5B1HA

Crystal structure of cystathionine beta-synthase from lactobacillus plantarum
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
302
Chain Sequence
MLIQHVQELIGHTPLMALPIEVPNHSHIYAKLEMFNPGGSIDRLGAYLIEDGLQRGRVNAKTTIIEPTAGNTGIGLALATQAHHLRTILVVPEKFSMEKQVLMQALGAEIVHTPSEEGIKGAIRKAEALAATISNSYVPMQFKNPANPAAYYHTLAPEILADMPAPITAFVAGAGSGGTFAGVAAYLQAQDSATKAVVVEPEGSILNGGPAHAHRTEGIGVEFIPPFFDQVRIDQTLTIADNDAFAQVRHLARDHGLLIGSSSGAALAASLQLATNLPANSHIVTIFPDSSERYLSQKIYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and mutational analyses of cystathionine beta-synthase in the H2 S-synthetic gene cluster in Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Lyase
molecule keywords Cystathionine beta-synthase
total genus 108
structure length 302
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b1hA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b1hA02
1TTQB 1TYZA 5KINB 1FCJA 1TZJA 1CW2B 3VSCA 4HN4B 5CVCA 2D1FA 1PWEA 3AEYA 5HBGA 5IW8A 1Y7LA 5EY5B 2EGUA 3AEXA 4HPXB 3CEPB 5B36A 4KKXB 3IAUA 1TDJA 3L6BA 5DW0A 2CLKB 4I1YA 2GN1A 4HPJB 1J0AA 3V7NA 5IXJA 1C9DB 1Z7WA 4D8WA 1UBSB 5DBEX 4NU8X 3R0XA 4OREX 2WSYB 4ZQCB 1TTPB 1UINA 3PC4A 4IL5A 5B1HA 3SS7X 1QOQB 1TZKA 1TZ2A 1UIMA 2TRSB 5D84A 2EFYA 5B1IA 3PC3A 1TZMA 1KL7A 2O2EA 4L0DA 4D9KA 4D8UA 3IQIX 2BHTA 3L6CA 4ZU6X 1WDWB 4D9EA 2PQMA 5I7AA 1J0BA 1KFCB 1M54A 2ECOA 2TSYB 4ZU1X 5B55A 5JISA 4D9CA 4LI3X 1E5XA 1WBJB 2TYSB 5T6MA 4D9GA 2DH5A 1KFBB 3VC3A 2J9ZB 4LMBA 4HT3B 4COOA 3X44A 5B3AA 3RR2A 1FUYB 3VSDA 1J0EA 4D97A 1A5SB 1K8ZB 1QOPB 2CLOB 1VE1A 2RH9B 3R0ZA 5DVZA 3SS9X 1KFEB 2Q3DA 5JJCA 1A50B 3T4PA 2JC3A 4D9IA 2CLFB 1A5BB 1K8XB 4L3VA 3TBHA 4D99A 5I7HA 4L27A 2Q3CA 2RHGB 2GN2A 3PR2B 5E0KB 1BEUB 1RQXA 1CX9B 1WTCA 2Q3BA 5I7RA 3DWGA 4D9BA 1P5JA 1VE5A 2O2JA 3X43A 4D96A 1O58A 1BKSB 4OFXA 1J0CA 1V71A 5C3UA 2DH6A 2ZSJA 4LMAA 5IWCA 4AIRA 3IQGX 1VB3A 4XUGB 2BHSA 4D9FA 3VSAA 5BW6B 4F4FA 4HO1X 1F2DA 2J9XB 5CGQB 4QYSA 3IQHX 3FCAA 2CLMB 4D92A 4NEGA 1WKVA 1X1QA 1K7FB 4Y6GB 5B53A 3FGPA 2RKBA 3SPXA 2ECQA 1V8ZA 2ISQA 4D9NA 2ZPUA 4WX2B 5I6DA 1D6SA 1V7CA 2CLEB 5J5VA 5DBHX 4D9MA 2CLHB 4JBNA 1C8VB 5KZMB 4JBLA 5I7OA 1K8YB 1KFJB 5I7WA 1K7EB 1OASA 4H27A 5DW3A 5D87A 1PWHA 2CLLB 5D86A 3VBEA 3DWIA 3HMKA 1KFKB 2C2GA 5D85A 1C29B 4AECA 2C2BA 1Z7YA 1A5AB 1J0DA 3BM5A 4D8TA 2GN0A 3DKIA 1JBQA 2J9YB 2V03A 4L28A 3PC2A 1K3UB 4PCUA 3L6RA 3ZEIA 5J43A 1K7XB 1TJPB 2CLIB 2ZR8A
chains in the Genus database with same CATH superfamily
3C6MA 3O4RA 1D4ZA 3EPRA 4EUSA 3ZGYA 1TT5A 4OMFG 3C8ZA 1WXGA 4L85A 1IBCA 4C7VA 3PF8A 2LDBA 3QU4A 2FN9A 4DLNA 5LOVF 1CJMA 1M1NA 3O92A 2B8WA 1BC5A 1D4OA 1IQUA 1I3MA 1ODIA 1VFNA 1YRHA 2JJMA 2QE7A 4UCFA 5A71A 5BNIA 5KNBD 3FYTA 1V16B 3E9CA 4IOJA 4RPGA 2F43B 1CVLA 1K66A 4YRCA 2PT9A 2A1IA 1SCBA 2RONA 3GP3A 3H87A 3DEHA 3J7AC 3MB8A 4HZUB 4D8WA 4F86A 2UVPB 4I8XA 3OLXA 1NIPA 2JLCA 2R3SA 3AU9A 3KPWA 4EW6A 1N3BA 3KD2A 3R44A 1TUBA 1N75A 5K8JB 4EUHA 1T43A 4Y6SA 3DFZA 3U56A 5FULA 5LCXA 4YCLA 1E3EA 2NO9A 3H5LA 1U1FA 1T5TA 1WRBA 4OD0A 5CB0A 1Q0QA 4KE9A 5EIFA 2BHTA 5IDQA 1KYVA 4HDSA 4KI0A 4CKEA 3N2KB 3GNQA 1V3QE 3FPBA 4FDVA 4MVJI 1U0FA 2ZUWA 3K1JA 2PBZA 1OI3A 3MW8A 3UWMA 5HP4A 3OM9A 5EEHA 3TSYA 3AXSA 1B43A 2XQGA 2VSXA 5SZHB 3CZQA 1KJNA 1CYEA 3LLVA 3UAYA 4JVOA 1VHJA 1XU4A 4BWYA 4PRYA 1X92A 3OKCA 4KUHA 3E81A 2RGNA 3GMDA 4UVDA 4YJ2A 3HCWA 3HXQA 3DT6A 2BHRA 3L0IB 4D56A 3F46A 1JILA 4XVUA 4MR8B 3PVCA 3WL6A 4BE4A 1E2HA 1GR1A 2VBFA 1PG2A 5CP8A 4Q3OA 3RW9A 3IAAA 1WW2A 2CFSA 3L04A 2MWMA 4GLLA 4M6WB 4ZEXA 3OLWA 1XN1A 2ZJ0A 3Q7QA 1IZYA 3PEVA 4RS3A 4KI7A 3CIFA 4HNHA 1NZJA 1X1CA 1OWNA 2XF2A 3H83A 1XEXB 4ZOBA 5JRDS 3CLHA 2VPPA 3C3EA 5IZ4A 3PHBE 3CH6A 4K0RA 2IVZA 4M7WA 5HQTA 2AE1A 2QM8A 4DUGD 3M1YA 1WZ2A 1POWA 2OD2A 4ZODA 1NVGA 5GVSA 1K92A 3HVRA 2B9EA 1X1DA 4TWRA 3FPAA 1IUKA 3KYCA 1P2VA 2JZCA 4JX9A 1TE2A 5ESDA 2XWPA 3AWDA 5LP6C 4DMFA 1EVZA 1G18A 1TPYA 4PX5A 4Y6GB 5DBGA 1I2BA 3C5HA 3IUNA 1U2EA 1PT7A 3B5JA 2BSQA 5L95A 2HV8A 4HZIA 4CTMA 4IV8A 3ZE1B 2ZR0A 2WJGA 1AOXA 4RSHA 4X8MA 1ORRA 2OKCA 5D3ZA 4BGUA 3DOHA 3OIWA 1D09A 1GV0A 1LU9A 1V47A 3DQZA 1J5PA 3MT0A 2CYBA 3O1LA 4JP8A 4PQFA 1VL2A 4RZQA 2RGDA 2DRIA 1S1MA 2JFXA 3L8MA 3SQNA 2ZI6A 4DRZA 2A9JA 2I78A 3U80A 4CL2A 1OFVA 2AOXA 4EHNA 1LLUA 3NEPX 1YR3A 1DWPA 4FOPA 4RY8A 2GESA 3SJZA 5JAUA 2QVGA 4HVAA 2GJ9A 1SBNE 3U4QA 3L6RA 4IQ0A 5AJYA 2J4CA 4ZU3A 2ZRGA 2R84A 1C0LA 2QY6A 3MCUA 4JWKA 4Q9KA 2UXBB 2RG1A 1O87A 4Q4JB 4FMPA 3I09A 4J0FA 2WWXA 4BFTA 1HE4A 2YS6A 4LE2A 1FTYA 2YYSA 1JNYA 2BFNA 3SHVA 4I4TA 4X7RA 4BNYA 5DHFA 1M1NB 5K3DA 3A9RA 3Q72A 4X1IA 1PWZA 3U7QA 2G4VA 1SVSA 3DMFA 4WFQA 2IJGX 1MVOA 3BGOS 2GN9A 1W34A 2H2WA 2VQ3A 3H5TA 2O3RA 3F8TA 3TGWA 4D3XA 5JXWA 4PPQA 3GIWA 2C7PA 3R4VA 4Q7EA 1TYDE 4B73A 2YV4A 2FOLA 2I2DA 4OYLA 5BN5B 1BHSA 1D2GA 4YAEA 3PX2A 3R5KA 5DIZA 5B7NA 3MZ0A 3CGWA 4D9JA 1KH3A 3DOJA 3QXXA 4D0LB 3VO2A 2J3IA 3I05A 5CDSA 4N8SA 4QPDA 5LDHA 5NLLA 3EXG2 2V7PA 4U6SA 2DUJA 1VI6A 2XXJA 1QG4A 1XMPA 4R16A 1Q91A 3UJCA 1F3OA 2CDCA 2QTMA 1SPXA 2D0IA 4M8NE 4UQOA 4YCJA 2QYSA 4P4TA 2DVMA 1X14A 3G0BA 3N1UA 4FE3A 2FVXA 4J75A 2ZBDA 4WINA 3P9KA 1XB2A 4EHDA 