5B1JA

Crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Copper-containing nitrite reductase
publication title Structure and Function of Copper Nitrite Reductase
doi rcsb
total genus 92
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jA02
2XV0A 4RH4A 4E9XA 1QNIA 1A4BA 4DP2X 1CUOA 4HCFA 4BWTA 1KCWA 1TEGA 3HEIB 2CBPA 4DP0X 2XV3A 4E9YA 3X1BA 3NJLA 1MG3C 1ZV2A 3EHBB 3PPSA 4MFHA 1NIDA 3WG7B 4DPAX 4DP8X 2JFCA 3ABMB 3NT0A 2YXWA 1W8EA 2BHFA 3NJMA 5TK2A 4F2FA 4W1TA 1M57B 3AY2A 3PAVA 4FA7B 1CYWA 4M3HA 4G71B 1J9TA 2IWFA 4F7KA 4YVNA 1AZBA 1OCOB 5PCYA 2FT6A 2JKWA 3AW5A 4PCYA 7PCYA 4AKPA 2FTAA 4NAJA 4YSTA 5D4HA 2OV0A 3FT0A 4KO7A 4CSPA 3V9CA 1AS8A 1WAEA 2GHZA 4QKTA 1OE1A 3PAZA 2GBAA 1E30A 4JHUA 4DP5X 2Q5BA 2TSBA 2H3XC 1A4AA 2GB2A 1B3IA 3BVDB 3FQ1A 4YSCA 1AAJA 3ABLB 1OE2A 4BK5C 4DP9X 1V10A 2FQDA 3FPYA 1HAWA 4A66A 4BXVA 5B1KA 4DP7X 1MG2C 2P80A 2HRGA 1BQRA 2Q9OA 2BW5A 3PCYA 3UABA 4E9QA 4Q89A 3X2QB 2BO0A 3S3BB 5I6MA 6PCYA 1E67A 2VSMB 2FQGA 4A2EA 3GYRA 1L9SA 2I85A 1WA0X 2J55A 2YAOA 1JXGA 2GC7C 3IN2A 1PNCA 1ZIBA 1FA4A 2X88A 1KV7A 1RZPA 3FPXA 1SDDA 2GI0A 5B1BB 1NWPA 5B3SB 2UXGA 2AZAA 4BWWA 2AFNA 4HALA 4WTQA 1IBYA 1R1CA 2Y1AA 2PPAA 2XWZA 2PCFA 1DYZA 1N70A 1WA1X 5TK4A 5I6OA 2E86A 2IDFA 3QJQB 2NRDA 1OCCB 3QQXA 1AOZA 1J9QA 4GXFA 3ERXA 1ET7A 2EINB 3NJJA 1RCYA 2IH9A 5B7MA 1CURA 4TXVB 2XXGA 1AZRA 3WKQA 1BXUA 3ZX1A 2I7OA 3SBRA 3UAAA 2YXVA 4GP4B 3FSAA 1OE3A 1V54B 2XV2A 3CDZB 3T6VA 1M9WA 1W6LA 3H56A 1AZNA 4YVUA 2PLTA 3FQYA 3WNIA 1GY2A 1MDAA 4DPCX 1OOWA 3ASOB 1JZHA 2IWKA 5I5MA 5PAZA 2YAEA 2YAQA 4HHGA 4AZUA 3T9WA 3RYMA 3TA4D 3NSDA 4KNTA 2GSMB 2VMJA 1BXAA 5B1JA 3H4HA 4YSEA 1WS7A 5FC9A 1L9QA 1UATA 2W88A 4NB7A 1NPJA 2BW4A 4AKQA 4AKOA 4GP8B 2R7EA 1NIAA 1FFTB 2QT6A 4M4RB 4YSOA 5B1JC 2PPFA 4GP5B 1NIFA 2UXFA 1SDDB 1J5CA 3NJNA 2IH8A 3TU6A 1KBVA 2CJ3A 1J9SA 2UX7A 9PCYA 3NYKA 3UACA 1JZEA 2PP7A 3FU7B 3OD3A 1JOIA 1V55B 1GSKA 3KW7A 1ADWA 1N68A 4KNSA 2MRYA 1A8ZA 1HAUA 3N2JA 3GDCA 3X1EA 4A2FA 1OCZB 1NICA 1XMEB 1QLEB 2QDWA 4HHWA 2VSKB 4DP4X 3MBWB 3JTBA 4Q8BA 1ZIAA 2BZ7A 1ILUA 3FU8A 2RACA 5I5JA 2VW6A 2XLLA 4E9SA 1BXVA 1A4CA 1CC3A 2HRHA 2CUAA 2IDQA 3WIAA 1KDJA 4YSRA 2OJ1A 5B7FA 3GXUB 1ID2A 5I26A 1DZ0A 4BXSV 3SQRA 1NZRA 1L9OA 2BP8A 1A3ZA 1AS6A 1NIEA 4UAHA 1RKRA 1TKWA 2HZHA 2VM4A 4YSPA 3CG8A 5ANHA 1XB3A 3OM3B 3C75A 5I5IA 4AX3A 2BWIA 2PP8A 4L0PB 4G72B 5B7EA 3NP4A 1SF5A 3SBQA 7PAZA 1GS7A 2EIMB 1ZPUA 2ZONA 1QHQA 2QPDB 4P5RA 2J57A 3WKPA 3QJTB 1CYXA 1I53A 3EF4A 5E9NA 5D4JA 3PAUA 1OCRB 1ASPA 2IWEA 3NJGA 4EF3A 1PY0A 1AACA 5EHFA 2BP0A 2IAAC 1ILSA 3DTUB 2DYSB 4A2GA 1AG0A 4GYBA 4ENZA 2FJSA 1KBWA 1J9RA 1E65A 1SHWA 2XX1A 3PXLA 1PCSA 4DP1X 1GS6X 2GC4C 1E5YA 4P5SA 2ZXWB 1PLCA 1GW0A 3IEAA 5I28A 1SF3A 3FU9A 1VLXA 3UGEA 1BYOA 3FSWA 1KCBA 1PAZA 1AZCA 3N55A 1SJMA 1TU2A 3FSVA 4HAKA 2QPEB 2VM3A 3SBPA 4JHVA 1JZFA 2ZWNA 1BEXA 3T6WA 1GS8A 1X9RA 1EHKB 3AG2B 2IDUA 3X1GA 1IKOP 2CCWA 2A3TA 4FAAB 1GYCA 1M56B 3HB3B 1JERA 2BWDA 2DY2A 2FT7A 3QPKA 4A68A 4AI7A 3DIVA 1A65A 3KW8A 1BQKA 4A2HA 1BYPA 1AG6A 3T6XA 2FNWA 2BZCA 3CVCA 3T6ZA 2HX7A 1HFUA 3NSFA 4YSDA 4DP6X 1KDIA 3L45A 3EH4B 1JZJA 1PNDA 2DWTA 2EIJB 3AZUA 2B08A 3PLYA 1XB6A 2TSAA 1AR1B 3EH5B 1KGYE 3G5WA 1IUZA 1L9RA 1KYAA 2P80D 3AG3B 2XXFA 5LDUA 3S3DB 5AFAA 1OF0A 1NWOA 2HXAA 4E9TA 2H5UA 2CAKA 3NP3A 2BP0B 3QJUB 3FS9A 1ZDSA 1L9TA 1F56A 3MX0B 4G7SB 5B1AB 4QLWA 1NDTA 3OMIB 3IE9A 1AANA 1PZAA 4PAZA 1JZIA 3UAEA 4X4KA 5AKRA 1BAWA 3IBOA 4YSAA 2XU9A 4KOBA 3TBBA 2EILB 8PAZA 1ASOA 1SFDA 2PPEA 3T71A 3WI9A 2DV6A 2VW4A 4YL4A 1PZBA 3AG4B 3DKHA 2YQBA 2DWSA 4HZ1A 4BWUA 1AIZA 4YSSA 1JVLA 2YAHA 3S3CB 3U25A 2XYBA 4HIPA 4JKNA 4E9WA 1PLAA 2HLEB 4KO6A 3QJVB 1AQ8A 1ETJA 4G7RB 4K9JA 5A7EA 1OV8A 3WNJA 4NERA 4UF7C 1IC0A 2I7SA 2ZOOA 1GR7A 1GY1A 3FYIB 2LLNA 3CDZA 3NSCA 3NJKA 2YAPA 2PPDA 1SFHA 2GIMA 2AVFA 4GY4A 4A67A 4CSZA 2XX0A 1ASQA 3UADA 4BDVA 1XB8A 3CVBA 3OMNB 2R7EB 3NSYA 1JZGA 2PCYA 1NINA 1TEFA 4WKXA 4N4YB 2H47C 1BQ5A 2W8CA 2EIKB 6PAZA 1T5KA 3NJIA 1PMYA 3CZUB 1W6WA 4HCIA 1ZDQA 3S8FB 4KO9A 1MZYA 2YAFA 2FQFA 1IBZA 2AZUA 2WO3B 2MTAA 1MZZA 2FT8A 1NIBA 4KO5A 1PLBA 3EH3B 4G7QB 4DPBX 5IY5B 4N8UA 5F7AA 3X1FA 2OCCB 2IDTA 1PF3A 3FU7A 2B3IA 2X87A 1X9UA 4W9ZA 2YAMA 4UANA 2AANA 2XVBA 2QDVA 3IN0A 4E9VA 2YARA 5D4IA 1EZLA 1FWXA 3BQVA 3FQ2A 5I6KA 4YSQA 2WSDA 3ZDWA 2CALA 3NJHA 1SHXA 2N0MA 1RZQA 2UXVA 3AG1B 1E5ZA 3X1NA 1SNRA 3QJRB 3FYEB 2JXMA 3FSZA 2BP8B 5I6LA 1JVOA 1URIA 2J56A 3QJSB 2IDSA 4ZK8A 3TBCA 1WS8A 2UX6A 4HCGA 4F2EA 5I6NA 3JT2A 3ZBMA 1ET8A 2UXTA 2PPCA 2WO2B 4KNUA 4BDVB 3OMAB 4E9RA 1J5DA 1NTDA 3ABKB 2XUWA 2Y69B 3NJFA 1ET5A 2HX9A 3ABGA 1AS7A 1AZUA 3H4FA 1NPNA 3OQRA 2FWLB 3S8GB 2FQEA 3ZIYA 1PZCA 5I6PA 3ASNB 1JXFA 2HX8A 1WA2X 2PP9A 2VW7A 4KOCA 2DYRB 3TASA 1L9PA 4G70B 5F7BA 2J5WA 2VN3A 5AZUA 3D12B 3V9EA 3CVDA 1JXDA 4YSUA 4A2DA 1YLBB
chains in the Genus database with same CATH superfamily
