G3RA 1N92A 4GR9A 4AS2A 5EJ5A 5B3JC 4FGSA 3BK7A 4R71A 4MW7A 5CFZA 4YUAA 1Q7TA 2C8LA 3ZIUA 3UV3A 1HKHA 3T15A 1RZ3A 3R1IA 4TWJA 4X0EA 5SYAA 4FCCA 2F00A 1LB1B 3W3ZB 1FZQA 3PHBE 1QFJA 1CZRA 1FS6A 1IAVA 1HT0A 2Q6OA 2VPPA 2YZ7A 3E70C 3ZHVA 1QG2A 4LE0A 4AW9A 4XI9A 5HRAA 4BB0A 4MR8A 1E3TA 5GGYA 3WO0A 1FNMA 3RS0A 1C0PA 1A96A 5JMOA 5TQJA 5A4JA 4JU8A 3QU4A 1T2DA 4TXLA 3IV9A 3T7TA 4QJBA 4WXPA 4RPCA 5DK6A 3PUKA 3G0DA 2GO1A 1WDWB 4FZJA 4WN9B 4QYWA 1X39A 1WCIB 3A1VA 4PXYA 4TT8A 3ANMA 3K9HA 3SZUA 2V45A 3ZWAA 3EW7A 3PDHA 4FNMA 4N40A 2YWRA 3BSYA 1HQKA 1UK8A 2VRCD 3I4FA 2X4LA 3FVRA 3LW8A 2WT8A 3OAAD 4J0CA 2QXUA 3R5XA 1FFBA 2W2VA 2OUKA 3OFKA 4GMKA 3N9IA 2YHIA 3I12A 3VR6D 1A04A 4BNKA 3TRKA 4ISBA 4XIJA 4XOUA 4L3VA 3D1JA 5HGJA 5IT5A 2C3MA 3O82A 3OCZA 4HGZA 4WVFA 4IUBS 3RKUA 2IEZA 3VOTA 4D4KA 4EKEA 4LNUB 3U44A 2OCYC 3DMDA 1JPNA 3PC6A 1MA3A 5ALHA 5AXAA 4RHXA 4EJMA 3BE8A 4GI2A 3CFYA 4QVIA 3KL4A 1X9IA 4UU7A 2DPXA 4U0KA 3ZVNA 3R7DA 5K6AC 4NE9A 3RABA 1EP3B 1TTPB 4IR7A 1I0ZA 2VWGA 4MVCA 4RQBA 1W2HA 2IXTA 2W58A 1N8TA 2GRAA 1B1AA 3IOCA 1UXJA 2BZ0A 3ETEA 3N0XA 1CY7A 5LQRA 1P4HA 4HS4A 4TVBA 3QEMA 3QE4A 1OJ7A 2W48A 4HQFA 4L5CA 4HQLA 4NG5A 4ZC8A 3WYNA 1JQJC 1UZMA 4HDRB 4WW0A 1IY9A 4KAFA 5H5JA 4CKZA 1N5KA 4FCTA 3PNYA 1VZ3A 2I7TA 1VSQA 2J6IA 5K8TA 3IB3A 1KFJB 3VUEA 1ZINA 3HCCA 1ZD8A 1NBOA 3ISVA 4M99A 4E2XA 2H00A 1HE2A 5AW3A 4WOKA 4B5KA 1NXSA 4MDYA 4UHJA 1E6EA 2AMFA 1NZDA 1X7DA 2C7BA 4L5BA 3NEJA 1GPLA 1CIPA 3P4YA 3VX3A 1L3BA 1VGVA 2FRXA 3ZEIA 3SXJA 1LK0A 1DC3A 3HUEA 3T8YA 3N2NA 5GGXA 1F4VA 3MWDB 3R8CA 3VZDA 4A6XA 2HDWA 3IEVA 3ENKA 1TQDA 3UV6A 4B83A 1GFSA 2Q5QA 3HRKA 2Z6AA 1GPMA 2QR2A 4CHGA 4TSKA 3V2HA 1IG3A 