3HUDA 3VYTB 1XZIA 2XZDA 1EVLA 2H5EA 4HTAA 4ND7A 5ELXA 2VAXA 4KNWA 2JBWA 2ZT5A 1NN5A 1QPBA 4N49A 4W7HA 4MGHA 1WW8A 1QYDA 3B1FA 4N82A 5AVRA 3VVMA 4MRMA 4DR5B 4ZCSA 4QTXA 5AW6A 2WQZA 4EOGA 1Q22A 1QFMA 1H2BA 3BXOA 4RY0A 3UC5A 4LRSB 3DVRX 2PUCA 1NUQA 1KK0A 1NR1A 2KQUA 1G55A 1U3GA 2G0NA 3O26A 4KXYA 2XQIA 3FZQA 2FRDC 2CE2X 2WF7A 3GFGA 5JU6A 5F9MA 3UCXA 3UCFA 4TYMA 3KU1A 4K2HA 4YDQA 5F2KA 3RBXA 4GX0A 4IVNA 3B6ZA 1SZCA 4PO9A 1XTIA 2WT9A 2IPLA 1XQ6A 3RJ9A 4DUZB 1RPTA 1XJ0A 4XFKA 5EJ4A 1T4MA 1JA0A 3H17A 3DNMA 1NI5A 4OFXA 5LC1A 1Y4ZA 5K8CA 3AETB 3DUFA 4DWWA 1U3WA 2E4ZA 3AB8A 1ZJWA 5HKOA 3CLVA 4M0MA 1ZUHA 3VKUA 4B71A 3UVEA 4F4FA 3JQRA 1MORA 1F2DA 2A4MA 3A31A 1GKUB 4KPYA 1KRHA 1M8KA 2IEGA 4RH3A 5FV4A 2EHJA 1U8FO 2W2KB 5L7YA 2JZOA 4DSAA 4IDDA 1E62A 4QLBA 1NQTA 1A76A 3VJKA 2WWYA 4KDCA 1XQYA 3U13A 3ZJTA 2CXRA 3CR3C 1N2BA 4BAGA 1NMEA 1RXVA 3F5DA 5EERA 4L9SA 3JVDA 2XD4A 3VTKA 3DO6A 2CCKA 1QFSA 5THQA 3VZSA 3JQDA 3WA6A 1JQEA 1DAMA 2UZ1B 2XNJA 1CCWA 2ZUVA 5CDFE 4HLQB 4EFDA 1YBAA 3UUWA 4CT5A 1M66A 1OB5A 1OH7A 4OFWA 1P0CA 3BB4A 4EQZA 2DR2A 4ESEA 2VP5A 1GZUA 1X1TA 2EBWA 4KNVA 4P08A 1QLHA 1PT6A 4JCCA 4JC8A 3X1XA 4CCSA 5FFMA 2IHYA 3BULA 2JANA 4LGVA 2QIOA 5SICE 1T5IA 3SOPA 3PQFA 1ZVJA 1JX6A 2AG0A 1E4YA 1OZHA 3BFPA 2JCVA 4M22A 3VKGA 3IT3A 2P5UA 4MJLA 3OEHD 1B3BA 1RTTA 1XNQB 2C78A 4YHBA 4ZVQA 3FRJA 5H5JA 1YR1A 9LDTA 2VKQA 4WBNA 3NWJA 4OHKA 1T8RA 5ERYA 5HOEA 1W5FA 3QE2A 1JHOA 3OO0A 5KMGB 1Z2AA 3JVIA 3GUCA 4LPKA 4F3RA 5M2QA 2JGLA 5C8VA 2OGSA 1PFGA 3OEEA 3ADDA 4D0GA 4H3KB 3JVUA 4FYYA 4X54A 4NCJA 1MIOB 2PSFA 3DAFA 3QXCA 5JSQA 3Q7EA 4RLSA 4J0QA 5JXHA 1Y6RA 2IWRA 3DXZA 1ENYA 3JZMA 5FTMA 4HQKA 3IEIA 1C0KA 2FU5C 2XQVA 2GDJA 1K06A 1DAEA 2J4DA 4D3FA 2Y8EA 5GGYA 3HFSA 2P4EA 3LH5A 1ZXLA 1KMHB 2FXIA 4W6ZA 2B36A 5G2OA 1LDNA 4CEJA 4AN1A 1PL8A 2W0MA 3BWYA 1YDFA 1BE0A 1ZC3A 3NBYC 4J2HA 2IUUA 2XYPA 4FDLA 4MYRA 3PDCA 3T7IA 4LY6A 4P4LA 4B4UA 4MPPA 5B4UA 1RXSA 4LHYA 5G4LA 3ZV4A 4MDEA 1SB9A 1VE1A 3A2LA 3EOAI 1F0PA 4JJ8A 4KJZA 4X8HA 4TUYB 4ZKEA 3UAVA 5LU8A 1TPZA 1R10A 1XYYA 4F5ZA 5C5DA 2G09A 5JS6A 3NC1C 1I32A 4QM7A 4EB8A 2IYQA 1BTOA 1QVAA 2GAJA 2GRJA 5I9BA 4BBJA 3U40A 2NZVG 2IV2X 4KH1A 1MB4A 1CX9B 3GV0A 3AQIA 1OFHA 1OCEA 3AUTA 4X6LA 3BXHA 3EF3A 4ZT2A 3SN6A 3TXYA 3ZI7A 4HAOA 4A1OA 4YQYA 2F55A 4MCAA 2PDAA 1XJ5A 2JCBA 3IVMA 4HBGA 4R71A 1GVNB 4IRUB 4XB6B 3U31A 3FLAA 5AVWA 2VPIA 1R4NA 5CUQA 1NXWA 2VZLA 1ZVQA 3IO3A 4FU0A 1FJ2A 3SGLA 3EGVA 3DD5A 2OHGA 4Z8YA 5FAKA 4MULA 1JT2A 2ZIGA 4PINA 2BR5A 1I9GA 3GRZA 1OT5A 4ENWA 1HGXA 3GT4A 4P83A 3ZU2A 3K5PA 4J7AA 2E0IA 1QAMA 1I7DA 2HWYA 1AQUA 2PD4A 4KMMA 2A57A 4QLAA 3R09A 5LD2B 4QNMA 1U3DA 3G7UA 2G5TA 4H6VA 4L5YA 1X7XA 4FJ2A 2O8BA 1NVDA 1EVKA 2VDVE 1IATA 2NVOA 4OFBA 2H4FA 4JI0B 5DRTA 5JECA 3HL4A 3WKDA 1K08A 3HV2A 3K6KA 1HDZA 3PQ7A 4MVJP 2XPCA 3VDNB 3ZCRA 3BAZA 4GZMA 4L8GA 3J81k 2XVMA 4KW7A 4RXUA 4DUPA 5KOHB 2C5FA 4ZEOA 4IDAA 4HDNA 2Y77A 1V95A 5EI5A 2YHIA 2IEYA 2Z95A 4G26A 5BPFA 3FHTA 3DV0A 1HT3A 3EW9A 3AL0C 3O31A 5IZCC 3ZQJA 1AKEA 1M2FA 1IN7A 2AC2A 2CVZA 3A3NA 4LJ9A 5K0FA 2VOJA 2ZBVA 4FFVA 3AILA 2P68A 3E58A 3C5WP 5IDWA 4BXOA 4P7KA 3MQFA 2CEAA 1EIWA 4C0LA 1CNFA 3OLZA 2XRMA 4LHXA 1Y7HA 2O8DA 1CUGA 2IYRA 2QM7A 1EHCA 3BMXA 3ORQA 4I4TB 3WNDA 3MWEB 4BP8A 2C9MA 3QTLA 4MVCA 2PZLA 3FCCA 4Y3UA 1TVEA 3U4HA 2LIVA 3TX2A 4JN6B 3IE2A 4ZV7A 4C3ZA 5K3CA 4L15A 4TYWA 5DHRA 4PN3A 1PBTA 2PS1A 1USGA 3CRRA 1RPZA 1XPRA 1F5NA 1Z17A 2YXBA 5CYOA 5KTNA 1PGQA 3IVRA 2AG5A 1SUCA 5LUAA 1NZFA 3ESZA 3SHOA 2H06A 3CMMA 3Q11A 1KMIY 3OLVA 3EAFA 2DWQA 3G8DA 2AVDA 4JHLA 4L08A 3KZOA 4RJ2A 1HFKA 1BHJA 3THXA 3TL3A 3STWA 1MJHA 3IDSA 4LQCA 3VMFA 1CY8A 1P4RA 5T5QA 1FBNA 4DA9A 4DMLA 3LUBA 2BGLA 1F51E 2CB9A 1VP9A 1ST2A 3H84A 5J4HA 3VUEA 1ZK3A 3ELDA 1RXUA 4N0QA 1COZA 1DC4A 1DDIA 2A5YB 4C2AA 3KQHA 3ZY6A 3F1LA 4ARIA 4JFAA 1DDOA 1M34E 5ECYA 3AP3A 1ZI8A 3JWEA 1XJQA 3TINA 3TLBA 1QB7A 1WU7A 3UENA 3DE0X 4TT3D 3DMDA 4W63A 4BWFB 1E6MA 4Y9DA 3DL0A 3WS7A 2YNMC 2ZRIA 3ILYA 1YVEI 1W4RA 3FOBA 3M1IA 1C1DA 2IUTA 4ZZIA 1URPA 3F3KA 3LXUX 1ZVMA 4GVLA 3EVFA 3ANTA 5JNSA 3AI1A 4YFVA 4AY6A 1FRFS 2I34A 1F38A 4PR3A 2R85A 4KRYA 3ZU4A 5HIAA 4AICA 1XP5A 2VBCA 3H2BA 5EZQA 1WXWA 4QYXA 2DFVA 1XZGA 4X1IB 4ZQIA 3UAXA 3U7QB 3O8LA 4GE0A 1JPUA 1YHNA 2J9XB 3K1TA 3L40A 2PBFA 4LHVA 4MQ6A 3TMAA 3A9CA 5B1DA 1D0IA 4ZXPA 1C7IA 3THYB 1XPJA 1TUIA 4WZZA 1X1QA 2C57A 2W48A 1G59A 2QP4A 2YXPX 4HVTA 2PZBA 4YLGA 2UXCB 4MZXA 4MQEA 1CZLA 1EB9A 4H7DA 5DLEA 4E51A 3IUJA 1U2DC 4OHYA 1VSQA 1UMBA 2IKQA 3LSYA 3OOHA 4G5HA 4NYIR 3TD2A 1E6UA 2RB5A 4YH1A 3AVWA 5HK9A 1VYTA 2PX3A 4IG4A 1X86B 2P41A 2YUTA 2DFTA 3IQWA 4RANA 3VR4D 2JLUA 2UXDB 3GD5A 1JBEA 3QA9A 3ZHUA 3KAPA 1B2RA 2W37A 4EGFA 5ILGA 5JNRA 3WRVA 3HDTA 4NZPA 4QOSA 5BOVA 3W5HA 1KEKA 2VRBA 4MGEA 1SURA 3IH5A 3W5SA 1KZ1A 2HM7A 3M6AA 5AM5A 3V80A 3EZ9A 1Z63A 3V00A 2VYNA 1OBOA 2GBFA 1JH9A 1SKYE 2OM2A 1SUSA 4PICA 2EJVA 1ISFA 3GLQA 5H81A 2W2LD 3LQ4A 3P7MA 3A6GA 3P2YA 3KQOA 4OQPA 4UHCA 4H1WA 4LBYA 1AO0A 2R1VA 1Q7CA 3BWBA 3GGPA 4L5IA 4RZIA 3FA2A 2YCLA 3T3OA 4JJGA 6NULA 1QGYA 4HH3C 3NG1A 1QIJA 2GN8A 3E9YA 3PRHA 4G5XA 4YQZA 1UMCA 1YS2X 4M1KA 4QXPA 1OKKA 