2ZP0T 3BIKA 4J3TA 1HH6B 3P1VA 2F58L 5I8EB 4XVTL 4XPAL 3VXUA 2E9JA 4S10A 5FCSH 2J2ZB 3HEIB 4BWTA 1QLFA 1M7XA 2JKJA 1VRSA 2VDLH 3DUSA 3IDJA 4X99A 1JXKA 1THAA 3M8OH 4GKSA 1LE9A 5F0MB 2DM7A 5DZOA 3IMWA 2B20A 4I4WA 1J1PL 3RGVA 2GFBA 2QFPA 1XVSA 4MQ7A 4F2FA 5T1LB 1RP9A 3P4OB 1T7XA 3ECBA 1FL5A 3QZWG 3QJFB 4NNXB 5EIQA 5GZOC 3VWKC 4RIRB 4NRZA 4L8DA 4PVBA 1K4DA 3FQUA 3OJMB 4FEIA 5ID1A 2GEQA 4X7DC 4R8WH 1ES0A 2QQKL 5HGDA 2X3BA 3A47A 3S36H 4LLMB 3FUEA 4F9LC 1F6FB 2CKBL 4XBEL 1UXSB 3I50L 2D0FA 1ITCA 1GCYA 3EGSA 4UTAA 2DW5A 1IC4H 2X4PB 2VQTA 4F5CA 3PAZA 2EECA 2Q5BA 3ESVF 4FDWA 4HZAA 1XH0A 5EZIH 4L4TE 2HWZH 4CL7A 1R3IL 5F93C 1FV1A 4GLRI 4YSCA 3B7RL 4Z3JA 2NW3A 2O5NA 3QFJD 2VDKL 4MRBA 2VR8A 5FCUL 4BHUI 1C9SA 2WVTA 4WHCA 4YHIB 25C8H 2I5YL 1GYAA 2C3VB 4BXVA 3GBMH 4KKZA 3OAYK 2QR0B 1VFOA 2Q9OA 2XZQH 1DANT 4HX1B 3LMJH 3VXRA 4EQ2A 1YPZE 1HE8A 3ARDD 5HHXL 5C08E 3MCYA 4MSWA 1U8HA 4EI0A 2FQGA 1XEDA 4WGVB 5CJXC 5IROC 3LZQA 2GI7A 3E9UA 4JRYA 2DBLH 5T3XE 2YAOA 2GC7C 3IS1X 5AW1B 3QHZL 4IMKC 4K8RC 4X7FC 1KWKA 2HTKD 3P0VL 4K8RL 4PUBH 3D4ZA 3MLSH 4WKZB 1EO7A 3KJ4B 3ZL4H 2GHWB 3IDNA 1K4CA 4ELMF 4KK6D 3HG3A 1I8MA 3SKUD 3GI9L 4FS0A 4HJSA 2F8VA 5IOKA 5SWSE 1ODUA 3BH8A 5AAWA 1IGJA 3ECQA 1PD0A 1RCYA 4P5TB 4QTHB 2BSSB 2DIEA 3SKJH 1FHGA 1UOVA 5ICYA 1CDBA 4JDZB 2XTJC 2ICCA 3F7LA 3QWRA 3WKQA 4HGWB 3V2AR 3QPXH 5A1AA 3A23A 4JG1L 1OAUH 1TZGL 5DMGC 4PW3A 4W6XB 4N0FA 5HI5C 4UM8B 3T6VA 2JQZA 1KPVB 2XBZA 4HKZA 4KMTL 1RK0B 3HR5B 3WSQL 3TX4A 1M1XA 4HIJA 4DPCX 1IEAB 1BWMA 4PRPD 3C60C 5JHDD 1JZHA 2AV1A 4NQEB 4OLXH 1DBJL 4GRLD 2YAEA 3O11A 4GJTB 4LLAA 5HVGB 5FO8B 3HI5L 3KVDD 3MFFB 3LZNA 4D9RD 3DPBA 3FQNA 4HWBA 4PGEB 1MREH 3MOQA 4Y7MA 5J6GB 3GT6A 2ADJB 1J86A 2W88A 4POZC 4AKQA 3PWNB 4PJ7B 3QG7H 4N8VB 4KHTL 1D5BB 1AGCA 1V27A 1G7LA 1OW0C 1AMXA 1NFKA 1WHOA 4JREB 1DE4A 2A4CA 3F6JA 4S0TD 4GW4A 4L1HA 2X9XA 3B2MA 5E6UB 4PGDB 4NO5A 3O6LH 5DFVD 2AQNA 2NY2C 3TBSB 3WMSA 1EXGA 3WXWH 1YY9C 5DJAA 3HE6B 2PYEE 5T5FL 4QD2E 1SN0A 1T83A 3HVDA 5I1JL 4XO8A 3DK0A 1G1KA 3E6HB 3S96A 4DGWC 2Q86A 1X6NA 3LH9A 4PJIF 2JCCE 2W07A 3RWFA 3WFDH 1OSZA 2Q8AL 1F0LA 1TFPA 1CLOL 4ODTH 5FW8A 3VFNB 4D2NA 1DHKA 2CXKA 5FLUA 4XMKL 4PTTB 1X5JA 4UU9B 4RMTA 3HE7D 3GDCA 2IPKA 3A4FA 3CXHJ 5E8EA 5FYKD 3FU0A 4OIIL 3RNKA 8CGTA 5C0DA 4L9LA 2NUTB 4U1LA 3MXVH 1YMME 1MFCL 2ZOLB 4MDJA 4NO0B 3IF1B 5BS0E 1R3HB 2YN5A 1JHKL 3GWJA 2Q1EA 5F7DA 2E4TA 2G0KA 1RV6X 4NC1E 2C4XA 2RACA 4NM8H 3TN0B 3U4AA 4Y88A 1L6PA 4NIKB 1R46A 4DGUA 4F27A 2FECI 4N1CA 3SCMD 5EB9A 1BVNT 2PMZA 4I89A 4LPUA 3CFJA 3DRTA 3HRZB 4BKTC 3X12B 4ZOCA 3H42H 2OYPA 5KYWA 4PHXA 5FO2A 3ZZ1A 1A7RH 1OGAD 5DMYA 1J5OH 2BSEA 2W1NA 3FTVA 5AVSB 4N22A 2X4TA 2BSRB 4YR6B 2R2CA 1EHLH 3S34L 1N5YH 1LEIB 4P5KB 3DIFB 3L3IA 3L4CA 1KGCE 2EC9T 4IU2A 4WY7H 4AL8C 1U8NB 3RVVC 2X1PA 4HC1A 1IFHL 2IWEA 4I1NB 3TO4B 3SKOB 1CE1L 1HESA 1KGJA 1N18A 3MR9A 3GSRA 1Z66A 3K8KA 3PWPD 3DSFL 2XICA 4BQ9A 4BZ2L 4PFEA 2VDNB 1KG0B 3DTUB 4A2GA 1IVLA 3LIZA 2NNFA 3SE9H 1MFNA 4EI5A 2C1OA 5D7IB 1NEPA 1UOLA 2NDFA 1DSFL 1CL7L 3QULB 1KTBA 1IX2A 1X9LA 1YEDB 2CDEA 1YYLL 1J9RA 4S11A 5C0GA 4IRSC 2CO6B 5HDBE 4MNQD 2W9DH 2JMRA 3I2CH 4YHNA 1PYWB 4X6EB 1XGUB 2DLTA 3B9EA 3SQOL 1AD9B 3U0TB 4UT6A 3OKYA 4DAGH 1FG9C 3CZFB 3FOLB 4NZDA 4OGXH 2FB4H 3R7QA 5I1CL 2RCSL 1KCBA 3FSWA 1MRCH 1CTNA 1PAZA 5CP7B 3O8XB 4HWEH 1ACZA 5CLWA 1A14H 2H32B 4FYSA 2GUOA 2NYKA 4Y89A 1OZTG 1RU9L 4OZIB 2EDYA 3D09A 4AQ8A 3N43B 4IRZH 1IGML 4FXKA 2VN7A 4EUPA 4DKAA 2GBTA 1GC1C 1ZSHA 4GKOA 1A7QL 5HHVH 5E5RB 3QUKB 2FT7A 4FE9A 3QPKA 4J1UB 4WEMB 2PCPB 3QQ4A 1IAOB 3VXMD 1FORH 2WBWB 4MBOA 4P4KB 1Q1JL 4PEEA 5A2IH 1XHHA 3A6BH 4JZOA 1AHWA 1KBPA 2VLRA 3CVCA 3MJ9H 5IB3B 5L9DL 4FF9A 3GUTB 1HCFX 4HIEA 4ZPTB 3NZHL 3QUYA 3UZEC 4ETQB 3L45A 4KKBC 1Y1DA 1MWAA 1N6VA 1IIIA 4LE8A 4LOEA 3S8WA 3MGTA 5EULV 3TFBA 5BVJB 4DFIA 4DQOL 1MW0A 1E4KA 3C8KB 4BD4A 2CBTA 4Q6IA 5TDPB 1Y0LA 3UH8A 2WKGA 1G9MC 3H85A 1U3YA 1RSYA 5CBEA 2DLHA 2BP0B 2Y5QA 1O7SA 1G9ML 4G6AC 2IQ9L 2KT6A 2ZYSA 3OMIB 3PIQA 2CO1A 1QSFE 4RAVB 2H45A 1BAWA 4OCSH 3RA7H 3K2MC 4OLYL 4N2MA 4N2HA 2QQNL 3Q8EA 4P99A 4XPTL 5AVYB 1B0GA 4YL4A 3DARA 3GSWB 4P3CH 5IBTH 2HFTA 3S3CB 1HK6A 2QKIB 2WLZA 1YEKH 2YQ2A 4ODXA 4DKEH 4WDIA 4I3SH 4HK3J 4A7GA 4B96A 1A9BA 4JFZL 4LLQA 3APDA 4MLSA 2BVUA 2LW3A 3BT0A 4ZMTA 4POUB 5C9KA 2RFXB 3NAAH 1QRNA 1Z5HA 3IXTB 3ZIMA 4AQEA 4D9QE 4H8QA 3KXFE 1PLGL 2R0KH 4NEHB 3S88H 3UJIL 3ZKSD 1OPOA 4O9HH 1LEKA 4Z7OB 1CG9B 1JD7A 2EXSA 4U7MA 1XB8A 1R3KB 4QNPF 3RX5A 2R7EB 5DJZA 2F6AA 1MOEA 1ZHKB 3T77B 2PCYA 5MEPB 4L5FH 1EUTA 1XCXA 2ZD0A 1H5BA 4KH9A 1NL0H 4X6DE 1K5NA 4GOSA 4M5SA 3QDMA 4D0CB 4KMTH 3R4DA 1C5DA 3CDYA 5DK0B 4N5EC 2YAFA 2KUTA 1N8ZB 2Y3AA 1IO4C 1KJ3L 2EYSB 4TRPH 5AL0A 3MRNB 2GITA 2G2NA 3AS3A 1TZIA 4Z0BH 4P2QB 5GJTL 2CO4A 2XT1B 1QLRB 4NSKA 2JWYA 5HGHB 3BPLC 3ARVA 4CDGC 5FGCE 4ZDHA 4ZO6A 3DETC 2FGWH 4JCLA 5I75C 4WUUB 3FHEA 1BX2B 4WGKA 2YFOA 3QIUC 1WICA 4L9DA 5GGSB 5IJBC 1MHPL 3C5JB 3MVSA 4JFFB 3TIDA 3BZEA 3C8DA 4L3EA 2WKOF 5ALBL 1TLKA 2WZPA 3UG5A 3RDTB 3O6ML 4HIQA 1XGRB 4XH2B 5CSZA 4R0LB 3IDYB 2O6DA 4X5XB 5T1MA 3HG1A 4P49A 3X1NA 1J12A 