4K6CA 3QEBZ 1I3CA 4AMGA 3H2BA 3V7FA 4PONA 5EINA 1E4EB 5JO0A 1X15A 3M2TA 4I6JA 1U6JA 4JYBA 3ACBA 3PENA 4OH1A 2J0VA 3U3RA 4BFWA 1GOTA 3C70A 4V1CB 3RTBA 5C8YB 3I9V6 3AVVA 5KX5F 4HDKB 2VT2A 2D00A 4LF8B 1O03A 1E1RA 4PGHA 3AFGA 5CCXA 2QBYB 5IXSA 1LFAA 1TZMA 1KY4A 2WDPA 4ZVUA 5DRTA 5FI3A 5KNBD 1SVWA 2D0PB 3DHNA 1IY1A 4A1OA 1NVGA 2Z95A 4BEWA 4JIGA 2P2CA 1J0AA 4LQCA 1VA4A 2CEAA 2DVMA 2V7XA 3ZHZA 4UNRA 3ENNA 4ND3A 1DRKA 4G9BA 4ZOEA 5HE9A 2X7XA 1L5KA 1X7GA 3L7BA 1YZHA 3Q3VA 1PV1A 121PA 2FEXA 1TJ5A 3N2KB 3OT1B 3R3HA 4N5LA 3QFFA 1PKXA 2F2TA 3WMEA 4HUQA 4YCSA 5B30A 5LXTB 1ZONA 2UZ4A 1B00A 1KSFX 2LNDA 4GZ5A 1I0LA 2YHAA 4BQQA 5EVCA 1PWHA 2I80A 1N5RA 4ENRA 2OY0A 4YJ2F 4Q66C 4TL8A 5IDYA 3EPPA 1E5XA 9LDBA 4K9PA 2DSTA 1DMRA 1L4LA 3CCFA 3RC3A 1R3UA 2DBZA 3RQIA 3NWOA 2NSLA 3OWHA 4DJ5X 3C98A 5FTKA 2WP0A 1IBKB 2PS9A 2YY7A 1E5TA 2HSEA 2RGYA 4CDGA 3KOUA 3TJMA 3LTNC 4WL0A 3UMSA 5KTYA 4LOAA 1Q6ZA 3KL2A 1J2TA 2OYRA 3THRA 4M60A 3GLIA 5L3SB 1Q2XA 4KPYA 4G1VA 2IP1A 4FU0A 1XKTA 2WE8A 4JLMA 1JLKA 4U6SA 1KAQA 4EGSA 1SUDA 3LPDA 1Y8CA 1GRVA 1MH1A 5AJUA 1DWPA 1EB9A 1TKAA 1MAWA 1RI5A 4E5SA 4EMTA 4JL6A 3WZ2A 4EHFA 2ZANA 4KLCA 1PLJA 2UZAA 3S6JA 4C6RA 4H7HA 4U7WA 3R0JA 2FWAA 4ISCA 4UBOA 1YJCA 1L7XA 5FJJA 4LS3A 1SWWA 3FJYA 5DGDA 1A9PA 1KU6A 1Z62A 2VNSA 2CFTA 1UBFA 1OPRA 3EXG1 4EGFA 3PEWA 4TPKA 4AQ7A 1PQPA 1N6RA 1Q7EA 5E0OA 1EWVA 2E6KA 5MHTA 4FINA 3OMXA 1R6VA 1Q16A 3B89A 1XCMA 3LC1O 1PVOA 3RVDA 2JARA 3IKTA 3IVMA 3ZKAA 2G28A 1NVEA 4KG7A 4Q3OA 1LLCA 1RM0A 4XM2A 4Q82A 3PKJA 3BWXA 3V4VB 3MHTA 4KE6A 5IH7A 5JZOA 4RIEA 1YF3A 3MBKA 3V4SA 2WHPA 1E3IA 3PGJA 4GR4A 2AUNA 2J6CA 3LHKA 2WV7A 3MSXA 1ZCJA 4G1BA 4NPCA 3UGKA 