3M4JA 4M49A 4EHLA 1D9ZA 3DE5X 4UZSA 3ZV3A 3THWB 4LZLA 1I94B 3ISTA 2Q6OA 4DJJA 4RTOA 4YREA 2CD7A 2XE4A 4B83A 3RC9A 3KJEA 2HLDD 1CQWA 4OHPA 2Z43A 3VHXA 3N8IA 1JG1A 1TGYA 2VAMA 3LCUA 1YH3A 2INGX 2FEXA 2QU8A 1YQGA 2CVQA 2R8PA 2ZR7A 4BZXA 2B35A 1Q7EA 4S1TA 3NBXX 1KNXA 2FZ4A 4B47A 3FTFA 1ULBA 4LYAA 2G0TA 2JHFA 3I28A 1Z13A 3MF4A 2A1UA 3G8BA 4U9IS 5DM0A 3W1EA 1JLKA 1H1LB 2WKRA 5DYNA 2OAP1 3OLYA 3WNCA 2UYHA 1B15A 4IF4A 1K2WA 2NVBA 1NRXA 1VLJA 3BZUA 1JAHA 1NL3A 3W7BA 2QDKA 1CDDA 2O0KA 4W9NC 3L6DA 5EE1A 3ZI4A 1IJKA 3I9NA 3UG7A 4DIKA 2ZYAA 3FZYA 3TBKA 4X97A 4F84A 5HW0A 1UFQA 5FNVA 1QOPB 3ASYA 2J09A 4WY2A 2FOXA 2OAGA 3LY5A 4G01B 4V3BA 1JDBC 5H16A 1KAHA 1KOJA 3GFSA 3U3OA 1PK7A 2CJWB 2RSLA 2DCUA 3KZNA 5EOVA 5BRAA 4CMBA 4ER3A 3E61A 1B8NA 2AR9A 2BONA 5I8ZA 4MIOA 2PVSA 3MT7A 1D0SA 3RS9A 1NT4A 3UKDA 2YFYA 4QYIA 2VAVA 3DXYA 1Z0SA 5E3HA 3JD4A 3L8EA 2R8RA 5JSZA 1TM1E 1E9SA 1LZLA 1KI1A 1T5BA 4E5NA 2G1PA 2P77A 2NX2A 1PQWA 1DJOA 1E5TA 2BFMA 1P31A 1USVA 1FTNA 1WKCA 4Q3NA 4QAQA 1ORTA 1KO1A 1OFIA 4HDQB 4TKUB 3AW9A 4C43A 3G2KA 3NP7A 1YDHA 3AR6A 5C0OE 1Z36A 3SBEA 1J1IA 3I8XA 1OAOC 1E3SA 4MCJA 2V6JA 3VYSB 3H9EO 3D2LA 3O4HA 4RC9A 2OENG 3NBMA 2C1ZA 4KO1S 5HUHA 5C4GB 2IEBA 2V8BA 1AB5A 3KEGA 3EZ6A 4UM7A 4A8PA 4G09A 4D4LA 3FOEC 4ZTUB 3DMGA 1AQJA 1E2QA 1B7GO 2PU5A 3L77A 5B2ZA 1HUQA 3SQMA 4KN9S 4ES6A 2I03A 3IMGA 4HQRA 4AK9A 2GSWA 3OQBA 4LV5B 1SBCA 2QRUA 3SVZA 2CDAA 1T2EA 2J3EA 2RJ3A 2WWFA 4OHRA 3U1BA 1FJXA 2ZTHA 3CVYA 1FTQA 2XH8A 3WIVA 1JBKA 3L82B 4UD2A 2R4TA 1RJEA 5K0SA 2ZIAA 1JHZA 1Q92A 1DWQA 1FC0A 1POXA 2H7XA 2FPPA 3N59A 1HEYA 4RK7A 4BU1A 3DE6X 5A05A 4PNEA 1MH1A 4ZRMA 1FEZA 3ASUA 1QF9A 2XUAA 3ME5A 3LC2O 3INYA 2ZJAA 2EEPA 4ZEWA 4QT4A 4YCNA 2CMHA 1U0EA 2QI9C 1YB5A 3F98A 1XYVA 2EERA 5CT4A 4YASA 1TTTA 2HU7A 4B75A 3B6IA 4EB0A 5HK8A 1ZN9A 2BJWA 3Q8XB 3WL8A 3ZEAA 3DF7A 1EHIA 5DTJA 1AKUA 2PLFA 2EFHB 2O52A 2WOOA 1REQA 4G3XA 4OOEA 2J5KA 4EO9A 3OSUA 2ZRHA 1FFDA 2FQYA 3KSZO 1W59A 1G8YA 2P3LA 1EDZA 1I51A 2ZITA 5CLFA 1ESCA 4NU8X 4YCAA 1FOEB 2MMGA 2QVBA 3R6GA 4LF6B 4G1BA 3ZE6A 4GZLA 1C30B 5DWQA 3H4IA 4OA8A 3WBJA 2ET6A 1E5VA 4TSFA 1DNPA 1RI2A 5KQRA 4BN5A 1PR1A 3QMPA 3T1OA 4GNRA 3CLUD 4CG1A 2AN5A 1TW3A 3DE7X 4PNZA 1GRCA 3A1UA 4MB0A 5DLPA 3PEYA 1H94A 4PC2A 1JFTA 3BWMA 5HCNA 2Y0EA 1SCNE 2X1HA 2JFOA 5FI1B 1X7ZB 1U0BB 4EA8A 5EXEA 1DOAA 1K63A 1M73E 1Y9ZA 4DYDA 1SUWA 5BWLA 2IU0A 1E9VA 2J6BA 3EEFA 2IY9A 4WLVA 4GLFA 5EHXA 3BT7A 2AB0A 1FNBA 1JFFB 1N9GB 4Z1MD 3HYRA 2Q9AA 3R3XA 1X3SA 1KOLA 2NXEA 4RCZA 4G5YA 1XU9A 4Y1GA 4G0QA 2QOEA 1F8YA 2HJVA 3P0JA 1U2QA 2X0EA 3LBHA 1ACJA 3M49A 3TJRA 1UJNA 5JJ5A 2I99A 4X62B 2ZIUB 2NTNA 2OP1A 4GG1A 4IAOA 4K81B 1Q2XA 2WAOA 3LDFA 3OCJA 1YAJA 3JQBC 1JQBA 1XOIA 4JLKA 3DC2A 1WSBA 4E11A 3L1VA 5YASA 1P17A 4GRIA 2IX3A 5GJWC 3E03A 4J0JA 3NYRA 1CUAA 5C9ZA 1K6XA 3MRXA 2W2PA 2VYVD 1LI4A 1ACMA 1VMDA 4AYWA 2VHVA 3PUZA 1MO4A 5AUPB 1VYVA 1J8DA 1ZH8A 3DMTC 4BAUA 3HYTA 2Y67A 5A2GA 2CE7A 4U8HA 1DRUA 1O77A 1QJ4A 4LC1A 3BE4A 3LHDA 3ZW7A 1JQ3A 1YFKA 2GPSA 2A86A 2ZXFA 3MHTA 3PYLA 2CLMB 1YBFA 4WZAE 4B6RA 1MOQA 1KJIA 4GI7A 3GP8A 4Y1FA 3RWMB 2GCNA 2YQ4A 4G86A 2FLWA 1FDWA 1N1GA 3K2BA 4KSBA 5SY4A 4O25A 2G6TA 1GGNA 1ZM3A 4OHOA 5A2QA 2IGTA 3FX2A 3U4IA 5EJIA 1C8KA 4C76A 2ZWIA 4P82A 4E15A 3ZK9A 4P34A 1BE8A 1HY3A 3FMFA 2ZUBA 3DT9A 4C6RA 1QP7A 2ST1A 2B3DA 4BKPA 2QA5A 1HE8B 1PZMA 2VK1A 2B1RA 3ET4A 3RIGA 3VOBA 2QY9A 3L1HA 2ZS9A 3DKIA 3E9EA 5DTEA 4BDSA 2SCUA 2HFJA 1M6YA 1EZZA 1QCDA 4RM2A 2DQSA 2GA9A 3HVKA 4FGSA 5CFRA 1G7CA 1GPYA 1MRZA 2R8OA 3B82A 4ZVVA 3SKXA 4XGRA 3MGBA 1L9XA 3AWIA 4UW9A 1E7WA 2QZ9A 3OZEA 2DLNA 3W3ZB 2IH2A 1RQGA 3CXUA 1S01A 1Z62A 4X94A 1CLUA 2ZE8A 4OQMA 1JDVA 2EGUA 1V2HE 1TJNA 2QMEA 2YWGA 4IDPA 2VFAA 4RY9A 4KC0A 4GQAA 4TGLA 5CCDA 1EDOA 1A2OA 2BM1A 3WG9A 4HUTA 2WVAA 3NFRA 4KE7A 3RQIA 3N8NA 1BGWA 5FH9A 1UKCA 3T1TA 1KDRA 1KEUA 4Q4AB 2PKRA 4E4YA 3EIQA 4MLPA 5ICFA 3AP1A 1JWLA 1TKRA 2A0FA 4ZGGA 2V1UA 2ZB4A 3FH0A 3K2IA 4Z7QB 2WSYB 4AO6A 3TKAA 3FCOA 4B7CA 2GZRA 2R11A 4ZVOA 2IZ6A 4LCBA 4D46A 2NPOA 4IIHA 2Y1KA 1QWOA 3PC8C 3OJOA 3I9V6 1YB2A 2UKDA 1DBQA 1IHPA 1Z82A 3G9UA 3QU9A 4NEQA 4A0HA 1IL0A 3VVCA 4BLPA 1YVRA 2ZVPX 1UOPA 1GU1A 3VGPA 5IM5A 1YQTA 4ZVPA 3VO9A 4C21A 2HBQA 2QXTA 3VV2A 1T0BA 5AIBA 5I01A 1HX7A 4AX4A 5THKA 4Y0VA 1NF3A 2NU8B 1ZAYA 1JHYA 3WNBA 5A9SB 3OP1A 3JU3A 1VL1A 5G3YA 2H00A 3TQSA 3PSAA 1Y6ZA 3IOCA 2VTBB 3W6ZA 2PX4A 2X6TA 5JADA 5EMLA 2JI6A 2A1TS 1PGPA 2J3HA 3MGAA 5FT9A 4D9IA 2TMYA 4LFBB 1A5BB 1HSZA 4KMSA 2IZ7A 3STYA 3GT0A 3D2BA 4IMJB 2YQZA 3MUFA 5F2NA 1QRUA 4HMPA 2H4WA 4NBTA 2O57A 2EW2A 4ZK2A 1Q7BA 3HA5A 2QBYB 4QDZA 3WSVA 4MW0A 4MXDA 5JSZB 2IYAA 2F64A 3OZDA 1N1DA 1M8GA 1MW9X 2HMTA 3HFGA 3ROZA 4R0MA 1GCOA 2H7CA 1CR2A 4F4IA 4OB6A 2WP8J 3GROA 1M1YB 3JQPA 3MPOA 3OJEA 2Z3WA 5EINA 2G5CA 4DWJA 2H17A 1BXKA 4LRWA 16PKA 1G16A 2GYUA 1B8UA 4ZN6A 5I7UA 2X5KO 2E48A 3AVQA 5EFZA 4KR2A 5A62A 1CP2A 1GKIA 4KQXA 1U9CA 3G79A 5AKZA 5I9NA 2D0DA 4FHDA 1XRPA 3SQLA 3UAWA 1NPTO 1T2UA 3EXFB 4QDXA 4U2FA 2ZYGA 5A0TA 2R60A 3LTNC 1K7FB 2V4MA 1HYBA 5EZ6B 2PUEA 3ND9A 4FFSA 4QICA 10MHA 1ZOSA 2YXLA 3OZ7A 2WUFA 3P9RA 4MI3A 5AOVA 3S99A 5EQJB 4TQGA 