1RIHL 3FYEB 1BA9A 2ZAIA 2JXMA 2GCYA 4PJFA 1C7TA 5K59E 1RP8A 4LU5L 1OSYA 3WIHH 1KB5B 5TDNA 5IGXH 4LARH 3FFDA 4WVRA 3U9UA 1BG1A 4JZJB 4HFUL 5I9QC 2EDDA 1CLOH 4WIQA 5BPPA 3JT2A 5EA0H 1H3PL 3JWNC 4KNUA 5J11B 3FCUB 2BJML 2WBXA 3AXLB 5E7FA 1E40A 2CUHA 2VIRA 1HL5A 3T0EE 4F91B 3P3UA 3PGDA 3ZTNL 1PZCA 1DQKA 3MUGB 1I1AA 2VW7A 2WLLB 1FH2A 3GXFA 2DEYX 4RSVA 3DROA 1XH3B 5HYSB 3BQUB 3FOMA 5ISZA 2WSPA 4PIBA 4W9EC 5FW7A 5LGYA 1XF3A 1IU1A 5BXFA 4ATWA 4X5PA 1HSAB 4XRCB 1ECZA 3SPGA 3ZDXE 3GJEB 4OM0H 5I1IL 4UIKH 1EHXA 4CILA 1CR9H 4XOEA 3UPRA 3V5DA 1AR1D 2HH0H 2HKAA 2J43A 3HZ3A 3EDEA 1UJ3B 3CU1A 4JRLA 5L6YH 4HJTA 1O5PA 2WLHA 4ABWA 1NIDA 4L1DA 3EDDA 5I8KL 4XNXL 4A38A 2CK2A 4PBVC 5D7SH 5IF0A 4PREA 4GUCA 3RI5F 1GSMA 2FSDA 1WHPA 5E0FA 3MNZA 4F3FA 5EO9A 1GGCL 3D39B 3MCLL 2WYIA 3VD4A 4MHHI 4Y19E 3VFPB 2ZUYA 5PCYA 4OCRL 3IM1A 4AL8H 2NXZC 3AW5A 3V7AE 7PCYA 1L3WA 2XETA 5KBLA 4AEEA 2OL3B 4KO7A 1W0VB 1K72A 2P8PB 4FP8H 4MS6A 4QT5A 4R6UA 1N19A 5FECA 2Y6TE 1AQKH 4YDZA 3UERA 1A4KA 4O51B 4FQXA 2CLZA 3BEVB 3NACL 3WFCH 4N8VG 1JMXA 4GS7B 2E7LA 3FCSB 2B1OA 3HAEG 3OTTA 3IMBA 4Y4KA 3DX2A 4EN3D 43C9B 2MQ3A 3WEXB 1GGUA 4QO1B 3KL3A 3MA7B 4YUEH 4TN9A 5B8CB 3CZGA 4LXFA 2FQDA 5FKAA 4LSPH 4J3OG 1I4FB 2P80A 3PP3H 4M43L 2Z4QA 1ZA6A 2BO0A 5FOBA 2PTTB 1E67A 4K5LA 4RMWA 4BM7A 5SWZD 3E7JA 4XODA 5TGBB 1CZ8H 3P11H 3S6CA 1S78C 5C0RH 1PNCA 4C56B 5K5YA 2BNRD 2NMSA 4S2SB 3BSHA 4OIBA 4LHUA 5EFIB 5C3IA 1ZLWH 1Q0XH 4KDVA 3MLTA 4EQ3A 1BD2D 3GHPA 3I6LE 4ZUWB 5DRXB 3ZQXA 2ZOKB 5K9OA 1AMYA 5IJKA 1H8NA 4YO0B 1GC1H 3I3EA 3EO9H 3O0LA 2AXFB 3PL6C 4UILH 4DKTA 2PPAA 3ZE1E 4L4TA 1JK8A 3HN8A 4GEJA 2BFVL 1ETZB 5L9DH 4KROD 4KU1A 4ZFZB 3SKMB 1F4YL 5A2BA 1E5CA 1I9JL 4ANWA 1TVHA 3V4VB 4NQDE 1I75A 3TP4A 1UKTA 2J6EA 1YNKL 4KAQH 4LVHB 1LWHA 2A6IA 4NWUL 5E6IB 5ETUA 1HNFA 2PWDA 4M9PA 1QHOA 2P8MB 2AQRA 4QHKJ 1N5AB 3CFQA 1YPZA 2Q6WA 4F58H 1RZFH 2AJYH 4QIRA 3DJ9A 5F6IC 4RMRA 5KVEH 1JN6A 3KAAA 4GG6E 4FJ6A 4DEPC 3FZUC 4UDUB 5AVUB 2XIIA 2QMJA 3FH8A 3FQYA 3LKNB 3DTDA 4U3SB 2V8LA 3BDXA 3EZJB 1CF8H 1TTBA 3GMPA 5KYUB 3HMXH 4QRBA 1U8QB 4Y9GA 3NTCL 1D9KA 3EUDA 2GSMB 4X6BA 4NUJA 4A6YL 4XPTH 5KSBB 3HMWH 2WZAA 3WIFA 1QFUH 4ZMQA 3HNVL 1WS7A 3ZYJA 4MNGB 2HT3C 3MZTA 4FFWC 5FC9A 1NPJA 5SWSA 3S4SA 5D1XC 4I5BA 2RD0A 4B0MM 4OLUH 4IOSA 3TJEL 3MMEB 5BJTB 4O5LL 5HJ3B 4I7ZC 2B0SH 3PQYD 1G7QB 2Z8SA 4AVJA 4LSSL 1RLBA 5IMKA 4PRIB 2YK1H 1WPCA 4YX2H 4B5EA 5EOTA 2J88H 5MENA 4MMXC 2KQMA 4JPIB 1MW3A 2C8NA 1VADA 1KJ2H 2WBKA 2LTQB 4AH2A 2VRQA 1AO7D 2X41A 5MEQA 3SDCD 1BG9A 3TU6A 2HPTA 2K6WA 3P30L 3V6ZA 3UJIH 3MBED 4MVBD 1PL3A 3CMGA 5IQLA 4JCWA 4TL5A 2WP3T 3ALWA 3KL0A 5E5MB 4NHCH 4KXZI 2DMHA 1Z9NA 2J5LB 2AV7A 4HDIB 5GJSL 1VIWA 5IK3B 4OZHE 4ODWA 2OR7A 3RFRA 3TBTB 4AMKL 4NNYA 2MRYA 3HUJA 4XWGL 3DDFA 4YJZL 2D4FA 3IJYB 3LQMA 5GSRB 4JHWH 4XAKD 5EU6E 3ZYIA 3UTTD 4WTWA 3BWAB 3C09C 4HXAL 3VRLE 5DHVA 4YLCA 4AEIL 5FYKU 3TURA 1BFOB 2LAAA 4GQ9L 1AKJD 2NX5B 3OKOA 1WWBX 2VN5A 3VI4A 2A9CA 1T04A 5KVGL 3ULUH 5F9JB 4F1SA 4QJ4B 3KPSB 5TPWH 5E94B 3H3PH 1AE6H 1CI5A 1DVFD 5EU4B 2EVIA 3BT2L 5A2JH 4IHOA 2ZUWA 4LLUB 2V5MA 2XLLA 5DS1A 5GJTH 4GAJL 2IADA 3ZU8A 1MCLA 3TV8A 3I75A 5LBSL 4RAUB 4JM4L 2I69A 3UCQA 3EOBA 3ZYOA 4G1EB 4V11A 4NIYE 3BAXA 3D06A 1NIEA 1HYSC 3VW3H 1S9WA 5DJ0A 4BSVB 5D6CA 1ZXQA 3QEUB 4HS3B 4N24A 1YYML 5D2LA 3W1ZA 4S1QH 2HRPL 2CR0A 3RUGB 1KYOJ 1I53A 3INUH 4XCCL 4OD1L 2H1PL 1RJCA 1SJEB 1E9QA 4NKDA 3RKDC 4BYHA 4KRNA 3PWLA 1JZ2A 3MRQB 4QRRE 3QFJE 5JXEC 3L1OH 2KBGA 1GGYA 4M7LT 1ILSA 3DK2A 2R2BB 3P2BA 1G0XA 1H3PH 3TH2T 1T03L 4HJEA 5EO0A 1IKNA 5L2JA 2AGJH 2MIZA 3QORD 1BF8A 5H37A 3JWNH 4CGUB 1EANA 3PXLA 4FYTA 4DGIL 3FO2B 4LKCB 1FCCA 2CGRL 1CK0H 3AT8A 4UOW0 4XC3H 1DN0A 1QATA 5EU3A 1I85C 1A0QL 5T5NG 4NJAL 2OTUB 2H2PC 4YE4L 2AQTA 1D5XB 1O7DC 5EU5B 3CNKA 5C9JA 1NGQL 3ESMA 3P0GB 1M3IA 1O9ZA 3N3EA 2YR3A 3BYTA 4NZTH 3ULVF 4IBZA 3M1BA 3T6WA 3L3HA 1D6VH 4R4FH 2G2RA 1KB3A 2VUYA 3MKKA 3ZDYF 5GGRA 4FAAB 2V3DA 4YGVA 4IDLA 1E9PB 5AVVB 4G59C 1U6AL 1U8OA 1L6XA 5AW6B 4HOWA 1A65A 4XNZB 1OPGH 4Y5YB 4UOJA 1KIQA 3QIWB 4I2XA 3GGWA 4CMHC 5IEHA 4WCYH 5IB1B 1EJOH 5CIPA 3TCLB 1RJZB 5EPMB 5A16B 3SGDI 3EGXB 4PRPE 1UVQA 5D1QB 5JHDE 2BY3A 3G5WA 3F5WB 3Q8AA 4K8RD 4LIQL 1BZEA 5D7JA 5DUPH 2H0PA 3QDGD 5EC2B 1N59A 2ICEB 1CFTA 1XR9B 2UVFA 5DEJA 4D9RE 3EDKA 1HQRB 5EUOB 4E9TA 4XNUL 4Y5VA 3HS0B 2OR9H 4OZFH 5CN1A 2WTPA 3KPQA 4G7SB 3SDXF 3UTSB 2VO8A 2R29H 2VXTL 1U93B 1H8LA 4G9DA 1SMOA 3MRPA 5DURD 3TBBA 4FQIL 2Y7QA 3N1PC 2WUCH 1LO2L 3CV5A 4RFEA 3WY4A 4H5SA 2VAAA 3S35X 4BFOA 1U3HA 4OZ4B 5DT1H 35C8L 1AIZA 1MIMH 1F90L 1LTXA 3OHXB 1BM7A 5EBWA 4FTVE 4JB9H 2GJJA 3T3MB 2GJZB 1MAKA 3SE8H 5A2KH 3QJXA 3C60D 2K3HA 3ZT5A 4MYPA 2AXHA 3P3SA 2ZF8A 3P4NB 1U4FA 2ALAA 4BH7A 5DRZA 1N0XL 2G4EA 4YPGB 1LO5B 1TCRB 2V4LA 1GY1A 3NCJL 5IVNA 5KSAC 5F88A 2A83B 4OCYL 1IEBB 3OR7A 4JY6A 4LCIL 3WO4B 4POZD 1A6PA 1BSIA 4OLVL 5FYKE 1WC7A 2Q7AA 3SB3A 5HDOA 2H4EA 5D2NE 2WSKA 1SGKA 2N3JA 1KYFA 3LNIA 3CFIC 3QT2A 4U1HB 1D5ZA 3BAYA 1CU4H 1YY9D 3GM8A 