2XYHA 2G88A 3FZYA 2BZGA 1USGA 2ZITA 5EY5B 4LFCB 2YV1A 3A06A 3GGDA 4LY9A 1FW6A 3EVDA 5HA5A 4BQIA 1Z38A 3W4IA 3HFGA 1K68A 2B9EA 2Z04A 4L4YA 3QBEA 2HRBA 3JQBA 4JJZA 4UE3S 2B8EA 4XOIA 2EJWA 2G0AA 4UBLA 5K0FA 3EAQA 4WE3A 1NUTA 5FUYA 4LXQA 4A27A 2ZATA 1HLDA 4JP2A 3RRFA 3T7IA 2P2SA 1GV1A 1IE3A 3LU1A 1PO7A 4WKBA 5TR9A 4BVFA 4YH1A 3UIEA 1H9CA 4IIHA 4LTNA 2G1JA 1AS0A 1OI3A 2GEKA 2HUPA 4BX0A 2ZSBA 3C3AA 5KOHA 1GIAA 4U7GA 2QMEA 2C7OA 4G5OA 4PLPA 5CFQA 5K8CA 2JFHA 3QXSA 3DPIA 2F4NA 1TCUA 2B3TA 3TMAA 2PE5A 1NVXQ 2B0JA 3MT8A 2EKQA 3EFHA 5A7HA 1P4JA 3SEQA 5KHLB 2JEOA 2D5LA 4L5YA 2ORWA 4X20A 5HZGA 1JE0A 4DQ0A 4U2GA 3AHFA 2ZUDA 4HB0A 2GUGA 2W6OA 4K6HA 4MS4A 3RIGA 3X1WA 4UHKA 4HDNB 3B53X 3VYWA 4CCAA 4PWYA 4DV0B 4RW0A 2WTNA 3W2FA 2KW5A 4R98A 4PE5B 1DXOA 3BWMA 4WZZA 2VUIB 2YFYA 4G8JA 2ONJA 4CWAA 1J22A 4PLCA 1JVNA 1XYYA 2XNDD 4NENB 1MIOB 1TIKA 3CUKA 4PWZA 4DLPA 1NLMA 1XCPA 1UL1X 1QYIA 1YT5A 2IYAA 2HJWA 2ZYAA 3HKEA 5KI6A 1T5BA 3ZD8A 2P5SA 1S8NA 3GY0A 3NC1C 3OY2A 4IIJF 1U2GA 1VI6A 1AK9A 1R6AA 2BRUA 3NJ8A 4HB2A 4N7RA 4OHCA 4RE5A 3VJMA 1Z4MA 3T5DA 2J3LA 2YUIA 2FRDC 3ET4A 1OXXK 3U37A 3X1JA 3DDNA 4C4XA 4W5JA 1UT5A 3I9JA 3U7FB 1IHDA 3NHSA 3TINA 2QTNA 2Y05A 3TRJA 5B1HA 1MO3A 2Y1EA 3UMFA 2J3EA 4HRAA 4RSHA 3O8RA 4RY8A 2YIVX 4G0ZA 4MQLA 3GRCA 2XYQA 3HKDB 4MW4A 1T8SA 1D04A 1EWTA 1UKEA 3RJ5A 1JIQA 4DLNA 2ACWA 5CB0A 2H57A 3U7JA 3P97A 1SU4A 3ZCUA 5CFOA 5C18A 4ZTUB 1H3NA 2ZE6A 3TSOA 3RC2A 1QG0A 3GFSA 3PFWO 3VC2A 1XTKA 5C4IA 1AMNA 4DG9A 3MGKA 4WDRA 5J3JA 4Q48A 3O6VA 3W8RA 2R5NA 4XWAA 5T67A 1XA3A 2B92A 4UQLA 1BJKA 3D0KA 1B4DA 1R15A 4H1VA 3GD5A 1XZHA 1XXHB 1A5BB 1KYTA 1YJ8A 2G9ZA 2X8LA 1VLJA 3CKMA 221PA 2F43A 