1CUBA 2P75A 2PWZA 3TXAA 1N7IA 4PZUA 4DN6A 4ND4A 5EYPB 1XEWY 2Y4NA 1EA5A 3IQXA 3NKVA 5J5VA 2CLHB 3MVEA 3O73A 1CUCA 4MVYA 3VBCA 1NTOA 1VPEA 2Y9PB 1XTUA 2B0JA 2Z4TA 3N2EA 3OESA 1WXHA 3RO7A 3NB0A 4QUGA 1UWKA 4MA4A 1YF3A 2VJLA 3HCDA 3KR9A 4WN9B 4QHSA 2EBFX 2QHXA 4BECA 4DMKA 1XLTA 4BVFA 5EUMA 3D4BA 1E61A 1JLRA 3S28A 4AJPA 3ETHA 3A1FA 2WPDD 3K4HA 3KXLA 3E22B 3NGLA 1G60A 3P0FA 1NR5A 2F3RA 2FMHA 3D9QX 4FZJA 4IDBA 4I50A 2AKAB 1IWPB 1WVMA 2PZAA 1GPUA 1MEJA 2W6JA 2PT6A 2VDUE 2HHCA 2YJZA 1GR0A 4Q21A 2I6GA 2JFGA 1CJUC 2VHUA 1M0TA 3HO1A 1YV9A 5DSTA 4RK5A 3BD6A 3HYCA 3P0HA 3DOCA 4JSTA 4M37A 4MKRA 5BN3B 2GD1O 1FFWA 3NIWA 3BXXA 3TOVA 3V2HA 2QL5A 4EO4A 4BPRA 3COSA 3SG0A 4FFLA 1AX9A 4AXXA 2J5XA 4QWWA 2B7BA 4L9WA 3LP5A 3RASA 3UK1A 3VR5D 2AMJA 2VBIA 3P9CA 2DKFA 4DCJA 1KEEA 2AE2A 1QHNA 2FZ5A 1NE2A 2JARA 1P2TA 2NXNA 2XHEA 2NQ2C 3OTWA 1HLDA 3TEJA 1MRNA 4DLLA 2I4OA 3IXLA 1KSHA 1RU3A 4B3MB 2IE0A 3P9IA 1EFRA 2PBLA 2VPYA 3IP1A 2A9FA 4GIBA 4PO1A 2QX7A 4IKOA 1KHTA 3ZX4A 1EJ2A 2P40A 1ZA1A 2QUKA 1ZISA 1L5KA 4LGCA 2PIDA 4HNSA 4W1RA 1IN6A 4EUKA 2G1AA 5GY7A 1NQUA 4OXNA 4KYVA 1NDQA 3CVVA 2Z0MA 1DPFA 1WD7A 4WBNF 4QNNA 4RMGA 1CP3A 3K0AB 2PSJA 2X9GA 5JWHA 3KV3O 1Y8RA 1G20B 2C03A 4CDNA 4CKWB 1S2GA 2FPRA 3MWDA 1GCAA 3G2JA 2CMFA 5JATA 1TU4A 4QARA 4KSCA 5IP5A 4P0PB 4BO0A 1CS4C 1HEUA 1NXPA 3O8DA 2GWHA 4U5XA 4UUQA 4DM4A 3HA3A 3OA2A 4L8LA 4RVSA 1DADA 3U5ZB 3LQ1A 3PDJA 1XZDA 4EK9A 1UMKA 1VJ0A 1GY8A 2PTHA 4JOCA 5FTWA 2F4NA 3A6JA 2FETA 1QQTA 3NHBA 3GLUA 4DTCA 2DTXA 1PX0A 2ZSAA 1B4DA 1IDOA 2X6RA 1R8SA 1ZGCA 3UB3A 1ZVKA 1Z6XA 2WWHA 5CRIA 1VSUA 3QI2A 3KALA 1AQNA 2NU7A 4FB4A 1EWRA 5LP1A 1P2DA 2EJTA 4GZ5A 3K7EA 1E8NA 3R7NA 4B3IA 2FSFA 2FEWB 3BTOA 1OTYA 3TNYA 1Z0KA 3ZCQA 1GCUA 1PJLA 3WBKA 1M3SA 3R8XA 2O2GA 3G3EA 4FYJA 4N41A 2WAXA 3FGPA 3SZGA 3WLOA 4GMXA 1Z7BA 1BH6A 1C50A 3DYBA 2X0RA 3FVWA 3K09C 3L0ZA 5AK3A 3LRXA 4N76A 1FYEA 1PD0A 1RVV1 2AQ8A 2KM1A 3BXGA 4RPLA 3V9AA 2WG0A 4UZFA 3SJBA 3S81A 3V1UA 1Z4IA 5I4IA 4HP8A 3RH0A 4OL0A 1Z47A 5A5EA 2WQ7A 1R9NA 1VIDA 2QS9A 2VQFB 2BFFA 3S8YA 1I3NA 3PEUA 1E1NA 3IAS1 4WRRA 4LMRA 2WSSA 1QTQA 4L5BA 4KN6A 1Z29A 2EKPA 2HN9A 3K9GA 4G0PA 1ULZA 4JFRA 5LQMA 1EDEA 5JBQA 1E3DA 2CMKA 5EAIA 2QAJA 1RTKA 2QUHA 1JAIA 4BO3A 2DWCA 5ICEA 3IEXA 3K0FA 1M6WA 1W8DA 1Q1ZA 3E1GA 2W0SA 4IJ6A 2WVHA 3NTOA 2DJIA 4RD0A 4LSMA 4J4TA 1DFGA 1CQIB 2QP9X 4RO0A 5LA6A 4CCWA 3NBKA 1E1CA 1FFSA 4HWPA 2QR5A 3D7KA 1V5GA 1FMLA 3DOEA 2JA1A 4RF2A 3PS9A 5KDOA 3ZK8A 2IL1A 3SLKA 2HIGA 3SYNA 4Z4HA 2ZRKA 4TVKA 1EA7A 3OPXA 1QG0A 4DG9A 4D74A 1JEYA 3OJXA 3KJHA 4O4IB 3CRQA 5F5NA 1ONOA 2XE7A 5JRJA 2H4ZA 1HO3A 4ZAXA 2EU8A 3HQ4O 1JEQA 4N9WA 1R3UA 3QPCA 4H1HA 5KHLB 2PAFA 2VDMB 4Q7KA 1QHYA 4YAOA 5A4MS 1LK7A 1AZSC 3WB0A 3DDWA 2A33A 4RZ3A 5FF9A 2H65A 3WL5A 3FHJA 1OFTA 2ZKIA 3HNRA 1WETA 2Z5LA 5EWJB 2AMVA 2ZBGA 5IX8A 2YJ3A 4KEAA 4H15A 2VT2A 2WF8A 3UANA 1S5PA 3AHJA 4M1TA 3DZIA 4Z4CA 4HVLA 3N2IA 3F0TA 1QO7A 2Z9CA 1DHTA 4OY3A 1S2NA 4WOPA 1AKQA 1BKYA 4JUAA 3C1TA 3I04M 1GGFA 4XTRA 2PL3A 5EWMA 4ZVLA 3W5IA 3BIXA 4MTLA 1UBUS 2R86A 2FFQA 3L4JA 1C3LA 1NNLA 2V6GA 3KT8A 4O1MA 1YL6A 3FTPA 5LQRA 5K3EA 8AT1A 3ZD6A 1S2LA 1LTQA 4MAAA 5BYKA 2VHZA 1C0PA 2VHCA 2OCBA 1MNAA 5BWNA 2YL2A 1UC5B 5TQ2B 4B48A 2HBYA 1A5ZA 1P77A 2HXGA 4FMDF 3SC3A 4MWZA 2HLDA 1XD2B 2A7QA 1G64A 3VAZA 4Y2XA 4ARBA 5DB4A 1ZR2A 5EIEA 4V0RA 2VTVA 1EFRD 3TR0A 2DCMA 2F48A 2YWBA 1RXYA 4KR6A 2BGNA 4YP9A 3ANYB 4J3NA 1ZD3A 1NNI1 3URMA 3V4OA 2H0AA 6LDHA 1SKMA 4XOIA 5CH8A 5ECWA 4QQRA 4NBUA 1U4NA 4M1ZA 3V46A 2AFHA 4D9FA 2A78A 3HVJA 1WB6A 1DOHA 2IHZA 3STHA 3NV9A 1JSXA 1QK4A 5J5AA 3VPFA 4JI5B 3SHWA 5BSVA 4O3MA 4ZVKA 5TQ2A 4FZ3A 2PJUA 3IBTA 3GGOA 3VH3A 3HEAA 3WXBA 1EK5A 4G67A 4YRMA 4YT4A 2OR3A 5ALSA 2NUAB 1TYAE 2YZ2A 4YRLA 1PD1A 1QVZA 2WAYA 2VSOA 1QGAA 1NVVQ 1OTHA 2VEDA 2XMGA 4LK2A 4Q00A 1IE3A 5B3JA 4I1VA 4HDKA 2DBYA 2VCYA 3MAAC 1N6PA 4TMTA 4P98A 3ZZTA 5BW5A 1VL5A 3QELB 4ZHQB 2QRKA 4N6GA 4Z2AA 1D5CA 3FSEA 4QQ8A 1I0ZA 2WSLA 3D4NA 3RIHA 3IJEB 2C99A 2OO5C 2YIMA 3QOFA 5DTIA 4DSZA 3O8OA 4Z0TA 3VC2A 3K53A 1TMGE 4G36A 1O94D 3S2EA 5K6TA 4K9QA 1DSSG 2DHRA 4NG4A 2RE8A 1P8AA 1EFVA 3B1JA 3JQFA 1JDSA 3QEOA 4PYOA 3SYLA 2TRSB 1UT6A 2NYVA 4HD8A 4ZOCA 5GONF 2X5OA 1RC1A 5CHEA 2R7MA 3T5DA 3A3PA 3G9ZA 5KNBA 4FD2A 4V38A 4DIFA 3MJ4A 2QLBA 3OHPA 2H1RA 2QRJA 3VR6D 1LQUA 4V0MA 3PPVA 5JI3E 1T9GR 1NJ6A 4CIWA 3HACA 2ZJYA 1Z3IX 4BFXA 4DM7A 1CUHA 1WAMA 3T41A 4QBGB 4L5AA 5G4KB 1G41A 4ERNA 5I8WA 3H4MA 1H1DA 4B6EA 3PC8A 2Y76A 1NY5A 4L02A 2RMKA 4JSRA 4BX9A 2IBSA 1QF7A 1YZUA 3R7LA 2X0DA 1RWNA 4P0QB 2H11A 2NZ8A 2VDOB 1L5WA 1G3QA 4QSMA 4R51A 5EN4A 4C7MA 2Y66A 5JNWA 4G63A 4XM0A 3GPBA 2P30A 1XC7A 4GNKA 5DXFA 4OQZA 5BXYA 3JQAB 5JZVA 1IN1A 1T5SA 1T6NA 2VDJA 1Z0JA 5BP7A 4D6YA 4KXQA 1FLAA 3H3FA 5KSOA 2EZ4A 3IL2A 2CNLA 4GD3Q 3LQ2A 2JG3A 3C8DA 2F7SA 3GDWA 2B4RO 2C1EA 5ELLA 3M5CA 4DZRA 1FUYB 1GTSA 3GLGB 3V1NA 3AOEA 1JR3D 4MI9A 5ERXA 1DTWB 1J20A 3PCXA 4YECA 1EVJA 1J6UA 1QIGA 1WMAA 2WM3A 1SCKA 3DC7A 3FKJA 3M7IA 4X84A 3Q7TA 2WM8A 4NH4A 2RHGB 4ZHSA 1PYOA 3STVA 3V32A 1SIUA 2Y0BA 2R1VB 7YASA 1BNCA 5J2TA 2FCRA 2JEOA 3BPSA 3IERA 2HZ7A 3QVUA 4LYJA 4RK0A 1SEPA 