4OUOA 1PMYA 3OHMB 4MZ2A 4ECNA 2XPGB 4JNXA 3DRQA 4NXKA 1ML0A 5DJ2B 1KXQE 1MZYA 5GHWH 1B4JL 2BDNH 2C1PA 3Q7JA 3PWJB 3VFOB 4ZSOE 1KSRA 3STBA 1SDAB 2BRQA 1PKQE 4QY8B 3GB7B 4M6NL 1MFAH 5DO8A 1IC5H 2FX8H 4MJ5A 5JPNA 1N6QH 4RGNE 4CU7A 4G7QB 1M71B 3AS1A 1EX0A 5F1NA 1YEIL 2NTSP 1J11A 3X1FA 2ZOTA 2NY4B 5T1KA 2IALB 4OZGA 1NGPH 5CILH 2B3IA 5JQ6H 3CBKB 2UYLA 1LWRA 2Z8WC 5IT2L 3D34A 1QBAA 1FAIL 3B1UA 2IGFH 4QXVA 1YO4A 2IBZY 4X6DA 2OPCA 4TUOA 3MV9D 3PWPE 5LBGA 1IGTB 5DMKB 3D3VD 4H25A 4I48A 4B50A 4H8UA 3NQKA 2VOTA 3FL7A 4LDEB 4DZ8A 3R06B 4L4VA 3GI8H 2BP8B 3DURB 1UACH 3QO1A 3PDOA 2B59A 2XQYA 3OPUA 2WN2A 3QUZB 4N9GA 4R96B 1RZIA 1QVOA 2AJ3B 1XIWA 1JGIA 3TH3T 3VFVA 1FZOB 1CICB 4OCWL 2DIAA 3CVHH 4AQOA 1QTYT 4F2MB 4HYTB 4NRXB 4LPXA 3TF4A 1JZ5A 3TT1L 4KX8A 3PNRB 3OZ9L 4AEIH 2Z93B 4O2CA 1U92A 3COOA 3BVTA 1CGSH 2IBBA 2P44B 5FB8B 5M7QA 3RIFF 3RVVD 3KPRB 3KVPA 3W56A 1DLFL 5IG7B 1S9XB 2AC0A 4UINL 2EDLA 3IKCA 3RX8A 5JHAA 4QHLA 5A43C 4HPOH 4ZPVA 1JGVH 1OANA 4C47A 5E4IA 3V0IA 4RH4A 4I18C 1OTUD 4TVUA 3VXME 4JM4H 1AZVA 4WW1A 3O2DA 5AG8A 4G43B 1A2YB 4PG2A 4XNQB 5D1ZB 4NFBA 4E9YA 4IRSD 2X9YA 2R0ZL 3K72A 1DBBL 3L4ZA 3QUXC 5DLMH 4HT1H 3SDAB 3MRFA 4GO9A 3UMTA 5KWYC 3DUUB 4RISL 2XWJB 4PIRF 2AEQL 5BO0D 3DVNB 5DHDA 2LT9A 4OCNC 4R4BB 1DQIA 4Q4IA 3T0EA 4BINA 2A1WH 1A1MA 4FQQB 1OQOA 2WANA 4C8XA 5BQDA 1EZSA 5LXGH 2R0WH 3CSYB 4F7KA 2LGNA 2BY1A 4PY8I 1XTLA 1T7ZA 2VDOH 3N06B 4LVNC 1OSEA 5IM7A 3ESNA 1TVDA 1P5UC 4P9MH 1VZGA 4U1JB 1RPKA 5JPMB 1JCVA 4NN5B 4HUNB 1OGTA 4F1ZA 4G7VL 5HI4C 2GB2A 4QHMB 1R24B 3AAZA 1TXKA 4KKBD 1KIPA 4XPGH 1IM9A 4UQIM 1PDKA 1MNNA 2CHZA 4CMMB 3QNXB 3BVXA 1JGEA 2PN5A 3BP4B 4NN7B 4WNQA 5DD1H 2HLAA 1QEWB 1NGQH 4Q89A 3S2AA 4XXCA 3EXLA 1FYTD 1OO2A 1XGTA 5GRVL 1N4XH 2VSMB 4X6CE 1X3DA 2XA8L 1L9SA 3MLRL 3GC3A 3MLUH 4PJ7F 4HAGA 3RL2B 2YO3A 2FBJL 1LK3L 3LN9A 3CX5K 5KW9L 4PJBB 1MJJB 1OHQA 4G6AD 2DZEA 4FFYL 1YEEL 4GG6B 4P8QA 2UXGA 1HILB 1U8IA 3MREA 4ZFOA 1OAZL 5CJQL 1JGLL 3V6BR 2H0EA 2CIKA 5C0AB 4FQHB 2A9BA 1I9IL 4XBGA 2X1OA 1U91B 1LEGB 4FQJH 2OS7A 1BVOA 2VXVH 1Z3RA 5CBAA 4KQ3L 3BSZL 4ZRGA 4ZQTA 3SYOA 4YK4B 4LP4A 2A73B 2V2TB 4GH7B 1JXJA 4GBXA 2HVKA 4GP4B 1OE3A 3LXAA 4M8VA 2XV2A 3MRJA 1E4XH 4GRWB 4CC0A 2OI9C 4U6TA 1QFWH 3CSGA 1A1NB 3ARXA 3H56A 3HPJA 2CDGA 1DBML 4PB9H 4YC2C 2IWKA 3T4AC 3QXVA 4ZMOA 1P4LB 3GHBH 2QQLH 1LO4H 4DVRH 3WAJA 2VERA 4YHMH 1GYUA 1BZ8A 2ZUTA 4TTGA 1BMZA 2HG5B 5G5DB 2B14A 3EJJX 3WFEH 1S8DA 3WHXA 3CZSA 4HCRA 5IW6B 1QLEL 3B2VL 2BNQB 4NB7A 2PR4H 2IMNA 4AT6A 1E6OL 4PLJC 4JO3L 2XFXA 4P4RA 4N5ED 4HBCL 1OLZA 3MO1A 4RCAA 1VHPA 1RK1B 3NCMA 4K3DH 2OYKA 3DTXB 5B1JC 2V2WA 1MNUL 1G6RA 1CO1A 1S9YB 3TBVA 3IU4H 4UQ3B 1D2PA 2UXFA 2I9LA 1OAXH 2YGPA 3LPWA 4IHBA 4CVXA 4PCSA 3F7PC 4Z78B 1HEZB 1OCWH 4Y4FD 4L8CB 3J27A 5CP3A 5IB4B 3ZKNC 5C09A 4MAYA 5L8KB 3E8UL 1MY5A 1H8SA 5JIKA 3H9SD 3MLVH 3P4MB 5F6HJ 2PW2A 1W15A 3LH8A 4X98A 4AGOA 3BKJH 2BERA 3QIUD 1DCEA 2BK8A 4Q97A 4HLZH 5DD5L 2WZ6A 3OGCA 1SOXA 4K3EL 1M05A 1LE5B 1GRWA 1A8ZA 1A6TB 3DSNB 4FI8A 4JFDD 1ESOA 1L0YA 1R4XA 3UX9B 2KZBA 2E7CA 5D7IF 2W9EH 1QWNA 2CJUL 3FCGA 4HKBB 1TJXA 3QVAA 4LAQL 1QFWM 1WBXA 3AACA 3NCYP 4BZ1H 1S7VA 1P9MC 1OT1A 5F7EH 1NICA 3QNZB 5D7HA 4ILDA 4ODBD 1PS3A 5CHNA 2XQYK 1Q9WB 2XBTA 4M6NH 4DO6A 3FH5A 3O9WA 1YEFH 1SOQA 4LRIA 2AJXH 4PVNA 2K70A 3BAEH 5I26A 1DZ0A 1W0YT 4DFHA 4MJ2A 4OZIF 4HKXB 2EIDA 2E59A 2YC1A 3N43F 3G04A 3ML9A 2E7DA 2LU5A 1DFBL 2JLPA 4OZHA 1ACCA 1EFXD 3DV6B 2XNAA 4WI4A 4F9PC 3HHSB 4NQXA 1A7NH 1KIUB 1OWWA 3GS0A 4QRAA 1IGFH 3VXOB 3MQIA 4XZ4A 4QHPA 3SGKA 2RBLA 2X6BA 7PAZA 4IJ3C 4G3YH 3BIKB 3LB6D 5CINL 3VXUB 1AQDA 2O5ZL 4Y9EA 1ZA3A 1IC7H 5L0QB 1JRHL 1NLDL 1WG3A 4YHYB 2Q20A 5HDWA 4UTBA 3F2LA 3IDJB 3NFPB 4I0PB 4X99B 1WE5A 4GKSB 2OA9A 1LE9B 1KC5H 3O0RL 4CGTA 4TNVF 5AAMA 2GFBB 2IEPA 1QFPA 3M86A 2Z4TA 2J25A 2OJEA 2WWOA 3OG6B 1V7MH 4ENZA 4LOVA 4UB0H 2ERJC 2OMYA 1FL5B 1I8AA 1SUJA 2XX1A 3BI9X 4L8DB 4RBPH 5EDXA 5EORH 5AW9B 3V0VA 3FKUS 3FQUB 5SWZE 4BFRA 2DYPD 3LDBB 4M7JH 5ID1B 5AKTA 2AEPH 2GABA 5HGDB 1VFMA 4WU5B 1F1GA 2BNRE 3W37A 2OMBA 1OOAA 2A2QT 2LOEA 4CVUA 2NXZD 3OB0H 1BD2E 1MFDH 4F8LA 4LL9A 4AYFB 2VDMB 4Y1AA 3EGSB 3ZHDA 4KJWC 4TQEH 1FO0L 3DX0A 1S7SB 4MA1B 1X6LA 5KVFL 3D85D 1FV1B 2VDPB 1OB0A 3FQXA 3X1GA 4QRRA 3RVXC 3ULVC 1R0AL 5T5NF 1JERA 1SJVA 1BDYA 3BUTA 4MWFB 5ICUA 2OX5A 3AQXA 3ULVL 3EKCA 3L2MA 4AGPA 3OKKA 4FFVC 1A64A 1IAII 3RNQA 4C4UA 3QXUA 2J8UA 4MAZA 4ZAKA 1DBAL 4MSWB 3VYOA 1U8HB 2L7EA 2ZCHL 3AITA 1FLRH 3QDJD 3M07A 4Z7OF 5ABDE 2B5IB 1S78D 3AU1B 4MAUH 1PNDA 5IFJA 1CS6A 3N85L 2OZ4A 1JYNA 3LZRA 1F4XH 3PPEA 1GH7A 1L9RA 3HBPA 3S37L 5FGRA 1A22B 5GRJH 3S3DB 3PL6D 1G7MA 5DJCB 3CFNA 3IDNB 2WWMC 4FFZL 4LMQE 1JPTL 3D7PA 4FG4A 3BLPX 4QI3A 5JXAL 2XN9D 3BH8B 3Q6FA 1MEXL 1TQVA 3IE9A 4XO4A 5FFLA 2XWTA 5K93A 3US1A 1Z5YD 3IBOA 1NCBL 1WT5A 2EDEA 3OR6A 3HE7B 5B39A 2IXQA 4YXLL 3AY4A 3IXAB 4FHJA 4D7BA 4N0FB 4GNKB 5ACZB 4W93A 3PU7A 1NDMA 2PTVA 2OXGB 3FZUD 4Y9FA 3LKOA 4FYRA 2FBJH 5MEOA 4LRNH 5JHDA 2XYBA 2YD3A 4JFXA 2AV1B 