4JJIA 4J75A 3PVSA 4LRQA 1MOPA 5G4KB 3P4UA 2ORYA 3NIGB 4BMNA 2QRGA 2ZT6A 2JD0A 3FFAA 4R31A 2FU5C 3N28A 5ITWA 2QVYX 2IZZA 2QX6A 1FFXB 3OX3A 5CGZA 4TYPA 3B5IA 3JWGA 1Z4KA 5TRTA 4JLJA 3OQHA 1QP4A 1I2MA 2AFIB 3I42A 4YROA 3KWLA 1PDVA 1SZCA 4UFNA 1XXHE 2RGUA 4D8WA 3GGOA 3MOSA 4QODA 1JA0A 3GPLA 5KJFA 2X1HA 5L7WA 1P2TA 2RG7A 3B6JA 2X5XA 2BYTA 5CXUA 3BAZA 1FVOA 2ZRNA 1FL9A 2CJWA 521PA 4NJMB 1QP0A 4LJRA 4I1RA 4MW2A 4OQPA 4HLNA 3TZBA 1DKRA 5F3RA 3JASA 2BC9A 2AFIE 5C34B 4FGZA 4DVGA 4ABTA 2VYQA 3DHVA 3K0CC 4LHSA 2XGSA 1OYWA 3KB6A 1OZHA 3SHQA 4Q93A 3DW3X 1P74A 3FI0A 3G17A 1CUVA 2HEIA 2R4QA 4G36A 2Q5OA 4ZVMA 2OHGA 4ESVA 3FMOB 1YGYA 2D0DA 3HUTA 4O29A 4G24A 4YR9A 4MGZR 4B8WA 2EKBA 3C7DB 1M1ZA 4Q9LA 4KYIB 2J9RA 2P5UA 3CX7A 3IP7A 1CZKA 2I4LA 4Q3CA 1J4AA 4N5MA 4HS9A 2B6HA 3ZXXA 1E1QD 3PFFA 4RD4A 1AV6A 4KR3A 2VDMB 3GLHA 3ONVA 2IBMA 3QKWA 4XD7D 4JQOA 1NVKA 5CX4A 3WK5A 3NZEA 2N46A 5CA0F 1NUQA 3M6WA 1UFKA 2EL7A 2UUBB 1KQ3A 1TZKA 3G23A 4CDMA 3KT0A 3GWGA 5IH3A 3M5WA 2WWGA 3DUFB 2IEAA 1KNXA 2Q28A 2GEUA 4ZYVA 3ECSA 3AJDA 3FJOA 3UO8B 2VDQB 3EF0A 1W5BA 4B81A 3HA3A 1TVEA 4JR2A 1SVMA 1SRRA 4GMDA 1ZMBA 1N7IA 1GKLA 1RBQA 2JIQA 1Z35A 2RAUA 2CF5A 5U4QA 6REQA 1PN3A 1IJFA 5C3UA 5AVTA 2BONA 4GKKB 1KSGA 5F7JA 4OLFA 2IYNA 2IPAB 3CM0A 5HTKA 2M6SA 2YV5A 3EXEA 4LZOA 4DC9A 5CBPA 2SCUA 4WKPA 4PN3A 4NL4H 1Z4IA 2F1IA 4MGYR 2V6JA 3T4XA 1EG2A 2WWWA 4LI3X 1GKIA 4JKOA 5AK5A 4WQMA 4KZPA 2XUAA 1DGQA 2ZSUA 3I9V1 2P91A 3WV5A 4DPLA 2R6GA 3N2ZB 4F4IA 4URUR 3ZGNA 1S8AA 2IF0A 5IRCD 3U4QB 4LUCA 4LVNA 4RETA 2DHEA 2R7MA 2DEUA 1P8JA 3GGGA 5KTTA 2ZIFA 4S35A 1H85A 1T43A 5IDXA 5FQOA 3NFYA 1ZYUA 1N6KA 4DIFA 1TQ2A 1T3TA 4MX8A 5D3MB 