4C7KA 1N7GA 4X6UA 1PJCA 5H70A 1CY4A 2Z1MA 2XVZA 1W5EA 1HI9A 1GRQA 5D7BA 2K7ZA 4QA9A 3T5CA 3EIEA 4PVDA 2HU8A 4X44A 1J07A 4C4SA 5IAGA 2QJFA 2CKDA 3ASVA 4LJ6A 3ROKA 1RRCA 5DCLA 2WF9A 1JYFA 4MRNA 3EB9A 2ONYA 2RGNC 1C81A 3HMQA 4AC9A 5CA1F 1YC2A 4JJZA 5B4TA 4YN3A 3UA4A 3TIXB 5C5EA 3R0QA 2ZDHA 1GFZA 2NU9B 1N5MA 3TLCA 4CCYB 4F2DA 3OSZA 1L5NA 4GVPA 5KBYA 3D8UA 1P1HA 1Y9DA 2OWEA 2EX1A 3EAGA 4OF4A 3AY6A 1GG5A 1RBMA 3GDGA 4ZCPA 1FFAA 1NI4B 2PD6A 1M2WA 4XUEA 2IHUA 3RC3A 2XB6A 4LJAA 4C5AA 5BV7A 2NU9A 1SUEA 1H2AS 1UEXC 5I7WA 3WIBA 4PLYA 1I2ZA 5CX1A 4D82A 2XKKA 3ABQB 4I1SA 4HSGA 4NBRA 1I2AA 4YRFA 5MDHA 2AUNA 1FQOA 3L79A 3PT5A 2WVJA 2GBGA 3S7TA 1C0IA 2PMKA 2VYVA 2YS7A 4DBLE 4A92A 1LQ2A 2K5UA 4KTVE 3ZKWB 4IH1A 3RRMA 1I7QB 1JN0A 2PUBA 1NX9A 3TZBA 4KQKA 1KI6A 4BZZA 3D1JA 4UMFA 1CKEA 1SVUA 8LDHA 4M9XA 2X4IA 5E7IA 1U8AA 3MUOA 3OOEA 4FGJA 3QWBA 3JXEA 1Q16A 2GEDA 2GF2A 2IUSA 1DRWA 2BVNA 2Q50A 2QXUA 2WW8A 4FXPA 1V9LA 1FQJA 4GOKA 7REQB 4OLBA 1P4JA 1XZHA 3EG9A 1EWVA 3MWGA 4V03A 4XOUA 3UJDA 4YUAA 4JLSA 4O3FA 4LJ8A 4XR4A 1O94C 5HBRA 4DLPA 3GJ0A 3E2MA 5H1YA 2BT4A 3B5IA 1TAHA 4FMCF 1GGMA 1ZN8A 2ZI9A 1QDLB 1VLMA 3HCRA 3KDAA 2YN2A 1H2ZA 2Y0DA 3GAMA 3N8DA 2UUPA 4H7EA 1CF9A 2BFEA 3EG5A 4GQBA 4ARUA 2A84A 2GZHA 4XYEA 3H5IA 1WB5A 3TEMA 1N25A 2WK1A 4AMZA 3PVSA 3LDHA 3ZHTA 3DSRA 4HUQA 3R9IA 3WKAA 1DO0A 2IPAB 3VRHA 3PNOA 3BJZA 5AHRA 4FWTA 4JH0A 3I42A 1SD1A 2OCDA 3KE9A 3LPAA 4KQMA 4QUEA 3Q3HA 4ZU1X 4D4MA 1YAHA 5U9CA 3IP9A 4LJ4A 2OXCA 1S7GA 2PU7A 4I3GA 1UBMS 1ZRHA 2Z2ZA 3GEDA 2X2OA 3PE3A 2JD2A 4FN5A 3UGTA 4RPJA 5BT9A 1FL9A 2HCRA 4HXEB 1J0EA 1RC8A 1CF2O 3H1FA 4MPTA 3EVDA 2NZ2A 3PQ3A 1HYEA 4TL6A 1RFLA 4UHFA 5CBPB 2DKNA 1ZNYA 3IUBA 4EELA 4IDHA 5A3JA 2W00A 3R77A 1U2ZA 4YI5A 5FOQA 4H6WA 4ZQFA 2GN2A 5CLLA 1FP4B 2WYHA 3ELWA 1QYCA 2L42A 2FPWA 1WTCA 1UBFA 5K2MA 2EZ8A 4B7AA 3TRJA 1PZEA 3ZXXA 3N6VA 2V7VA 4V02A 4Q3BA 2AYYA 3RIYA 2YHSA 4BNFA 4X0EA 3LOUA 4JB3A 1XDSA 2C9ZA 2FPGB 5BV2P 2XVAA 4HH4A 3EDCA 1Q17A 3RS7A 1JP7A 1RE0A 3CNQS 4UU8A 1M72A 2BV3A 3WBBA 4ALIA 1XELA 2EWVA 3HC7A 4G5SA 5IWAB 3SBXA 1T1EA 2EKDA 3WGOA 3HM9A 4EECA 2O3SA 4YRZA 4P3XA 4QOFA 521PA 1T5DX 2PG3A 3T5BA 1NZDA 1ZJZA 5EJ7A 1XKTA 4DAOA 1QIFA 5EZSA 1KJ9A 4JU9A 5AKGA 5JNLA 3GLSA 5JRZA 1Y5LA 2PS0A 1C0EA 5JVDA 3KLBA 4TZTA 1PR2A 4RZUA 4X95A 2EKQA 3FTCA 3ETNA 5FO1A 5JO9A 3HCOA 2ZJ8A 1M2NA 1OQAA 2BEUB 3B6EA 4IHJB 4QODA 3QWIA 1G9SA 3VU9A 1U6IA 2ORVA 5CBKA 3D0QA 1ADFA 1D6JA 3CH4B 3KJZA 3OF3A 5A5GA 1IRXA 1XXHA 1Z4JA 1S3FA 2W2NA 3OHSX 1CUWA 8ATCA 1PDWA 4YQFA 4WT7A 3QFSA 1GN8A 1M5TA 2WYIA 4J0IA 2G8NA 4GPTA 1KZGB 4CLEA 1SQ6A 5M3BA 2L19A 5FP0A 4I36A 3PNBA 4N12A 2AOTB 3U44A 4HADA 1A9PA 1QTNA 1PHPA 2O7VA 2OHHA 2WG2A 4TLEA 2WMYA 4UATA 3TIIA 2IF0A 3QENA 4LOKA 3KVOA 3VSCA 2AN4A 3QYAA 4BXOB 1ADBA 1YUMA 3G0OA 3KJFA 2PJRA 1QH1A 2J59A 3AEXA 1BEEA 4F1WA 1Y6JA 4JQCA 1P19A 4PSKA 1B6GA 5IAEA 5U4XA 2I3DA 2Z4RA 3WXMA 4ISBA 5KYXB 3MCAA 2C7QA 5TEWA 4GO1A 4A7PA 5BN4B 3WC4A 5L7TA 2UZ3A 3KKNA 1Z08A 1Z2EA 2VUUA 2WU8A 3M1AA 4Q1VA 4RK6A 3W2FA 1MXFA 3KPVA 2VH1A 5EE3A 1ECCA 2FVYA 5BUQA 1CJSA 4A73A 2XMRA 1MGPA 4BRZA 2VK4A 3NVKI 3FOWA 4RUKA 3KK0A 1MF7A 3N7AA 1VDMA 3BRWA 1AJEA 3RS4A 4PYIA 4CKCB 4B33A 3EPHA 5J1TB 4TYYA 1ZJYA 5LXTB 3B6JA 1QGED 3PL5A 4MRVA 3SQWA 3DYIA 2H0QA 3UBTA 1N0IA 3U4AA 1DCFA 4QRIA 4D9KA 2BCJQ 1YIAA 3T1HB 2MYNA 5AVJA 1JAYA 2WFAA 5A4JA 4XR9A 5C8YA 3R5TA 1BEZA 4QFDA 2CVHA 3CX7A 1XA3A 2V74B 4JLWA 4HQNA 1W5BA 2DH5A 2P2CA 4MS1B 4OJKA 3EEBA 4L4RA 5KVAA 2R6AA 3PD1A 2ZIXA 5JO0A 4GSYA 2XUQA 3AP2A 2R00A 2JJ1A 4MINA 1TEZA 5BSGA 4Q37A 5LFAA 1B1AA 2WP0A 1WHSA 1YASA 4BGDA 1RXEA 3W34A 1G2OA 3PICA 3RUEA 4HNUA 3EGOA 5JPIA 1JJBA 2WZDA 5ED4A 2GYVA 1NRWA 2WDZA 2GLXA 3B70A 3B52X 4R05A 1R9MA 4CIXA 4B0OA 5C18A 5F64A 1YK0A 3RSOA 1PZFA 3OH8A 1HYGA 1IVYA 3EBLA 4OSOA 4M76B 1KJZA 1X13A 2H2AA 3EWSA 3Q3IA 4Z3DA 3VPBA 3A10A 3TLMA 4EHKA 1DIRA 1UM8A 1Y7TA 2Q3FA 3A7EA 3L46A 3JQ7B 1BROA 5F5LA 2JI8A 3TLYA 4ZO9A 1S9DA 1VL0A 1BHQ1 2TECE 4LZPA 5BSKA 6REQB 1RJ9B 2Y6UA 3B9RA 4QXAA 1ENOA 3C6XA 3SC4A 4JC5A 1SVOA 1F20A 2JD0A 3IURA 1E2KA 2X13A 1E2LA 2QTTA 3FFXA 1Y3FE 1ZM9A 3HB9A 3OEYA 4PLWA 3CNNA 1Q2UA 3Q8KA 3GARA 3HA2A 1W94A 2VTDA 2ZYVX 1CY1A 3ED5A 2PZFA 1YXMA 2WR8A 1MHPA 2QYTA 4UCXA 1DAOA 5ALYA 1J09A 4NBNA 2C83A 1N0UA 4G23A 1V3TA 1VBMA 1FS6A 1N92A 4Q66C 3V4SA 1P2BA 3ZLTA 3KVRA 2VP2A 2C98A 1KI4A 4NKRA 4OYRA 2AX3A 5KYKA 2OBXA 3CEHA 3JQQA 3ZVNA 1XMQB 3SIRA 2FEKA 4WEOA 1YQUA 4ODIA 5TVGA 1LLFA 1EBUA 2PX6A 1MJGA 1LXCA 3I73A 4GOOD 4MMYB 3RGGA 2JGEA 2QF7A 5CB4B 4J16A 1YO6A 2JKZA 4MROA 4A10A 3EUAA 1BDMA 1DAIA 1WVGA 2CJWA 1TFRA 2AHOA 2BFCA 1J8VA 3HU2A 3L49A 5FPQA 3T7CA 1YZHA 5JMTA 1J2YA 7MHTA 3L9WA 3H4TA 2N46A 4LDJA 4HFJA 3A05A 4PC7A 4TLMB 2IDZA 1S8NA 3GMTA 3TL6A 3ZVLA 4F06A 4NOLA 2IOQA 3MWDB 4KDFA 3RF6A 5TDHA 2FPPB 5LP6B 4L22A 5TGDA 4ER0A 3DEZA 1H0HA 3U7RA 5B2EA 1IDN1 3AVUA 1NW8A 3NALA 2M6KA 3PNKA 2WSSD 3RDPA 3V42A 5B12A 4M0EA 4BO1A 3NBZC 1SRRA 3LL7A 4O2BB 1QQ6A 2N1BA 4YXWD 5JMOA 3HRHA 1H2EA 1DFIA 3G9XA 4CLOB 4DLAA 5IXSA 3R8FA 1F7VA 1H1LA 4LZNA 2O06A 4IR7A 3TWOA 3HZZA 3ZDZB 1KKLA 4FM9A 1CIVA 2VDWB 4GMDA 2OXFA 4IP0A 4CQMD 4S2EA 