4Z76A 4KGLA 4XPBH 3KBHE 3NIGE 1N9PA 4EDWH 2YQGA 1QSZA 1PU0A 2CNZA 4NO3A 4X6FA 1ZLUH 2A4ZA 4POYA 3NGBC 2GT9A 4G42A 5F0JB 1ZTXH 1L7TL 1OZUA 5DRWA 3ZGHA 3G3LA 5F7UA 2X9ZA 4X80L 4XAKE 5IMMA 2PPDA 5J7CC 4J12A 3UTTE 5DQDL 3KBFA 1MCCA 2HT3D 1KN4H 2A9DA 2DWXA 4XVOA 1P4IH 5D1XD 1OGAB 5I18H 1AGCB 1ED3A 2ZUQC 3CVBA 2VABB 5MP6L 2IPTH 2ZCLL 1DE4B 4V33A 2ZICA 2VSCA 4GW4B 5GZNC 4FTDA 3JV6A 4P04A 5DJAB 1IJ9A 1S7TB 2ZKHH 3GBDA 4FTVA 3QQDA 3IETA 4QDGA 1OAYL 2DH2A 3S96B 3WUZA 2Q86B 3EO1B 5DQ9A 3CXHK 5K1VA 2W07B 3RWFB 1Y07A 3FUFA 3MA9H 1OSZB 4K94C 4P59H 3IU3A 1WFTA 2VDQH 4YWGL 3QXDB 1VACA 4QRQA 4IW4C 5KVMC 4GQPH 1HIML 1AJ7L 2ZNXA 1P7KB 4Z5RA 2M8XA 4R7XA 3ARGC 3CHXA 1PLBA 2FCBA 3HNTH 4ZS7L 4DN3L 1UUSA 5I1AB 2MMXA 4MNQB 2IPKB 4J4PD 3RNKB 2IBZX 4JHZA 1U21A 4NKIL 3GINA 2E9WA 4U1LB 4JG0L 3M6DA 2ODIA 2CHXA 1UASA 4W9ZA 3IN0A 5F7DB 4BJLA 4XGZA 3ULAB 3GMQA 5DJ6A 4BSWA 4ZUUA 3ZTEA 3BN9C 1WZKA 2CALA 2YD6A 1TEYA 4OM1L 3GMMA 1KXQA 2M1KA 5C07A 1TJIL 3T2PA 1A4JB 4HLEA 2BY2A 3BD3A 4M3JA 3O3DA 4CJ0A 2Z34A 4XPFL 1NMAL 3II1A 1M7IA 4LEXH 5E2UL 4D0BA 4APXA 3K6IA 4ZK8A 4OD2B 1H15B 2WVUA 4F2EA 3F12B 2WVSA 3ZBMA 1RUKL 3O41B 1FH5H 3LSOA 4KZDH 2JB5H 3S3PA 3OAYH 2E5EA 3CIQA 4XWOC 2UWEE 3ZE2B 4HSAC 1ZT1A 3L3IB 5GGQH 3CN4A 4G7YL 4LCWA 3VO0A 3WGVB 1IZKA 4LPYA 4WO4D 1UT9A 4F8NA 2YA0A 2AI0L 3A6CL 3MR9B 3GSRB 4DW2H 5IWLC 4YEFA 4P3WA 1CDUA 5E08L 2ZTBA 5JXED 4YSUA 1WIUA 4NQSA 4NPYB 4YLQT 4CKVX 4MXWL 3X11A 2V6HA 4BUHA 2OJZH 5A2CA 5C0EA 3L4UA 4JG9A 5AB2A 3PG2A 1YMHA 3RFZA 5B38G 4HUMB 4YHNB 4PR5B 3OL2A 4PJ9A 5DZLA 3IJ9A 5CZVH 3KLAA 2NNXA 1HHHB 2X1QA 2Y1VA 3LPGA 4DZBA 3O6KH 3ABMB 4HWZA 4XCYB 2H2PD 4P46A 1DTUA 4R26H 4K73A 4Y4HA 1UWXK 2WZ5A 3RWCB 3FF8A 3QDGE 2MPAH 3V4LA 2GUOB 5I23A 2XSKA 2ZNWA 2IFFH 5EN3A 5D71L 3IFNL 2IGTA 2NDGA 5F9OH 4OI7A 4FXKB 3KJ4C 3SD5A 2FT6A 4LNRA 1JPEA 3KBEA 4M6OH 2NQCA 1DSWA 4M8QB 2HVJA 2OMZB 4MB4A 2HJFB 2QADB 6FABL 3NZSA 3T08A 1JZDC 3OJ2C 3O2WL 4YSTA 3HRPA 3U1QA 2XJLA 3CPLA 2Y7MA 3QQ4B 3MRLA 1VA9A 4P5TC 4CSPA 4NWTH 3ETTA 1JWUA 4N87A 3TYFA 1G7JB 3WBDA 5FHBL 4H1LA 1N67A 5CXPA 2EE9A 1IFRA 4L18A 4HIEB 4PRHE 3NCYS 4WFGE 1TZHA 3VVVA 2B2XH 2GEEA 2LAGB 1CE6A 4TQIA 3NQIA 2O6CA 5FKPB 3MGTB 5FM5O 5TFSH 5E70A 3V5HA 1NGXA 3OJDB 4KRPC 4HJGA 5KSBF 3VWJA 3G6JA 1U95B 6PCYA 1F42A 1MJ8H 4Q6IB 3DBSA 1SYVA 2X38A 1DLHA 1E5UI 2XJKA 1KBKA 1AVAA 1A3LH 2DQDH 2ZOUA 3PIQB 4K5NA 4XI5D 2R8SL 3Q5TA 1SOSA 2WCSA 1SY6H 3E0GA 2GTZB 1OD7A 2C3WA 3EYSL 3DMMA 1OQXA 5IQOA 3FTZA 2UY7A 4WEBL 1BF2A 1B0GB 4JREC 1R1CA 2XWZA 4A7QA 5JIQA 3L5XL 1DYZA 4NQCE 4ZW6A 3LEYL 5BUAA 4PI0A 3ARBB 5DMJB 3UDWC 5K9KA 4WQOA 4ODXB 4LNVA 1N10A 1J7VR 4WV1A 4LGRB 2NYZA 2R1XB 5J1SC 1BXUA 4RVBA 4PTUA 3ZQWA 3QCUL 3SBRA 3UAAA 2B1HH 3O6FA 1OK8A 2D0HA 3AVEA 3BFQG 4AQEB 5AOIA 4X83A 4Q56A 4JKPH 3N50A 4WNJA 3AWFA 2WOYA 4MJ6A 4WWID 3MRCA 4C59B 5KSAD 1IKFH 1D5IL 3BCDA 5JYLA 1VKXA 2ZX7A 1SRDA 5DWUH 3WNIA 4DETA 1LEKB 1G43A 3L17A 5JXAH 2K7QA 5I5MA 1DVYA 1I82A 3Q13A 3SPVA 5C2BL 4M7LL 1DUYA 5LB1A 1BM3H 5F96H 1SVZA 3DI3B 3NSDA 5DD0L 3N0AA 4AVIA 2YSSA 1Z9SB 3HJEA 3VDCA 4HUUB 2JJUA 4APQA 5L4FA 4GLRH 3MV9E 4AJVA 3TN0C 4AKOA 3D3VE 3TZVA 4PJAE 2F5AH 2FJFA 4QHKI 2MSPA 3ETSA 1H3XA 3CN1A 3HRZC 1BAFH 2JJTC 2GITB 4KQ4H 3BKCH 5H94A 1UXMA 2FYVA 5KVDL 2QJDA 2CLVA 3QHFL 3WS3A 1I3GL 3B6SA 3U0WL 4IIQB 5BO1H 3FQWA 4M03A 3ZN6A 3CK0H 1QUNA 3RUGF 2BVYA 1ZVSA 1GIGH 3N6YA 4UQBA 5GS0L 2MOQA 1XV8A 5GIRA 1EV2E 5IHUL 2UZXA 1HCYA 1P4BL 1YEJL 3FU6A 3TIDB 4L3EB 3KVQA 2A99A 3SKNA 1BMGA 4JRXA 4MJIE 4DUWA 3TO4C 4CVWA 2QELA 4R7LA 1JTPA 2ZKWA 2P46B 2RH0A 5T1MB 3HG1B 4L8SA 1WISA 1EWHA 3GZOA 4KTDH 4O58L 4PJFB 2GCYB 4CN6A 1DQLH 2VDNL 3GSOB 3MRHB 5CD5C 2ZUVA 3H3KA 3BW9A 2AS5M 2VXQH 2OBGA 3I9AA 1LP9A 3U9UB 5FOJA 4Y1TA 4K94H 5G55A 1D3CA 3KWUA 4YHZL 2YPLD 1NC2D 2W80C 4ZS7H 4EN3B 2C9AA 1WTGT 3T2OA 3PNWA 1CFMA 1JSYA 1LD9A 3PGDB 3MPCA 3O8XC 2ITFA 1QA9A 2YBRA 5DS8A 4FZ8H 2J1ZA 1ZD6A 1RKRA 3MJ6A 3SPHA 2HFFA 3TESA 4YSPA 3JYCA 3O2VH 3PP4H 4ENED 3FOMB 1H0DA 3NESA 3NCEB 1BFVH 4UT9L 2MCMA 3OM3B 3R7RA 5IVZA 3B3BA 1CT8A 3FT3A 3HPLA 4G72B 3G5VB 1ND0B 7FABL 5BXFB 4WHYG 2C9XA 3HZYA 2X7LB 2LFGA 2EIMB 3N1FC 1ZWIA 3BWUF 3V5DB 1IBFA 4YN3A 3CN3A 1KCVH 4CN1A 1I7UA 2MEJB 3L7FB 3PAUA 5D4JA 2D03H 2QSCH 4G8GD 2F54E 2X4SA 2AJVL 3QUXD 1E27B 3D2UD 4ZFFB 5CUSL 2L4OA 4PU2A 4GKNA 5IF0B 5EO1B 1S9VA 3GXDA 3IS0X 5EC1A 15C8H 3MNZB 4KROB 5EUOF 4F3FB 5EO9B 2WTRA 2R1YA 2V5TA 1SHWA 1FYTE 1XR8A 4TVSa 5C0BA 2R9HC 4OQ1A 2J7LA 1OF2A 43CAB 3GO1H 1GGIL 5AYUL 4XP9L 3DGDA 3LV3A 3UGEA 2TRYA 5T3ZL 4KHXL 3IDGA 3ORJA 3GUFA 4NKOA 3WO3B 1NGYA 3HZVB 5FECB 1X4YA 1A4KB 2P5ED 1G1CA 2CLZB 4MXWH 1EZVY 2P45B 3MJWA 5FO7A 5IUCA 5ITFA 3NABH 2Y24A 5FUOL 1JPFA 3O81A 1AGFA 1TYEB 3T3MF 5HI4D 3VSUA 1FE8H 4GSRA 3HTLX 2DQGH 2PO6A 4PSRA 2VXUL 3HB3B 2HKFH 2QKIC 1A9EA 3EYVB 4Z7UE 3OGOE 5FKAB 1Q38A 2VDRB 2EXWC 1FNSH 1YZZA 1ZA6B 1EXUA 4YMPA 2AEIT 3WHE1 4X2UA 3VI3E 5IQ7L 4LFHG 4PJDA 3DX4A 1VFUA 2J1XA 1IM3A 1NJ9A 3PQYB 3LHPL 2XZAL 4YFDB 2FX9H 2BNRA 4PGBA 