3LY5A 3WRYA 4G0WA 5CDTA 3BTUA 3N05A 1CFZA 2PT7A 2YWFA 1BU5A 2OBBA 5FHQA 3ENVA 4HT3B 3L4BA 3PB3A 3QEOA 3HN6A 4CMAA 3SNHA 3PRKE 1S8FA 2OR3A 3D2CA 4Y2JA 1F4LA 4EAQA 3LCRA 3RVNA 3SFTA 1SXGA 2J3JA 2TYSB 2FMHA 2H48A 4C6TA 1NBMD 4EKIA 1GL7A 3BD9A 1YR8A 4MWEA 4CKEB 3GLQA 2FPOA 4U00A 3WHPA 2C29D 2AN5A 4R5HA 3JSAA 2C5GA 3LRXA 3QYAA 2NUBA 5JADA 3NAMA 2IWRA 3UWPA 1DB3A 1ZJ4A 2TRSB 2OBMA 1NV9A 4Z2AA 1MW9X 4L4XA 5H81A 3QXGA 4RAQA 5DASA 2WI8A 4RU1A 2JJ2A 5IKPA 1CP3A 1H8ED 3GGPA 1MDFA 1WBJB 3ZQ6A 3C7CB 1MMFB 3CYFA 3FIJA 3R6TA 3G2MA 4WA8A 4QDOA 1L0BA 1HY3A 2ZBPA 3HYCA 4M1KA 1NULA 5E1MA 5IFLA 2G0NA 4YYZA 2FB9A 3RS4A 2PMCA 3L84A 2Q99A 3WQBA 4GYYA 4KI7A 1RLTA 3DL7A 3IQHX 2CXQA 4OKIA 4ZAYA 3PQ7A 2YS6A 3OQMA 5IM5A 3RYIA 4BJ6A 5A4MS 1QH8B 3HMQA 2JFGA 1BDJA 3L82B 4G8CA 4YUXA 4MW9A 1QH1B 4M88A 2I2FA 3ZXUB 1M1NB 3WNVA 3LBNA 2VIIA 1I2BA 4HVLA 2Q3MA 5A9TA 4NQZA 1CU1A 2YJ5A 1U9YA 3RF6A 5TARA 1REQB 4BQNA 5C5DA 3OEYA 2GK6A 4IDAA 5DXJA 1EFLA 2AEEA 4ODIA 2XITA 1K6MA 1VECA 3K8YA 1HSOA 3SLKA 4EQZA 1NW4A 2P6UA 1K4MA 2NP7A 4X41A 2QB5A 1O5OA 5FBKA 4OQNA 1LH0A 2B1IA 2PRZA 4HPJB 2D5IA 2W93A 5A1JA 3NHKA 2ZRJA 1M75A 1W0KA 1Y3BE 5AKHA 4JI5B 3VI4B 1EUZA 3LVBA 4C7VA 3KYIB 4BP9A 1BN6A 3PJRA 4NYJQ 3I04A 1PR6A 4OHRA 1DCMA 1S01A 2M1XA 4IICA 3CEJA 4KUHA 1UKVY 4HXYA 2ID7A 4I81A 2XXJA 4WD3A 4ZOAA 5AKYA 3CY6A 4KXLA 4UE2A 4RZ3A 4Q15A 1Q7BA 5FQNA 3IBGA 3ZQ4A 5DNWA 4G4SP 4ZZ1A 2RH4A 1NQWA 4JHLA 1SVSA 2C96A 2PSDA 1M2FA 4K46A 2ZS7A 1Z8NA 3FSEA 1XCJA 3V1KA 1AB6A 1YBHA 1WVGA 3Q0TA 1OI4A 3K9CA 4Y6LA 3PGA1 1R18A 2Q4OA 4YJGB 3IX7A 4OHWA 1RFGE 3N0RA 3MCTA 1Z6XA 1EM8B 3QTLA 2Q0HA 3ZHSA 2A4MA 3AQIA 5AKLA 1VZ2A 4ZQFA 4PQYA 3I23A 