2XSZA 2SKEA 3GL9A 3R5FA 5KTYA 4IUYA 4UE6A 2ZAYA 4PWYA 2VDNB 3AOEC 2CBGA 3RVRA 2JGDA 2O2IA 1SK8A 3HV0A 1NFQA 1UXKA 2AXQA 2J48A 4MYTA 4NZZA 2RI6A 5C4IA 5TS2A 2AZMA 3WLMA 1UOQA 3SS9X 5A4KA 3B20A 3MAGA 2VJOA 2BM9A 5B6JA 3TBHA 3NOXA 5D5HA 4BNKA 4F5YA 1H2HA 1IC6A 3NJRA 3NTUA 1OVGA 4MWOA 1R6BX 4B3GA 4UARA 4UVHA 4TKUA 1E58A 1R64A 4BX0A 2W2TA 5DNAA 1HDXA 3KAKA 2O2JA 1QHIA 1T4DA 5IF9A 3ZJUA 2XGSA 4OXXA 4BQNA 3AFGA 4ZYTA 1DLJA 4H7IA 4ZALA 3HB5X 3H2HA 1II8A 4PHGA 3QVTA 3SFZA 1YWGO 1GOTA 4MKIA 5I7FA 2RARA 2LCIA 4TWIA 4TLAA 4D0NA 5A5FA 3DM5A 1Z56C 5EXTA 3NHSA 2NACA 3OWHA 1ZCFA 2QUZA 3AL2A 5CHYA 4WK0B 4CM4B 3LVFO 4B74A 4MV5A 3E7DA 2A6PA 3DJFA 1N5RA 4UBJA 1E1CB 1VG1A 1UDAA 3NEYA 3N8GA 5B53A 3W3AD 4FQ5A 5E9JA 3S55A 3B7GA 1PNQA 3K0FB 1MO2A 1X8JA 3UPTA 5F23A 2A8YA 4GI2A 4KDEA 2E18A 3QX3A 4WK2B 4Z9AA 3RFCA 2HD4A 1MBZA 4EH1A 2GJSA 2OBYA 4YIHA 2CXSA 2WAMA 1YU9A 3MJFA 3ILXA 1O03A 3DV9A 3PFCA 2MIIA 4FKZA 3WFZA 5KSYA 2EFGA 3FYUB 3GUVA 4DJFC 3JQAD 5EPUA 5T4EA 4BUZA 1K7YA 1KY3A 1PFVA 4FGLA 1M9NA 2J9GA 1M8PA 1SEVA 1ZRNA 2JD1A 1UBTS 3BM5A 3ZS9A 5KDDA 3A28A 1XRNA 2F1RA 2GKGA 2G72A 1DQZA 2PWBA 3GFOA 4LE1A 5I3CA 1RHKA 2OP0A 2ZRBA 3TLJA 3WJ2A 5JH7B 3UB2A 2F1KA 4TKVA 1EFTA 4PLFA 1SD2A 2NSDA 4DA7A 3F73A 3AW8A 1AUQA 1FCJA 2V9CA 3E9RA 4AJ2A 5EKUA 4M6WA 4RKRA 2G0AA 4Q4DA 5FTKA 5JFGA 2ATVA 4OJNA 1JI0A 3CONA 2QTFA 2ZBRA 2HLPA 1H8ED 2HI0A 3PHGA 1FUKA 4RBNA 4DMGA 1GNVA 3RYTC 2I71A 1BU5A 1WZUA 1C4OA 3H2ZA 3A1CA 1UKYA 1JSZA 1NVFA 2NQ8A 2O7QA 4CF3A 2V0CA 4LZJA 2PXAA 3BGWA 3KKMA 4ZQCB 5HM8A 2G5PA 3HO6A 4ZOLA 5JYDA 5AVTA 5C7IO 2ERXA 2VJNA 3R7SA 2OO5A 3FDJA 4NJMB 1OC4A 4GWKA 2QU7A 3ND8A 2HNAA 3R3HA 4M36A 2B82A 4EGCB 4FOTA 3DPUA 4F9GA 3G2PA 1PQUA 4FGUA 1YUNA 4WHMA 1NXSA 2CHVA 4RQTA 1HZZC 1DC8A 5SYNA 3MIZA 2A58A 3C7AA 1FP2A 3HCBA 2HK6A 4OQ4A 1KZ7B 4JWTA 4L2IB 4ASUD 1GQYA 3NATA 2FMIA 5AW5A 3TW0A 3SEAA 4ZK6A 3VJLA 5B3AA 2BRUC 3VSDA 3FNGA 1Q3KA 1DT5A 2QXYA 3ROEA 1K5DA 3B6KA 4HB3A 4UEWA 5KU1A 4AS1A 2FEAA 1H6CA 3LD9A 4L6IA 4MV4A 1SHLA 1DTSA 1E3JA 3QU5A 3T4PA 4MS4B 4A2WA 4BMDA 2IYYA 5EZYF 2GEUA 4BJHB 1I30A 3ABIA 1U2RA 4FBMA 5IVKA 5DTRA 4Z9BA 3G85A 1GAQA 1IHUA 3D31A 4XPIB 4EZBA 1GTZA 2I3GA 4KIFA 4MX8A 4O29A 2V6IA 4UBKA 1MLDA 4XIFA 5DHTA 2GM5A 3WL4A 3KKKA 5EA2A 1NWCA 3GDFA 1NJ5A 2UDPA 1GVHA 1H65A 2HCBA 1BSVA 2XMPA 2GEFA 3ECSA 1ISMA 1I6MA 5E1OA 4AS2A 1OAAA 1IJFA 4Y6RA 3USCS 2Z5VA 4WL0A 2Q3JA 2WMDA 4GGPA 4BKUA 4B3JA 5TEVA 1J25A 1P0QA 2I22A 1C41A 3LM8A 2HQOA 4OG2A 4B0PA 2C9DA 1OFUA 4PYKA 5DP2A 1YNOA 2VQDA 1W47A 3PRJA 2VC2B 5IUNC 1JR3A 3FPCA 4MKZA 1NJFA 4XVQA 4I1RA 4HL6A 5HPYB 2P6UA 3FPJA 1VKHA 4UJ3A 4TS9A 4WE3A 2OCLA 4O6VA 3D6AA 4RV9A 2EBHX 4UASA 4TSFD 5GZ1A 3H8VA 4K9DA 2JF0A 4FYMA 1ZKMA 3WKCA 4EATA 3SEFA 5EE0A 1ZNWA 1RMQA 3N76A 4Y2JA 1R2QA 4REQB 4EVQA 1GM5A 2XNKA 2QDXA 3FSJX 3PKZA 3ER8A 1DUSA 1Z6TA 1A4UA 1FMTA 1PG0A 3CZCA 5CW2A 4HXGA 3G8YA 4U0KA 1NA5A 3LJKA 1Y3BE 3JQ8B 4JVLA 1FPMA 2AC7A 4DR6B 3IUSA 4NFYA 3D5EA 1GYRA 3A3KA 3V4RA 3M2PA 3X44A 4BNVA 1NC1A 2ZOSA 3KQTA 1W85A 3GFRA 3NAZA 2BRUA 2XX3A 4O4JA 5E4TA 3ZCPA 3FVQA 1ULUA 4HH1A 4ZJPA 1W93A 3HR8A 5IW8A 2JGMA 1V4VA 3C6YA 1NPYA 1N9ZA 3RYFB 5AM0A 2QD5A 3QX9A 4P5EA 1V4BA 2J3JA 1CRWG 4EB3A 1P9RA 1XI2A 2W2MA 1K27A 3H4VA 3LC0A 4G25A 4LBWA 2DY0A 1IJBA 1U2DA 4YLEA 5DWVA 5ED0A 1H4VB 3GUZA 1ECPA 3S1AA 2ZR9A 4CTNA 4XIYA 3TZ6A 4P31A 3O4VA 4ZAVA 3RK1A 1H9AA 3AINA 3LT2A 1KRXA 1XX6A 3WSWA 4BQPA 3WISA 4ZCIA 2XHZA 3P4UA 4QJ4A 2NUTB 1NI3A 4NRDA 4W5NA 2DY1A 2NYRA 3WRYC 4EBFA 2HXYA 3I3SR 2MJLA 2X3UA 3KR1A 5JS2A 3BMOB 5L9AA 2WJVA 5KNDD 2XYVA 1TRKA 2DPLA 2JKYA 2RJOA 3KKQA 3QW4B 3PUWA 1PNTA 3O84A 3ZS8A 3KVVA 3CVWA 1MVLA 4FQ7A 1RNLA 2MU1A 3ELBA 4DA8A 3OOSA 4XD7D 4EHBA 1VKOA 4MGZR 1VPDA 3JRNA 2PMWB 1VB5A 4C0AC 2MSNA 3LRTA 5CB8A 1NUSA 3PQEA 3PXGA 5ITZA 2HSGA 1G3IA 1E63A 3QU2A 1WEHA 3HGMA 4IQ4A 4GXNA 3O3OB 1A5SB 1OIWA 5GWXA 3A6HA 1OBVA 2OO3A 3RU9A 5HQ3B 5KYGA 2QN7A 1XZMA 4AKIA 1VXRA 3R8CA 4EGAA 2R5WA 3QNUA 3F4LA 5DBIA 2JLVA 3HDYA 1TYBE 1PJ3A 3U2QA 1WNFA 5IYZB 3AG5A 4LJ7A 4N5LA 5FUVA 3JZDA 1VSBA 4IY1A 2FRDA 1H3NA 3PFIA 5IKMA 1CQXA 2P79A 1OJLA 3SSNA 4I8IA 2SBTA 4F1KA 5IXYA 2BKEA 1FFGA 4PS1A 1SC9A 2ZT8A 4MJ7A 5C3UA 3W90A 3UTDA 2PZJA 3HUUA 4N6OA 4J1SA 3HTXA 2IHKA 1XAGA 2W2QA 2ZRQA 2LR0A 3JAMA 2I55A 2OBNA 2FPKA 1BS2A 4F3NA 2BEVB 4L73A 3QFRA 3Q2KA 4ZZ3A 5JIBA 4PZCA 4KWCA 5DIFA 2XCTB 1X42A 3AM5A 3HP4A 4Q93A 4WEQA 2WHEA 3H16A 1XQXA 2QWXA 3GPIA 3LT1A 4N65A 4NS1A 2YICA 1QE0A 2VXYA 4P53A 1HTWA 4H1VA 3M5DA 1KMHA 3WJAA 4H7HA 5EHNA 2BGWA 4C7XA 4D6PA 1C1HA 3PJGA 4M1EA 3SVLA 1M76A 3ENNA 1FDOA 4EKGA 4YBRA 4FKMA 1BQEA 1RW4A 4QHTA 3BERA 4YIKA 4D98A 3NHLA 1LK0A 2W11A 2X4GA 1XMOB 1N2CB 2QZSA 4EIWA 4F45A 5KU7A 1R0SA 4XFDA 2O8CA 1BVUA 3N7TA 4FFBB 5D85A 2XZLA 1QE5A 1CRQA 1KERA 3B9BA 3SNKA 2IYPA 2J3QA 2A5DA 5TC4A 2XAUA 4BFLA 2Q45A 1NVVR 2Y1LA 1NULA 4URVR 4II7A 5HJEA 5CM8B 4AMGA 4PYNA 3PGKA 5EP4A 1F1BA 4L16A 3TAHA 4I46A 4CQMB 5FOUA 2AA3A 3JZIA 2GXSA 5F3DA 1NSTA 3O8RA 4IGIA 5K01A 2C5GA 2H18A 2VUIB 2GLTA 1YS7A 1KJQA 2C61A 1HV8A 1DBRA 4HN4B 4WTOA 4DL9A 2O3UA 4ROSA 4ZMRA 5KB3A 4HDMA 3A9SA 1CK4A 1LBQA 2RHCA 2Y0CA 3HJTA 3KL2A 2DM6A 