2DICA 4LHUB 3AZUA 4QRPE 5E1IA 1BIIA 3GBNH 3ZMEA 3EH5B 2O61A 2V9RA 3QAQA 1K8IA 3MJ8A 4PJGA 5K9OB 4N5UA 1OAJA 1AO7B 2Q0ZX 4NO2A 5FYJL 2FO1A 1CFSA 3US0A 4QWWC 3CXFA 1T21B 1G7HA 2BC4A 5D72L 2HJLB 4E9LA 5JO5A 1UH2A 2H41A 3V4PL 1HSBA 3W82A 1TVHB 1JZIA 5DGQA 2F1BA 2A6IB 2XY1A 3MUY1 4I1RA 5CEZH 2AEWA 3MXWH 4PM1A 5E95B 2OMXA 8PAZA 3CUPA 2C7FA 3R19A 3GSNB 3JTSB 1DFXA 4I85A 1AKJB 1FBIL 3PDDA 4N85A 4RFNB 5L88H 2FD6L 3B7TA 1UD3A 5DLLA 1E28A 1WWAX 4JQVA 4NUMA 2IAMA 4G9FD 2EKSA 2Z65C 1OP4A 3WGUB 2HLEB 3BWSA 4NC2B 1HCVA 1NPUA 3H9SE 4KK9C 4RMQA 1CIUA 4GMTL 5EUKA 1NSNL 1D9KB 1EAJA 2ZOOA 1Z0NA 5JHLL 3F64A 4OFVA 3C5ZA 3GMOA 3VH8B 1J0KA 1W9XA 2VR5A 2AVFA 3RDTC 1C5CH 3LEVL 4Q74A 4G80B 3BVUA 3X3GH 1DJSA 4R0LC 3IDYC 3FC8A 4I5BB 2ADGA 4EDXA 4BDVA 5HY9B 4N6RA 3ARSA 1UWYA 4PLJD 1WYJA 1OARL 3GBEA 1HXMA 3KNBA 3RL1A 2I07A 1UD2A 2OMNA 1NUGA 1SJXA 1M2OA 5MENB 2E6JA 2YOCA 2IWGA 4ZMNA 1VADB 2MOGA 4JZJC 4MB3A 1KB5L 5MEQB 2EIKB 2YUVA 2E7MA 1E8XA 2O6EA 3JWNE 5J11C 5B4MD 3V6ZB 1BQUA 1QBMH 1W8NA 4FMVA 4XN7A 3ZKND 2O1AA 2DLGA 1Q9KB 5FF6B 2AF2A 3DYMA 1S5IH 5F1SA 4WI2A 4ODWB 1UA6L 2WO3B 4NNYB 2NY5C 2HMIC 3C9NA 3QORB 2ISDA 3BQUC 3ETBF 2JQAA 2VLME 1G9NH 1QBLH 2NY5L 4K5PA 4N8UA 3QUML 5DHVB 5I5RA 4B9YA 3GLAA 3VI4B 2KLSA 3OKOB 1T04B 4EUPG 5HGAB 2FAUA 2ITDA 1BLIA 4B9ZA 4Z7VB 3OKMA 2CKBB 4OQTH 1DVFA 1NOFA 4X4XA 2O5YH 2AANA 2XVBA 4RMBA 1J1XL 1UJ3C 4YFLI 3ZUNC 1W72H 5D4IA 1MSPA 3FCTB 1EZLA 1FWXA 3MOAL 3P0YL 4LMQI 3B7UX 4OGZA 1B88A 4HG4J 4YSQA 5CZXC 1HINL 2KC0A 2IADB 5MERA 1AFVH 1HTYA 3S97C 3MRDA 1I31A 3EOBB 1TFHA 1RUAH 3TO2A 2EIBA 1J0YA 2IO5A 3BDYL 2F8OA 3LNFA 1KYOK 4F37K 3VE0B 4WF7A 2E76C 4HCGA 4XNMA 3TNMA 3OLGA 2H6OA 2JE8A 1EGJL 5IHUH 1S9KC 4Z9KB 3SGJC 3ABKB 2H6UA 4GSDL 4JK0D 4R9HA 4IRZA 5D2LB 2J8OA 1ZTMA 2WKLA 1CDYA 1UUNA 2OL3L 4NKDB 2PP9A 1QSVA 3V0WL 1NKGA 1OAQH 4G5ZL 4GS7C 4W4OC 2VN3A 2XZCL 2WB1A 4JE0A 4PLOB 3WE1A 3V9EA 2YFNA 4JO1H 4IU3A 3DXAD 1AZZC 5B8CC 5HYJD 3MJ9A 1YLBB 3T6XA 5EO0B 1ORQA 3Q9QA 5L2JB 1UM6L 3SYAA 1F4AA 4NGHH 5GZOA 1HCZA 4HCFA 3VWKA 3L1GA 4I9XA 4PJBF 4CUCA 4TL4A 1RZKL 3QDJE 5DURB 3QCVL 5EU3B 4WWKD 3UZVA 3HC2A 4HEPA 5IB5A 4GG6F 4DP8X 3CJJA 4H20L 2WZ0A 5J5EA 3EGDA 12E8H 4F9LA 3I6KB 2WB7A 3CFCL 3BZDA 3QQ9C 2UWEA 5AOMA 3Q9PA 5KYYB 1UH3A 4QYOB 1XD0A 1ZLSL 4KJWD 3C8HA 1J9TA 4DOHE 1KCRL 3VB8A 3VFMA 1W91A 3VFUA 3BLBA 3FQRA 5GGRB 2CK0H 3BHBB 1O5DT 4P2OC 2V0AA 2XN9E 5DR5L 4QEGA 3RVXD 3ULVD 1F4WL 4ZO7A 3FUHA 3PREA 2BVTA 2BCMA 5D4HA 5I1EL 2X6VA 1CXKA 3LKSB 1MFBH 4ELME 1YJDH 5E6IC 4LVHC 1UGNA 3H9YA 3V4VL 4GRWF 1KIQB 3TYGL 1AXTL 4JHAH 1WCQA 4I2XB 4U1GB 4FXGC 4OJCA 4RWYL 5DDHA 5IEHB 2XZZA 5IROA 4DO5A 5CJXA 1RUQH 5CJBA 5CIPB 3QH3A 5F3FA 4TVPL 4YLBA 1UGKA 1SN5A 3FTXA 3NEXA 3BJLA 3N1MC 4IMKA 4ZXBC 5EOCH 4Z3IA 3EFFA 4HV8A 2D7OA 3VMOA 5D7JB 2ATPA 2WNKA 2XQBH 2Q87A 1VGKB 3CSFA 3P3YA 4TSCL 1MCWW 2EH8H 1CFTB 3MU3A 4GKZA 4XMLH 1OIOA 2DN7A 4GT7A 4Y5VB 5F21B 1ZT4A 3KR3H 2WWMD 4DERA 2JLLA 1ROWA 2QTEA 4ZNCD 4ONGL 1ZIBA 1MHCB 1WAAA 1DQJA 3KPQB 3GLZA 4FQ1L 1HZKA 3L5HA 1SVBA 1L7IL 5D1XE 1O6VA 1MHEA 5CLZA 3RJDA 1NWPA 2AZAA 3ZPDA 1YVLA 3BUYB 1JHLL 2Y7QB 4FG6C 4HALA 4RFEB 4OGYH 4V1DE 2VAAB 2Z9TA 1VJSA 4PRHA 1RIVH 2Z92A 3F04A 2DDQL 1CFVH 2CLRB 5K1JA 2NRDA 2EUXA 3QQXA 1RHHB 3CQFA 1BIHA 3VU2A 1MJUH 4YDJA 1TJGH 1DVTA 1DJGA 4HK3N 4BH7B 4Y2LA 1B4LA 3D3VB 2NZ9C 5DRZB 1PEZA 2J5LC 5DYOB 4PJIE 2UZIL 5F88B 1MHHA 3CN2A 1W6LA 4PJXA 2TAAA 4IMLA 5C1MB 1WBZA 5KVGE 4FZEL 1WC7B 1ZGLP 3LRMA 2WLYA 1S3KH 2F18A 3K6SB 1GZQA 3AQDA 2F74A 5GZND 3H54A 3VFRA 2I9TB 4XNAA 4XMVA 3MHZA 4NQCA 5AOJA 3RWJA 3H3BC 3PABA 1E7VA 1XX9C 4G6MH 3W9EB 5CGYC 3JWOC 2AQ1A 2DQHL 5G4NA 3ZDZE 1EVUA 2CR3A 3WIHA 4NENA 2EEFA 5CMAA 5D7LA 4RQQB 2C1PB 4RGMB 5HHNA 4FCAA 4AXWB 3IFLL 3UAJA 2EDNA 2AABL 1QNZL 3BE1H 4FGMA 4MJ5B 1G7IA 4TS6A 3NCCB 4JQIH 4MASA 4QF1A 1BZ9A 2Z91A 1OLLA 4L3FA 5IW1B 3WNMA 2OQJA 5C0IA 4HH8A 4OCLC 2IH1A 4MCZB 2W65A 2IH3A 1JGUH 3F58L 3FO9A 5BRZA 4A37A 5K9JL 5T1KB 3ROLB 2YLHA 5EIIB 1DANU 4UAOB 1R33A 2N7BA 1J9CT 4NLHA 4ELKB 4RWHA 2G3XA 3HBZA 1TTFA 3W39A 1QZ1A 1ZEAH 1JNLL 4HUVB 3KEDA 4TSBH 2R39A 4H25B 4I48B 1Y7VA 3DX9B 2MHAA 4AV4A 4PJAA 1ROCA 3MKGA 5LBVA 2GK0A 4DZ8B 1F45A 1RERA 4TQ8A 2NNAA 4K15A 1E6JH 1N8OE 1RMFL 3FRPA 3DHPA 3K8MA 4L4VB 4WUKH 3RZWA 6CGTA 3EFOB 4AQZA 5T1LD 1XF2A 3PDOB 4FNSA 3TEZA 2P7TB 3UJTL 1QI3A 2ZYRA 5I5JA 3LD8B 3BIAX 3KYOB 1I1FA 1HT6A 4XO3A 4IBUA 1S4IA 4N0CD 4WEUD 1QVOB 3I9IA 1T3FA 1XIWB 1A4CA 2X0WA 3D9AL 3WTYA 2XC8A 2IDQA 3WIAA 1QTSA 1MAML 2CMRL 2R2HB 5AWNL 1ID2A 3U83A 4YHPA 1O7DE 1BWWA 4K5OA 3CFEA 3T6QC 1FDLH 3V95A 5F6HI 2LU4A 4O2CB 4Z7NB 2NCEA 3O3EB 1FC1A 4HK0A 1FVEA 4LPCA 2ILLA 3S0PA 2P24A 4MJIA 2HP4A 2QZQA 4NBYB 3PE9A 2A9NL 1NKRA 4NKMA 2OSXA 2ICWA 2ID5A 2BVPA 4U1MA 3ZO9A 5IVXE 3M1OA 1YC8A 3PAYA 3QUHA 1IGYA 4WJKB 3T8XA 4KKCD 3DOIA 2YEVB 4YXHH 3WU1A 3WKPA 4WW1B 3N9GL 4JANA 4XNZC 1EJ8A 3F7QA 4OT1H 4JVUA 4Y5YC 5TE7H 3QIWC 1E4JA 1SEQL 2F53D 3QZBA 3BWUC 4ERSH 5CCGE 2FWOA 3MRFB 4ZNEE 1VDGA 3BAIA 1BEYL 3QHTC 1F3JA 