5BMVF 4U2BA 1GGKA 4RH1A 3VNBA 3O7MA 3AUYA 1EE2A 1YIAA 1KYVA 2GARA 5JCZA 5DBFA 4IOLA 4URVR 2DQZA 1Z88A 4EFNA 3HVHA 3GVXA 2C3UA 2XNHA 4MKGA 3U4MA 3GELA 2VDJA 3KEFA 3ICOA 2PUFA 1W8DA 3EF3A 3FCCA 4GVPA 4LDJA 4XGRA 2OO5C 4ZQEA 5EHGA 1C0LA 3WRXA 3ZE2B 4ENSA 5IXYA 1AMUA 5C31A 1Q91A 1JQ5A 3PXAA 4KMOA 4RMIA 5EPOA 5EPUA 4A2WA 2QJRA 4D0NA 4YMUA 3W6ZA 1KQFA 1E60A 2J5XA 1KSJA 3BSWA 1SOWA 4ZDJA 2C84A 2JGIA 3QHPA 5DJ5A 2IOQA 3R5SA 4AVYA 4CG3A 4Q1FA 4B31A 1JV2B 2A8YA 2FSIA 2VDUE 2R751 3SR0A 3IKMB 5A4IS 1AHHA 4YJKA 4DILA 3G68A 3PLRA 5SY4A 2C20A 3TDNA 1QO9A 2HWUA 5K3SA 3PQCA 1ZGCA 3PUVA 4GX5A 4QO8A 1DC6A 3SS7X 3AY6A 3TSZA 1XZCA 1YI8A 4JLOA 5GONB 4D96A 1SVUA 1XN4A 1OOEA 4NZZA 4ZOLB 2Q5CA 1RWBA 5ALXA 3RYTC 5BRAA 1LPNA 1RYDA 1C1DA 3F9IA 5BWNA 5L3VA 1DG1G 2G4LA 4P86A 4DR3B 2C2ZA 2PX6A 3CW8X 2FCRA 2BGWA 1JFTA 3HVUA 4F11A 2XTNA 1E2QA 3LDUA 5GIPE 5IVDA 2DUNA 1EBBA 1NJSA 1CSEE 4KFRA 2Q49A 4ZI5A 1LZKA 1JG3A 4U7TB 4PSUA 2XEXA 1SXJE 4D3SA 4FYJA 2PL5A 2Y8EA 3D0RA 1EWQA 1KDYA 4P9NA 3UWSA 1SKYB 1UDRA 2J9FA 3O4GA 2QYSA 1H6CA 2Y1KA 2IP4A 3GFTA 1J2YA 1W1IA 5L3ZA 2WTXA 3AR5A 4AJ1A 3S2FA 2FZ4A 1A2QA 3TCXB 5CJ2A 3NBXX 3KHKA 3QMPA 2C98A 1JVBA 2GZRA 4M86A 4RIFA 2JJ8A 5EMJA 5CYGA 3QG1A 4FDAA 2AKEA 3H1GA 4ITRC 2RGCA 2VHXA 4N54A 4UM8B 1H1TA 4KUGA 3TFQA 3MMNA 4ZREA 3JQ6A 1JAHA 1VGQA 1SKYE 3OQVA 4A8JC 4KHPB 5TPZA 5BT9A 3CF0A 1N2XA 1T8PA 2H9IA 1P31A 1NR7A 1W52X 1WOYA 4W1QA 4YAOA 1QH9A 1KI2A 4LYJA 5CH3A 5HCIA 2HLHA 4BO5A 4CQMA 2GZ3A 4S0XA 3GMIA 4BEBA 1TMYA 1WMFA 3TQOA 1EUDB 2AKAB 2GF9A 4MUJA 4GYKA 3E9YA 4LSGA 4JI1B 1PRYA 2IBTA 1ORDA 2YQ5A 4N5IX 4ZMSA 2WFLB 5HQ3A 4LFBB 1SK9A 3OZGA 2FZVA 4Q02A 1B73A 5LNK6 3B1ZA 3A1DA 