4TT3A 1NP3A 1BGXT 2I7XA 1L5ZA 3O8CA 5NULA 1WPQA 2AS0A 1YS6A 2PKQP 5JD6A 1KH2A 4XYBA 2ETVA 1ODCA 5DGTA 3V7NA 1UPXA 4BJ5A 1T1RA 3CGGA 3HVHA 2C0CA 3PPXA 4HAVA 5IFLA 5A1TA 1RM0A 3C70A 4P84A 1RE1A 1V8BA 1UT8A 3P9NA 1KBQA 4A03A 1IQ0A 1DDGA 3CM0A 1TK2A 2O4CA 1GL6A 4OHMA 2DUNA 4CIVA 2C3YA 1Y9AA 1PQPA 5ALFA 4KO4S 3KHSA 1IU9A 1STOA 2HL6A 4TUYA 3SK0A 1V5EA 3EGXA 3EWAA 1WCIB 3E0XA 3DP7A 3NAQA 1XNJA 3DLPX 5FYDA 3SIXA 4CM4A 1N9GA 3AR9A 5F5XA 3ZH9B 3HE3A 4QXMA 2ON6A 5JNTA 4MHSA 1JH8A 1SUDA 1CHNA 2XBLA 3FWNA 4Q47A 3FI0A 1E59A 1SHKA 2JGKA 3VC7A 2DPHA 4D3ZA 4FUTA 1RADA 5AW9A 5K05A 4U7GA 4G4SO 1X9GA 2XZPA 3A14A 3E23A 3F6CA 3G0GA 3R1IA 4FFMA 4BNZA 4DSNA 1QG6A 3CW9A 3PGA1 4TKZA 2OLKA 3K0SA 1ETUA 1JWBB 1E2FA 3R3WA 4Q03A 1DBWA 2HHAA 4RFSB 4LHWA 4RW0A 3GLIE 4OLHA 4M0PA 1L4UA 2B2XA 4JBGA 3T15A 3MXOA 5FYQA 5FBVB 3MTJA 4ZPJA 1V25A 3SZUA 3W5UA 2I6SA 2RAFA 3ISJA 5IVPA 1BD4A 2HMUA 1QK5A 1W36D 2YJ4A 2VJPA 3U7IA 4A2PA 4DIUA 5J2UB 1H5UA 4U39A 1JHAA 3NXKA 4ZO4A 3J7TA 4XDZA 4RV4A 2A59A 1YDMA 2QR3A 2FSVA 2R1ZA 3MYRA 1VKRA 1DZIA 3WK4A 1L7NA 3FZGA 4NOJA 1E2UA 2YCBA 2KSQA 4LW8A 4XD7A 5AMXA 5TB5A 3WGYA 5JYBA 1U98A 4W99A 3D0RA 5COBA 4W5JA 4WKGA 2I3BA 4MWCA 3D6FA 3MS2A 4KYTA 4NHOA 4O4LB 4JYAB 5ITZB 3OKAA 2AVNA 4FEGA 3EUFA 3ZGOA 3PXXA 2PLAA 2EP7A 5EJ5A 2PT7A 3S2IA 5BQPA 2OGUA 4HNRA 2X0KA 4RU1A 4J7CA 2NZJA 1Y4SA 3G17A 1RRGA 2RIPA 2YBEA 3SCZA 2ZM6B 1J7KA 1TKAA 4LDNA 4HYTA 5A9TA 3P52A 5T41A 5IKEA 1K8YB 1N9KA 3V2GA 3ZQ6A 2K7FA 3EQ6A 1UBOS 3BB1A 1I7PA 1MIHA 2FRVA 3PENA 4HR7A 3TI9A 3LKBA 4MQFA 4JNCA 4MWTA 1LV7A 1UP6A 3V1MA 4BQSA 4DBZA 2ZAMA 3CNEA 1JVSA 4PFQA 2P4QA 2WPDA 5L3QA 1M6NA 1E2NA 3ETCA 1J0DA 3C4JA 1W2WB 3LLCA 2PUAA 2NZXA 1UF9A 2F3PA 2YYAA 4KXLA 4RJLA 1G19A 3SC2B 3L7AA 3H05A 1W25A 2W2KA 3KOUA 3OFNA 2VNHA 3PTLA 3AEKA 2PSEA 4MR7B 3VNQA 4A0FA 1J8MF 4F72A 2GERA 4J43A 5BSWA 5C51B 3P97A 4FHGA 1G8MA 1KY4A 3PDHA 4XCXA 4HYQA 3T7TA 3AHDA 1XCMA 4II3A 3RARA 5CM9C 1BS1A 1GT91 1QRRA 5AKHA 2YJ5A 3E6AA 1P2UA 5EEGA 3IJRA 2YFKA 3RANA 5AW8A 4DABA 1YT5A 2B20A 3L7LA 3DUFB 2QMZA 4B3BA 4BCDA 2BP7B 2QLNA 4OHVA 4D2IA 1EFAA 1I1QB 5H02A 1S0UA 3BKXA 2QZ4A 1FFHA 1ULHA 1E1QD 1UXIA 4KYUA 1Z4NA 3UIEA 1ACLA 2J3MA 4BJ3A 4WNAB 1VLHA 2C5AA 3UWSA 2Q3EA 1MAUA 4X3CA 1KSFX 5KVCA 4CMEC 2WUWE 3VR3A 1F8XA 1TVCA 4KH0A 2FQXA 1N6LA 1V3VA 2BEUA 3L8CA 4IHJA 3RPEA 1Y8QA 1L7PA 2NTVA 4PSVA 1QRTA 4BYGA 1RP7A 4E32A 4DANA 2ZZMA 3GEPA 1RXCA 2BD0A 2C2WA 3W8NA 3PUJA 2H48A 2NT3A 1NUPA 3SDSA 4YRRA 2AR7A 3HYSA 1LRJA 4JLMA 5U4QA 3PXDA 4XA8A 2AUMA 3TW8A 2W9XA 3G1TA 5H68A 3RT7A 4N48A 4MWSA 4FSDA 1XEWX 1FUIA 4QPPA 1P3DA 3QF4B 4J8PA 5CA0B 1D03A 5JDIC 5CPFA 2XNSA 1A50B 1EXMA 4B17A 3QM1A 4GBMA 4K9NA 2BL4A 4ZT6A 1JQKA 3LLMA 3HCPA 1VKZA 4ZXFA 3KWFA 3AZQA 3OY2A 2Q7OE 4BQIA 1HLPA 4D4KA 5HVNA 2IEZA 1JMVA 1OXVA 1P5HA 1MQ8B 3I5MA 1AURA 2BEWA 4P38A 1ZL0A 1UQUA 2EEZA 2JAWA 4RHYA 4TLBA 5D6NA 5B58T 4MW9A 3ZOKA 4BLSA 4CR7A 5L53A 1H85A 1OBFO 5IH7A 2WHPA 4Q7LA 4U7FA 2EX0A 2HRQA 1XR3A 1QONA 2EJWA 3LX6A 2XTNA 5AM2A 3ZZ0A 3QXSA 3S2GA 1XALA 2XSZD 2R1TB 2VSQA 5B3LA 5J2TB 2QTCA 1FXUA 4DBVO 3ZX5A 3S2YA 1TOAA 2XDAA 1W30A 2ZYHA 4AG6A 4JOQA 1E7QA 1GFIA 3NYIA 4MQFB 4NK4A 1TCBA 4BWGA 1XLVA 1RHQA 1RAAA 3KUDA 1EFDN 1UZAA 3IELA 1GLVA 3ITDA 5JTTA 2BYTA 4G84A 3RCBA 1D7AA 3VR6H 3A1TA 4CXMA 2FK7A 2WJPA 1DMSA 2AJ8A 1PJ8A 3C24A 2KMLA 3CH7A 4WUVA 1OHHD 2G88A 3M33A 3SSOA 3SP1A 4UTRA 3OZBA 3KZMA 2P69A 2XIQA 1EZ1A 3VPGA 1PS9A 2IBTA 3G0HA 4ENQA 4QJBA 3JTMA 3D4PA 3NRBA 2D7CA 4WKBA 3UN1A 1BJKA 3EGCA 4OP2A 1TK9A 4X5OA 1IRIA 1QE3A 1IBSA 1ELOA 1Q7TA 3AJRA 2IPOA 3QOXA 1Z8FA 3KV1A 1G5PA 3IGFA 3CISA 3OA0A 1X15A 4MKGA 2FFJA 1N6OA 2Q5FA 1PBNA 4BVHA 1TA0A 3ND6A 4QGFA 4G0XA 4PV7A 1ENZA 3TAXA 4RAQA 7REQA 2C77A 5IN5A 5I9SA 4NY1A 1IQRA 1WSAA 3CX6A 4JLUA 4K26A 5F7JA 1H6AA 3E9ZA 3IKVA 5KDLA 4E3WA 1KARA 1U9IA 5AI4A 3A9WA 2WZQA 2H3HA 5CIWA 5EHGA 3T5MA 4U4AA 3DFFA 3HFJA 1CVRA 3IYLW 4Z99A 2QTHA 1H22A 2FMKA 2IP4A 3HXLA 4CUZA 4F8EA 3BORA 3GLGE 3QV2A 4C4OA 2OV1A 3IVCA 1JEEA 3V33A 3FR7A 2PGIA 1OD6A 1TT5B 2HWWA 4FSHA 1UINA 4URWR 5DO9A 3DW3X 3I23A 3MJVA 1QKIA 5G40A 1XV5A 4PZAA 3TW4A 3MJRA 5F4BA 3H86A 3LPLA 1FXSA 1O9BA 1FSGA 2ZRPA 4AZ3A 3I1JA 4B3XA 2FQ1A 1AXEA 1PZGA 3KQUA 3NEAA 4KLNA 1ZD4A 5DK6A 1UJMA 2P2LA 2J6CA 2OYSA 2UYCA 2RGRA 2YH2A 2ZSHA 2OM6A 1W1WA 5D01A 4Y6PA 3R7DA 2AFVA 1CB0A 4OXYA 1SK9A 1UBHS 3AFNA 1N6KA 1Z5OA 2GYYA 3FLEA 4IEFB 4WZBE 4JLPA 2Z2XA 2QZZA 1AGPA 5K4AA 1KFBB 4QU9A 5KAPA 3TFWA 2JGIA 2RDMA 1H2RS 1P44A 4RF4A 4B2LA 3AF0A 2YMQA 1B0UA 4M46A 3L84A 3BTSA 3AUUA 1JFSA 2F90A 2CMDA 2E89A 2NXWA 4IW3B 4JJ6A 1NURA 5EESA 2Q5LA 3T9FA 2B98A 3QKUA 3ZIDA 2V7BA 5DGXA 1O95C 3ZU5A 1OXXK 1P8JA 1HWYA 3UBMA 2I0FA 3H75A 3R0IA 2GMWA 3EWIA 3OQOA 4TQUS 4KXWA 2W6OA 3NHYA 2CUZA 5EL0A 1GRVA 2QN1A 3F97A 1NM5A 4HCJA 1GQFA 4R2JA 3VU8A 1PLJA 1V26A 3I1IA 4ID9A 3ENZA 5AXCA 3WLPA 3WP0A 4YYEA 1LDBA 2D3WA 3V8EA 2P2GA 2ZXEA 4DA0A 2VWGA 2ZJFA 4QU0A 3E5HA 2FWPA 1AV6A 1SZPA 3IAXA 4EY5A 1CJTC 2II6A 1GAXA 4CLRA 2HBZA 1ZONA 3K31A 3TMYA 5SV2A 2QMQA 2RC6A 2ODBA 2AEFA 4AF6A 4ZEVA 5LOVB 3NC4A 1RHRA 5ER6A 1QTRA 1ESNA 2HA2A 1KMMA 5FJIA 4KVZA 1JDUA 4RNDB 3KQWA 2P2SA 4ZVSA 