1KJMA 4WJ5A 2C9QA 3CLEH 3QK0A 1J0JA 3EYUL 2Y9RT 3SZ6A 5D1QC 5F7FA 1P4UA 4RFOH 4UDTB 4GSDH 4XP1H 1A1MB 3HFMH 4U6HA 1R5WB 1RFDH 2FE0A 2C7UA 2ICEC 2YPKA 3LZFH 3QI9D 1M3JA 4JN1L 2PNDA 3TA3A 2JK5B 4O4YH 3HS0C 4P2YA 5T3XH 1EZVX 1H6EA 2D3NA 1BYOA 1I1RA 5IM7B 4BK4A 1L9MA 2XV6B 3NSJA 1I8LC 3VU1A 3MACH 2V5RA 4YQXH 1SJMA 4ORGA 1RZ7H 3GDBA 1JTOA 1CJYA 1OGTB 2YD5A 3HFFA 3KGRA 3S4SG 4F8TA 4DVBA 5KS9B 2F54A 4NHUA 1MRDL 1BQHB 2A9MH 3AAZB 4Y2OA 1MVFA 2VL4A 1BOGA 2A3TA 1NAMH 1E8ZA 3WDJA 1KIPB 3OHXC 3QCVH 3DPDA 2B7DT 2Z3FA 4A68A 1CL7I 4KKQA 4L0ZA 3U36A 4FJYA 2HLAB 4B60A 4B6ZA 3OBAA 4XCFL 1J8HE 4PV8A 1UEYA 2SODB 3H1ZA 3N41B 2WIMA 3ARQA 5C86A 3WFBL 4DGYL 4DWHA 2H6PB 1HKFA 1FFNB 4O02L 5TF1L 4K3JL 3QDHA 1XZ0B 2EIJB 3EF7A 3HMXA 2OZNA 1ORSB 1LMIA 3SY0A 4K2UL 1ZRUA 5HDQL 2CKNA 4OJFL 3MRBA 4Q9RL 1G5GA 2YWZA 1U8IB 3MREB 4ZFOB 1OAKH 4DT2A 4Y4FB 5I1EH 3KLHC 3NFSL 5ANME 1S6NA 1IGCH 2CIKB 2C3GA 4KK8C 4XHJD 4I3RH 3T0DA 3TEUA 4QNPE 3L7EA 3QIBD 4BA0A 3MV8A 1DEDA 3F7YA 4N2EA 1V7NL 4J3OD 4KTYA 5DF0A 4HXBL 2YEQA 3S37X 32C2A 3HE6D 4Z7UA 5CBAB 1PZAA 1OB1A 2XG5A 5EIVA 2MOVA 3Q6GL 4JFDB 4BV1A 3NH7L 4XTRD 2FVNA 1KJ2A 2HVKB 2CO7B 4GBXB 3WI9A 3IFPB 2EC9U 3RY5A 2FX7L 2FJHA 2AK1H 1PZBA 5DEGA 5ALCH 2YQBA 3MRJB 3QAZB 3VXSA 5TE6L 2ZG2A 4WI8A 5E2VH 3RVTC 3HPJB 3WXVH 4QRPA 3ESOA 1KGXA 3WIIL 2EYTB 2NQDA 4HIPA 2G3MA 5I66A 1OL0A 4NZUL 4QRSB 4AK1A 1OGSA 3P54A 2NY4C 2ZXAA 3WLBB 1EEYA 2B8OT 4NERA 2P48B 2LE9A 2D0GA 1OVZA 3UL4A 1JL8A 4W4NA 3WHXB 2UZPA 1JZ8A 4PS4L 2YAPA 4A67A 3KDPB 3DOSA 3BLKA 3DHMA 4TLSA 3TN0D 4AT6B 3LS4H 2VXSL 5I17A 2LQRA 2WGNB 2XFXB 4U3CA 3KYNA 4WI3A 3OMNB 4P4RB 5DA4A 3MO1B 3FUMA 2WMPA 4JDVA 1BVNP 4PGZA 1E7UA 3TBVB 1FVCA 1AY1H 1BQ5A 2DD8L 1AKPA 2HFGH 1EERB 3WEMA 3MNWA 3QUZC 5DUML 5H37G 1U8PA 1NGZA 1X7SA 3IAQA 3LKRB 3SBWA 3IDIB 3CZUB 2Y0SA 1XSIA 1CICC 3ZE2F 2YPLE 3ECWA 5C09B 4EIGB 5GGSY 4PLKC 5GS0D 2Z64C 1IC1A 1NDGA 1TQWA 2R27A 1HJCA 3JBG7 3H9SA 1QI4A 4DN4H 2PW2B 4X98B 1A9VA 3OX8B 2NZ1A 4XN1A 2OP4H 3ZR6A 4R83A 2H1XA 2CUIA 5EN2A 1B3JA 3WJLA 4KO5A 1JCKA 2WGXA 3EJZC 5DHEA 5IY5B 3RP1A 3TO4D 5AOLA 3T0VA 1A6AA 3VX1A 1WBXB 2B1AH 1QACA 1S7VB 4X50A 1ZVYA 3RWGA 2KPNA 4HSCX 3NFNB 3KYMA 3JWOH 4WNSA 3UBXA 5CD5D 3HC3H 3M7OA 5D1ZC 5CHNB 5T1DL 3QRFM 3SDAC 5HDLA 4XP5H 1Z3GL 2WXMA 3OLIA 1A6ZA 1XGQA 1SHXA 4NT6A 2ZE0A 4ZMPA 2APTA 3KYKL 5CEXA 1NFIA 3D85B 1U33A 1CQYA 1UCBH 2YC1B 5JW3H 1TQBC 1URIA 3Q1SH 5ID0B 3O8XD 2GG1A 4KZ0A 4OFYD 3FN0L 3LNHA 1MAJA 2XNAB 3A67L 1VCBC 1YY8A 4UQDA 3GHEH 1PGRB 3HLAA 3TWCL 4FYQA 3F7VB 4HEME 1TNNA 1LVEA 3PUCA 4L1TA 1FNLA 1GZHC 3CVIL 5TQ2H 3KWXA 2RR3A 5H2BB 3QCTH 5JPMC 2A9AA 1AQDB 1JK9A 2P5EE 4NM4H 4UWQB 2CU9A 1ZA3B 3CXDL 4HQQH 4NN5C 2Q8BL 4P4KD 3O4LE 2GJ6A 2HJKA 4G6KH 4JY4B 5JORB 3QR0A 3D25A 4XNYH 4ZG1A 2DIJA 5JOPD 1G6VK 1K3ZA 1IV8A 1X5HA 2BNUA 1FFRA 2YKLH 4E0RB 4P2AA 2OMYB 4NN7C 5JR1H 3PWVA 4C54A 2JI2A 1KCWA 1FIGH 1KIRB 5DD6A 1KEGL 3C6LB 4OVUA 2R9HD 3IDXL 2BMKB 5HVFB 1ZV2A 4AVKA 1ZLWK 2P9RA 2WW8A 5HYQA 3GJFA 2JFCA 5T3ZD 3BP6B 4XNBA 4BBWA 4HZLA 4FMFA 4KPHH 2BHFA 5TDOA 1HQ4B 3BH4A 4Y1AB 5I76A 1UB6A 1ZTXE 5C7XL 4OZFA 3FB5B 3U7WL 4G71B 1H9DA 5I1GH 3C6SA 2R29A 3LRSA 4YVNA 3NCWA 4K23L 2J21A 5ITBH 4A7GF 4PCYA 4A6YB 3VFSA 4NQTA 5SWQA 1A25A 5AQ0A 1OK0A 1PZ5A 2BIPA 4RAHA 5CJOL 3RNQB 3M7FB 3SE4C 1AS8A 2J8UB 3GK8H 4ZAKB 2EXWD 4YK4C 3SGEI 1V3LA 4MD4A 4UQEA 1HX0A 4NOFA 3VFWA 2XHNA 5DO2D 4OD3H 1UOWA 1VPOL 2WYTA 1B3IA 2WC7A 1RD6A 3UP6A 3Q8BA 2A74B 4H26A 4U3HA 4AC4A 2UY6B 4Z1PA 5FYJD 3GS4A 1EBPA 4R2GB 1BQRA 4N0YL 1P1ZB 1AD0A 4OIFA 4CN4A 5ADOH 5FO9B 4FQCL 3TNNA 1ZJBA 4QWWD 3P9WB 3QS3A 4IKKA 2C3HA 1KJVB 3B83A 5IQMA 5ILTH 5FUZH 4GI9A 2XN9A 3AXIA 5LCVL 1MF2H 3Q6FB 1UM5L 2ITEA 4R5TA 4XMUA 1TJHL 2MPVA 3VG0L 2EDJA 5SX4I 3T0WA 2AFNA 1V3JA 4YH6A 1DJIA 4LAJH 4JL2A 2JTDA 2WN3A 1NDMB 1GCFA 3GSQA 1AOZA 3P4LA 3NIDB 4GXFA 2EINB 4JRFA 1XF4A 5MEOB 2DQMA 1EAPA 2XQYG 4I9WD 2N59A 4Z76B 2DMBA 5AB0A 1GZPB 5E1QA 2XXGA 1S7WA 1HN1A 4Q9CA 2NY1B 4KK9D 3ZDZB 3IAGC 3MLZL 3CBJB 4NFDA 3SQBA 2GT9B 3FSAA 3I02A 3RTQD 4GFXA 5DRWB 2ZJSL 4JFFD 2K1MA 5BZDB 5E8PA 3FO1B 4PJFF 4NP4L 2WBJA 3ASOB 1HHIA 5IKCA 1B2WH 1ED3B 3BMVA 2EDKA 5GQBA 1CFNA 4L37A 1RL1A 2P52A 4V1DA 5HGGS 5C6TH 2NY7L 3REWB 3JV6B 1MFEL 3U6RB 1U3ZA 2VC2H 5T33L 4YSEA 3ZVVA 2P43B 1G4RA 2BH0A 4E5XB 1QWHA 1F02I 3AROA 1MFVA 3QQDB 1O9WA 5AW7B 1G84A 2X4UB 4XMWA 1ACXA 4XVJL 3RPBA 3SOBH 4WO4B 3ZKMC 5JIMA 3GZPA 3WIIH 1NIAA 3IU3B 4WK0B 4Z18A 4YHKH 2CH8A 4D8OA 4LPTA 1DQQA 1VACB 4OB5L 3UPCA 1MLCA 3CVHA 4Z5RB 3C2AH 1WEJL 3QEGH 1GXEA 1NC4D 5HHOB 3EJUA 1M2VB 3RWIA 3D05A 4LLWA 1KLGB 2AK4A 2HG0A 1JV2B 2CPCA 3FNKA 3UACA 4NZRL 5C3LD 3ILQD 2J4WH 3KLQA 2V9QA 1P7HL 4TUJA 2R2EB 3DO4A 1NLBL 5L0QC 4YHYC 4LASL 5KUMA 4F57L 4FHKA 1S3RA 3GMQB 4XGZB 4I0PC 4BSWB 2HTKC 3D0AA 2XYCA 3KCPA 1FL6A 2E7BA 5CZXD 4NUGH 3DXAE 2DPKA 1FIEA 4WHDA 1PZSA 4HD9A 4Y2DA 5C07B 2Y3NA 2EH7L 4UIMB 3NCBB 3O3DB 4J7RA 2WAQA 5AW5B 2HKHL 4KQ0A 1UWGL 1ZIAA 5E4AA 5AZEH 5I0YA 4YGAB 3D39D 3LDBC 5EBLA 1MCDA 5IJVB 3CLFL 