3IB6A 1F4PA 4DCNA 1PV4A 1IJEA 4GC9A 4LF4B 3VJLA 4DFDA 1Z5VA 3DD5A 4ZARA 3BA1A 2BVNA 5YASA 3D4PA 4G84A 2JIMA 2UZ1B 5GOTA 4F3RA 2FW8A 4L0CA 4UE6A 4EK9A 3KVVA 4RA9A 1QE3A 1RLOA 1QCCA 2IVZA 2A3RA 1WL8A 3MUNA 1U63A 1MBZA 2WD7B 3UY4A 3G8YA 3MGAA 5C80A 3CC8A 1JJ7A 1TTTA 1YR7A 1Q50A 1X8KA 2I4OA 1HT2E 2PXXA 2FPPA 4R3NA 3LOPA 4EX7A 4OHYA 5BRNA 5AKKA 2B4RO 1Z45A 1GM5A 4G5XA 3EGVA 4MQ4A 2A7QA 4AIIA 1JGTA 1F06A 2NO1A 2WE7A 1AK1A 1N2CA 5FF9A 4C5BA 1B8OA 1RTTA 4ZHQA 2IYVA 4QUGA 3DBLA 3I5MA 3BKXA 1JXMA 3L8DA 3WY9A 3ZNQA 1VJCA 2XMBA 3SG0A 3I1IA 3OBIA 1OH5A 1OAAA 1Q1GA 2NTYC 4MUNA 2ZIXB 1N9ZA 3IMFA 2ZI4A 4IMRA 2IYSA 4QYMA 1CR4A 5CVVA 5L3QB 4B33A 4J0EA 1L1EA 4IJQA 1US8B 4ZT2A 3AONB 3H18A 4P98A 4E5DA 4I9HA 3L7YA 4RHFA 5CIQA 2KYRA 4GP7A 4QUIA 4BMVA 3LAWA 4H7DA 2HBRA 2GD2A 2YWHA 3EGOA 5EHIA 1N5LA 1DXHA 1L3CA 1SCKA 3PGKA 1VPTA 4FR0A 4K9NA 1C9KA 3RFFA 3U7QB 3JZDA 3UTCA 1JH8A 4BEJA 3UMGA 4H77A 2VJDA 2X9VA 4KR2A 2CLEB 4R2WA 4MS3B 3I2FA 1C7JA 5HG0A 4EELA 5A4KA 5ELLA 4CIXA 1LUAA 4LBZA 4OGKA 3G13A 3G0IA 1O89A 1QHIA 4ZU3A 2I1VB 4N5HX 2WW8A 2YV4A 5A6SA 3PQ8A 1M7GA 3W7BA 2BT4A 1V1JA 2YWXA 2DBQA 3H4MA 4TVOA 1FVFA 4H6VA 4ZVNA 1U28C 2R6ZA 4GW3A 2B9VA 3NDPA 1S0UA 3K9QO 3LUDA 2Z2IA 4CDNA 4E07A 1YK1A 2DC1A 1QO0A 4EYSA 3TE6A 3B9QA 3MN1A 3SYNA 1U4OA 4J3JA 2WUFA 1T8TA 2JZOA 4ZEWA 3MUOA 1ULUA 1Z08A 2GA9A 2IRWA 4IZOA 3G2NA 1K8YB 3HYSA 3L6OO 4NQRA 5EE3A 4WSOA 3TQIA 1JBQA 3VQTA 4YV0A 3HJAA 3I2JA 2I6GA 2QVGA 2AT1A 1UDAA 4DMKA 4LDRA 3KTOA 4EFLA 1H9AA 3B51X 1ZFNA 4IQGA 1ECJA 3CHYA 3DWEX 3N2EA 2FP4A 4KVZA 5A4AA 4C03A 4Y6RA 3UK6A 3T52A 1CY6A 3PYXA 1DTWB 1LS6A 2YNMD 3AHCA 3IAS6 4TMKA 1AO0A 4MCIA 1KFKB 4PC2A 4D4GA 