4EZEA 5KJFA 2H6EA 4HFNA 1QRSA 5JH7A 5JPCA 3SE0A 3I4FA 1INLA 1SVKA 4QXRA 1NYLA 4EG3A 2DFLA 3MCVA 2CLEB 2YINC 2OHOA 3RFFA 3WYCA 4PXSA 1ZESA 1EAYA 1D2MA 2W6QA 4H4DA 5AK0A 1LJ8A 2X19A 2OB2A 1I80A 2ZI5A 3PL1A 4OHUA 2ZI7A 4TWAA 2JAUA 2MYUA 3M9XA 4CQLB 1JECA 3LPNA 3K9FC 2ZAGA 2Q9BA 1DEHA 3GLFE 3HP1A 3MTBA 1ETHA 2I8AA 3H6GA 4WXRA 4QTYA 4XWAA 2R7LA 5IKOA 4WK4B 4UZEA 1Y5RA 2IE8A 3G23A 4QC2A 2COKA 2OV2A 3E2IA 4TWJA 5F52A 4ILEA 2FUCA 2B92A 1RJDA 3C3CA 3I6QA 3L0OA 3MHPA 2GJAA 2FWRA 4B3CA 3K70D 4OIMA 1G8FA 1NQ5A 2PQ0A 1JG3A 3TNFA 4DIOA 1NJ1A 5FPSA 1LPNA 1OYWA 4HAZA 1WXFA 1TQHA 5DZSA 1P9WA 2IOHA 3QVMA 3KTAA 2IIQA 3CS3A 4LSZA 3GDOA 1CUVA 1KEZA 3RIMA 4BHTA 3K3PA 2C4VA 4OJQA 4YDHB 4HQ6A 3I2GA 1C4KA 2NQTA 3ZR4B 3CZMA 3E1KA 1ISIA 4IUCS 1J22A 4POAA 2OMEA 5P8WA 1R4NB 1J0AA 1Y1TA 2DTEA 4HEHA 3T5GA 3GO4A 4Y9RA 1OJ7A 2AZDA 1C9DB 2G25A 3VNVA 2CHUA 2HJHA 2I1VB 2VR1A 3RT9A 4HDRB 5K3OA 3TGPA 3TIVA 1Z8NA 3NCTA 1WSWA 4MH0R 1PHRA 1E7SA 4LVNA 1FJHA 1R8JA 2H2IA 2J87A 4A8TA 3RS2A 1NVMB 1DTEA 3L7MA 4YX9A 1EUQA 2EHDA 3P94A 1L5HA 2P9BA 1JWAB 3HCCA 3WAKA 1W44A 4GAEA 4MV0A 2NYAA 3KWMA 4YTEA 5JT1A 4ZC1A 2FSUA 4J07A 4MLCA 3MWLA 4KVFA 4D8UA 3UJBA 5TT1A 1AHPA 3LDAA 5HJ7A 4A0SA 1U94A 5BV0A 1BDIA 4UAUA 5ALJA 5JVDF 2J3LA 4RYDA 1KU6A 4IQGA 4B87A 4FIDA 3EULA 2VSFA 3L0CA 4JLOA 4MS3B 2FKAA 4OJMX 4P4NA 5BSMA 1XTBA 1QYWA 1GRRA 1J39A 1X77A 4AU1A 4KQEA 4GUAA 4J1TC 4H1TA 1TI7A 1NAIA 1M0EA 3DAGA 2XKAA 2JDIA 4DM3A 1Z4PX 3DL4A 1RRVA 1NXQA 3U1TA 4E1VA 2OFWA 3ST7A 3D0OA 3UM9A 1RC0A 2KB0A 4KHPB 3GU3A 2YMPA 2C4HA 2Q0SA 4ZDWA 5KX5A 3PXCX 2ZJ6A 3AIIA 4LJSA 4TLDA 1LJLA 5EGNA 1NN3A 3UAGA 4MI1A 3WLSA 1YR2A 3F7MA 3B1VA 2H0RA 3ZC3A 1Y48E 1T4CA 2RCYA 3EUEA 4JBHA 3DG9A 3F6YA 5JS8A 2W6ID 3ONVA 1F9EA 1WKBA 2X8WA 3C48A 2P5SA 3E7PA 4HDRA 2XGOA 4HN2A 3IOEA 5LZ4A 1XD2A 4LPSA 4KITB 1QC5B 2OGTA 2LD4A 4ZO7A 2OCPA 3N0RA 1QS0A 1XAHA 1YS1X 2AT1A 3JQ8A 1C9MA 4O08A 4YWHA 3G59A 4ZCRA 3F5MA 3KZVA 3UPDA 1ZGBA 4R9SA 5AW1A 2IZ1A 1OFGA 2YC4C 1JDBB 3BSFA 1VYUA 2NO0A 1P45A 3I9KA 4BCCA 5JJIA 4ZDIA 2HCJB 1ILEA 1E7MA 1VMAA 4L3WA 5A04A 1JIJA 1JG6A 3VPDA 2ZKLA 3W6UA 2REXB 1YE3A 4D7AA 5EXDA 5FL7A 4JK3A 4R84A 4JDPA 4LYEA 5CXSA 5HKKD 3CSSA 4RTRA 4UULA 1GGEA 3NU1A 1B6RA 1U8YA 2FUKA 3MLEA 3TE6A 4YRKA 2YN4A 3HBNA 1NJSA 3BGVA 4IFBA 3BD9A 3KWLA 4EL0A 1KI9A 2ODAA 4TXJA 4LF5B 4NI5A 5K3SA 1ZG3A 3LWNA 4TV8A 3RIEA 5JWRA 3HXOA 3EXHA 5EP2A 4EQ6B 3MMSA 1RACA 2O05A 5HMMA 1U8ZA 2DMRA 5T64A 3ROFA 4PY2A 3QF7A 1TM3E 2X42A 1SUFA 2P6PA 3FI9A 3KEOA 2PVPA 2NUTA 1HEIA 1WUIS 2GTIA 3DHNA 1KVUA 1KZHA 1Z4QA 4LOIA 1XTQA 2W70A 4CF4A 1RZRA 1TKBA 2I2BA 1SD5A 2JI4A 1HTTA 4Q15A 4N0EA 1LWNA 4TRMA 4ZOLF 3QZUA 1HK7A 3I30X 1NONA 3LPDA 4Z3KA 2PL9A 4DR2B 5CFLA 2XGJA 3HBJA 4GRAA 4Z4FA 4RPHA 3RC2A 3SR0A 1V45E 2PZMA 5DEIA 5A3QA 1N78A 4TRJA 3HA7A 3RVPA 4GPZA 1P74A 3GRRA 3HCFA 1PFWA 3WFJA 5FFFA 1GXSA 3V4LA 1UAYA 3OZCA 1JIQA 2GZSA 3WGJA 2QB5A 4WLEA 3WYFA 2BMVA 5ELMA 1HLGA 3FPEA 3AESB 4J0HA 1UIMA 4XIIA 1M5UA 3CCCA 1GZ4A 2IEIA 3AEQB 3MJHA 4Q7MB 3U4CA 5F9HA 3BGSA 2X8BA 3TW6A 1CQPA 4FFOA 3H7AA 4MR9A 2IS1A 2VF7A 4MJ3A 1AU9A 4MGYR 4Z5XA 4RKYA 1KFCB 1Q7RA 1NBEA 2A67A 2R7AA 3K20A 2OBLA 3CLSD 1AHHA 4LY9A 4NYIQ 4REQA 5B37A 3ROGA 3HCNA 5DULA 3KQKA 1WA5A 2N1MA 3AUXA 1NG9A 1TF2A 1JHVA 5H4GA 4UU1A 1UDBA 2YJ6A 4NS4A 2F4VB 1Z22A 2NSJA 2EX4A 2VJAA 1UOOA 3NS7A 1GPLA 5CA1A 1MOSA 4GMFA 1FVOA 3ZIAD 4YJ2F 3S27A 3C3DA 3D8HA 2QRPA 1KZYC 5BYAA 1V37A 3KSDO 3QVGB 1XBTA 3T8YA 1XNRB 3BD7A 4CMKA 4BMYA 2IS6A 3MTQA 4YYZA 1UM9A 1KI3A 2HWXA 3GNSA 4CG3A 3E82A 4PZDA 2UZ0A 4FYWA 3TAUA 3P2IA 3II6X 4BV9A 4C3VA 4BKOA 1N2HA 1R3DA 4IIBA 1KBZA 1J33A 3J81A 2XWQA 4XQ0A 1ILWA 1YB6A 2C59A 1M1YA 4R41A 1KI6B 1U5CA 3Q6NA 2GF9A 1VECA 4HH0A 2E4WA 5KC9A 2W6NA 1U28A 3L06A 1WOYA 2YKGA 1JKXA 4ZYXA 4X24A 4EW3A 3I5XA 2HQBA 2HFKA 2EG5A 4NONA 3ZV5A 2G7MC 3WNZA 5DFAA 4FS3A 5BW4A 3CB2A 2L82A 1EBFA 1XVVA 3DVAB 3C6QA 3DP9A 1G98A 3MT8A 4JT8A 3C3MA 3GXOA 3TRDA 1RKXA 5DU2A 4JA2A 4BNWA 4PZEA 2H1CA 1F2VA 1LS6A 4UUNA 5FLEX 2WHRA 2A0WA 2EWMA 4XGIA 2ZTUA 1E1DA 5PGMA 3WR5A 1MFZA 1WHTA 1D04A 2VF2A 4X7MA 1CR6A 3DE4X 1VG9B 4LJLA 4EITA 5EWLA 1ISJA 2W2LA 3ICVA 3LY7A 3NHAA 4RLFA 5KVQA 3OIDA 4YY3B 1SJ9A 1YB1A 1XF1A 3K9WA 2W22A 2CNBA 3N2ZB 4JXXA 3WRXC 1P3Y1 9ATCA 3E70C 3NNNA 2XTJA 1E64A 1QVVA 2Z57A 2P2NA 4R3UC 3H8JA 1YKFA 4BFYA 2GN0A 3PJRA 5TLSA 3TPFA 1HC7A 3LX4A 3RTDA 3N6XA 2YWHA 2A9OA 4NG5A 3AM4A 3N2GB 3RB8A 4F4UA 1NBOA 2Q5CA 4IHKA 4AJ1A 1R16A 2VP4A 3WGVA 4B31A 2QENA 3OJWA 3RV4A 3N5KA 4GM1A 3RVDA 4EMTA 1PUIA 5KYYA 5JCJA 3Q7SA 3S29A 5EXPA 1AS2A 3NEJA 2VXCA 1O6BA 3E53A 3PHIA 2GCIA 2XTAA 3WMEA 3SJCA 5LQNA 1B0PA 1PQYA 2X23A 1V7ZA 3RTAA 3SE7A 4ZI7B 2GK6A 3MRTA 4IINA 1RWBA 1Z5ZA 4D3SA 2COEA 4OB8A 4L4YA 1J8YF 4GL4A 4M7PA 3SKYA 3T5PA 1QU2A 1G6Q1 1H1TA 2B5OA 1UKEA 3SAJA 1U81A 5TPWB 4E12A 1YTLA 5H3CA 3VTZA 2HADA 4GFDA 5B1HA 4DE5A 1KDTA 3BFVA 4QBHA 4YJDA 4PG5A 1RZVA 1FP6A 3H11A 1D1PA 3QG1A 2ERYA 5LJLA 5GOTA 1DQNA 4G1MB 4ZRNA 1ZWKA 3KQNA 1U8UA 2YOFA 2OY0A 3QVGA 5KTMA 4DB4A 4YRBA 2V45A 3GA5A 3NHWA 3ROQA 6Q21A 3UOWA 2C97A 1A8QA 1KK1A 3ISVA 2G3YA 3IUEA 4TXHA 5TJ9A 2Q2OA 1J5XA 2D06A 3UH0A 4ZVTA 4GR9A