2RG1A 1O9BA 5DHTA 5LLDA 3PC4A 1NI4B 2YR0A 3HJGA 1JDNA 4EZIA 3CF4A 4UUAA 2Y67A 4NZ9A 1R8JA 3E18A 5J1SB 1KDTA 2NGRA 4F46A 1FUKA 2F9LA 2VATA 2F9FA 1RS0A 2ODNA 1XDZA 4HX9A 1ZI8A 4MA4A 4BE9A 2EGHA 1EXNA 4UOEA 4IIEA 4AICA 4QXRA 1RP1A 4OI0A 1PR2A 3HR4A 2A9QA 2IUTA 1G6OA 4TQAA 3VDNB 4HMOA 3ZU5A 1FMFA 1DC5A 4F85A 1XMXA 2B2CA 2R1TB 3I5UA 5J47A 3MS4A 2HV9A 3TLMA 2RH8A 1BCRB 2TMDA 1B0UA 2RK4A 3NR2A 1IC6A 2AEMA 4UEKA 4X8MA 4BB9A 1G3MA 1UUFA 3QPVA 4IDPA 1XEXA 3ZG6A 4IDCA 4NZOA 1GT6A 1KIMA 1YQUA 1B7GO 1BWQA 1Y5IA 2ZRIA 4YRFA 5I7AA 4UUNA 2QN1A 4Y9TA 2JFVA 3KT3A 4A8JB 3D7MA 3UUFA 1QIHA 5JQGA 3UENA 1GA4A 1C1YA 2O54A 3DDZX 3B6KA 2ZWIA 2GDJA 1WCXA 3ASVA 4YAUA 4JN6B 1QZTA 2PWYA 1WM1A 1J8VA 3CEHA 4GIBA 4HNAB 2A33A 4QU5A 1TAQA 1QZXA 4Y2HA 4KR6A 3OFND 3AR4A 1M2OB 2QLMA 1X8JA 4CTOA 1E0KA 2GM5A 4W5QA 2WJ4A 3CR3C 4ZRDA 4M0LA 4HWSA 2CF6A 5J2UB 2D2IA 2XSZA 1CPYA 2PKWA 3RSSA 4B6OA 4CKCA 3P2IA 2X14A 1FY2A 1K7EB 2ZBUA 2FK7A 3R3VA 4O2RA 1UK9A 3SLRA 3OM8A 2NU6B 4MYRA 4YAIA 3HCOA 2O50A 2IYYA 5E1OA 3SBOA 2V5AA 5EHQA 2HN9A 4L4SA 3TR0A 3FX2A 1RZUA 2ASVA 3HJFA 3AT1A 2I2CA 1OZFA 4OP3A 3O2SB 3U7HB 1BRMA 2WYIA 2H2GA 4JUCA 3TMKA 4RD3A 2W2LA 4Y7DA 3OZCA 3G8CA 5BXYA 1AJEA 5F33A 2ZSDA 3IV6A 3UUEA 2ZBDA 2P0EA 2I3ZA 3WFJA 3IIJA 1AQNA 1AQUA 2VA9A 2HREA 2V58A 3DNMA 2YWGA 4CIVA 1RPZA 1RXVA 5LQCA 2G7MC 3ANYB 4C4RA 1UBOS 2WTEA 4TTVA 4KDCA 4LX8A 4QUEA 1V16B 4NNJA 3AF5A 1EFCA 1H69A 2QAGC 3P0IA 4KDFA 4LWZA 1M1UA 4NV3A 1NSTA 2HQBA 4QREA 5LN1A 1VLVA 4C9BA 1UPCA 3GDHA 5DX0A 2GVDC 2HU7A 2X5JO 3I92A 1YCDA 5F7OA 3CSDA 4ILEA 5EE0A 4RPLA 3B36A 1DARA 4U4AA 1JRLA 4UVGA 3VR3D 5IULC 1EE1A 5FI0B 1XPJA 3CZCA 1WA5A 2FHSA 2JAHA 3N8KA 4PIPA