3L5WA 4YDIH 1CC3A 2GAZA 3LSOB 1B4RA 1HKLL 3KGTA 2GSGA 1SZNA 5E9DE 2AQPA 2G5BA 4WSGA 1M1SA 4HIIB 4JAMA 1L9OA 1ZGLB 3UTOA 3EJPA 1E42A 1A3ZA 1ZT1B 2VSDA 2B9AA 4JM2A 4MX7A 5KVFE 1HDMA 3IGKA 4LCWB 2VDML 4UTAL 2CIIB 2BINA 4MQSB 4GRLC 1Z5LB 3RBSA 3ULVE 5JXEA 4NQSB 2VDPL 3HNSH 4M48L 4AEHH 4Y9BA 1ZPUA 3H7LA 3X11B 1QHQA 2G75B 3ZDYE 5C0EB 4F15B 5E9NA 4BCXA 1JPSH 3DI2B 4OCXL 5DRNA 4YDLB 2CA3A 4LT7A 5IJCC 4ZTPH 3EO0B 4N90E 1AGBA 5JQHC 3Q5OA 2AJUH 3KLAB 1I85A 3K0YA 4DZBB 2B5IC 1OM3L 5HPOA 4HWZB 2Q7YA 3GJFK 4P46B 4C56D 2O5XL 1QI5A 2AJSL 3QISA 2PETA 4QCIA 3HLKA 3NEOA 3QQ9D 5EF0A 3VD5A 4KZEL 1MVUA 1V05A 4HHAA 3NA9H 1UM4L 2YWYA 2BOCA 4LNRB 4M1GL 1T7WA 1AI1H 1F6AB 1INQB 5ABZA 4FA6A 1KLUA 2FNBA 5AAWC 2RAMA 3CPLB 3N55A 3UTZA 2A6DB 3KPLA 3DX8A 1JWUB 3TYFB 1Z1WA 2F1EA 2H26A 3L2LA 1FZKA 2Z7UA 1NCCL 3SDXE 1MVYA 1IBGH 3HE7C 4KTEH 5ECJE 1JWSA 4TVPD 1ACYH 1ZXKA 1JDDA 4ZNEA 1TZHB 1IB5A 3WLWC 5J56B 1DVXA 1CE6B 3TWYA 3CHRA 1BECA 5D2NC 2DLFH 2XRAL 1X5LA 3V5HB 4C83A 2DY2A 3GTTA 2AKRB 3CH8A 3QO0B 4RDQF 4TKWA 2G9KA 5FM8A 4WO0A 4HJGB 5BMFH 2VN6A 4R7DA 1PY9A 3RHWK 3VWJB 3G6JB 2FNWA 1SHMA 4JFVA 1FNEB 1TIUA 3ZMRA 1SYVB 4MTMA 2NQ3A 1KXVA 4DO4A 4U1SB 3I6SA 5MI0B 4HWBL 1T6WA 5DEFB 3GNML 3NSXA 3DGGA 5LVEA 4GUPA 1IUZA 2Y25A 2IIJA 3DMMB 3A0OA 4LBEB 1GOGA 4TNFA 4IEFA 1RUPL 4NDMA 2FECL 1UZ8B 3MUHL 3E9TA 3OKLA 4WI0B 3GIVA 4WGWB 2P5PA 5IHWA 1TVBB 2MQCA 1PG7L 2WXQA 2CAKA 3H0TB 4PRID 5CCKH 5IFAL 4Y16B 3VCLA 2X2IA 1BBDL 3BKMH 4UV4H 4X0NA 4V2CB 4WV1B 3AGWA 3MSPA 1F3RB 3K3QA 3NMEA 2VLJA 1J8HA 1JF5A 2KS0A 2ZUXA 4PTUB 1WFMA 3O6FB 5I1LA 2VW4A 4NUQA 2NZ9D 5BVPH 4QXGL 1NFAA 1YECL 4XMPH 2YAHA 1IGIH 4TNEA 3MRCB 8FABA 1EAOA 1GOHA 4OR1A 1VKXB 1JE6A 1UG9A 2J73A 2ESVA 4KWUA 3ATDA 1SHSA 4Z7VF 1Q0EA 4ANUA 4E9WA 4JO4H 1CBVL 1ZHNA 1FFOB 1E4XI 9CGTA 1DUYB 1QFWI 5ANMA 4GG8A 3FMGL 1SXBA 2YSSB 4RZCB 3FYIB 3FUNA 2LLLA 1JF1B 3FK3A 3TGXA 4AQAB 2BOBA 4BZ1A 4APQB 1HOCA 1JV5A 4JPWH 5DZAA 2XX0A 4JFPA 5CGYD 3IT8D 3TZVB 1U42A 4I77H 1MPAH 2CJSA 4QRUA 4A7VA 4X0KA 1IJNA 2WQWA 5DVMA 4LCUA 5H94B 2P47B 1AGDA 1YCSA 1H6TA 3LN5A 2CLVB 1C1EL 3WS3B 5FDYA 3B6SB 1SMAA 3RZCD 3L13A 5D2LF 3FQWB 4BEIA 4KZDL 2CM6A 4G8GB 3VFTA 3S8FB 1KULA 4NNPL 5DJDA 4N6QA 4FG2A 1ZCRA 5DFAA 1SEBA 3MYJA 4OUUB 5EOQL 1E3FA 2ZXEB 3D2UB 5GIRB 3WKML 2XCMC 3D5OF 3OPZL 1M6UA 5ABAA 2FT8A 3SKNB 4JRXB 3SDDA 3EH3B 1CI3M 3C5SB 4LSQL 4HC1L 1TNMA 2F5BH 3HG4A 1SLVA 3ISYA 3MRKA 5ICZA 1UWXH 1OALA 2WKOA 5IOPA 4L8SB 2WCGA 5DC4B 1GHFL 5ESAA 1DR9A 4EI6B 3IDUA 5F72S 4L1SA 3BW9B 3LIZL 4JDTH 4X9GA 4ODUA 5BNXD 3KPPA 1DL7H 4Z3TA 5I0ZA 4GW5A 1LP9B 4XAWL 1QD0A 1KACB 3MLYH 5AVTB 3NJHA 1BFSA 1RZQA 1NC2A 4ANKA 4A7TA 5A3ID 5FHAH 1SJHA 5FS5A 3QJHA 1N3NA 3IJEA 4E42B 4AIEA 3PNWB 1TO4A 4UT6L 1E5BA 1RI8A 3OAUH 1QA9B 4ODHL 5BRQA 1JFQH 3HHMA 5AW4B 4NQUA 2HFFB 3QXTA 4C4KO 2WWNA 3L3DA 3AB0B 3C12A 2FSEA 1XGYH 2DI8A 1H0DB 4J8RA 1ET8A 5IVZB 2P5WB 4Q9QH 4YXKL 1CT8B 3HPLB 4E41A 2ZP9A 4EIZC 2FR4B 5F1IA 4B95C 3FBQA 1MQKL 3QFDA 4UZGA 2QADC 2APSA 3HZYB 3F3HA 1K6QH 5TQ0L 1AS7A 5I73B 4KXDA 5JOEA 3PWUA 4PD4J 1YQ2A 2VKWA 1YHPA 4ZMZA 1FNFA 1NEZA 1Q8MA 1I7UB 1PZDA 2H7WA 3TASA 1INDL 1GPOH 3QIWD 4N0UA 3WN5A 1T1XB 4TQPA 1A6WH 5CEZE 1XCTA 3CVDA 5TE4H 5I1HL 4ODVH 5B39G 5DHMC 4YNYA 3GUTA 4GKNB 2MCPL 4XP6L 1S9VB 4DP2X 4PJCB 1HKLH 5EC1B 4DK5A 4M5ZL 1CUOA 1MWAL 2WVVB 2XN0A 2DEWX 5D1QD 2WTRB 5FFGA 4NQEE 1Q94B 1MUJA 3IPFA 4XP4H 2R69H 4FI6A 4Q6IC 1SBSL 5GSVA 4BUQA 2B39A 1YN6B 2CXGA 1NBYB 1UOKA 1MRFH 3LV3B 3VQMA 1UXWA 1WZ1L 3IDGB 3UTSD 4F8OA 4PJ7E 5E8DH 3STLA 2COVD 5BV7L 3N44B 4F7PB 1F5WA 1ZHLB 1QYGH 2JKNA 4G9FB 3GKZA 3Q44A 1B2YA 4RNRA 3O4LA 5ESVA 5ITFB 4DTGH 2YD9A 1AGFB 4J23A 1OCOB 2IFGA 4OLZH 3W0WD 3W5MA 3SDYH 5GGVH 2N56A 3ARBC 1A9EB 4M8RA 4UV7H 3FT0A 1F58H 1EXUB 4KI1A 1H3UA 2EQDA 1E50A 4Z7WA 5I16A 4PJDB 3FQ1A 2BY0A 4G6JH 4RGOH 4AYDC 2QHRH 1RULL 1A7OH 3ABLB 5EZLB 1QSEA 1T7VA 1I7ZA 1EQWA 1JUFA 3LH2L 1E9OA 1KGUA 1MG2C 4PJGB 1RUMH 1C16A 2BW5A 1ZJAA 3GXTA 4G8AC 4NO2B 5I6MA 3MRRB 2ZQKA 4PRNB 1QP1A 4BQCA 5IFHH 3K71A 2ORBH 3D4GA 2FWSA 5FFOA 1G7HB 4KK8D 5JO5B 5JUEH 4W9CC 4BE6A 1HSBB 1X7QA 4H13C 4XCNA 4F93B 4TLUA 5FYKH 2CGZA 3DBXA 3V4UL 2OMXB 2X89D 1MY7A 3ZTDC 1Q72H 3IJHB 4PJ5D 4O2EA 5KVDE 1MCQA 1YN7A 1GGBH 4LSRH 3ZRCC 1TF4A 2PCFA 3NK4A 4WWNA 1X44A 4GKLA 1JDCA 1MCNA 3LS5H 1F6LL 1BBJB 4OGQC 1PSKL 4IIQC 2FH8A 2IAMB 2VZUA 2YOAA 3OJVC 2EKSB 5LGHH 3HZKA 1KCUH 3POCA 5IP4A 3DVFA 2PYFA 2R4RL 1UT1A 1OD9A 3A21A 2XOTA 1P0SE 2NY4D 3CFDA 3KPOA 1YEGH 4KX9A 4OGAC 5DHXB 4DGVH 3L4WA 5AG9A 3B34A 3C5ZB 5AYTA 3GMOB 4EBQH 3I85A 3MBWA 5I30L 4YVUA 4Z95L 3U4BH 2R1WA 2ZAHA 1UZ6F 3OF6A 1LMKA 2R83A 3B9DA 5KN5A 1A7PL 3U82B 1IQWL 3LIUA 4N6RB 3K6FA 5JHMA 2YAQA 1NCAL 3KGSA 5J6SA 1BJ8A 1I3VA 1T0OA 4YEEA 4JR9H 3KNBB 3RL1B 5D7IE 1E4WH 2I07B 3REVB 4AYBA 1MCHA 1X5AA 4TULH 3ZT7A 1F00I 5B1JA 2BRRL 2PTUA 4IBVA 2M83A 5DVLA 3TV3L 2D31B 2PW1A 4X5RA 4BFNA 4QXGH 4GSXA 4D8PA 3QUZD 4NJ9H 4GSQA 1CICD 4Z7NF 3KPNB 4RX4A 2HN7A 3ALXA 4PLKD 4XVSL 3B9KD 4EN3C 1YEHH 5GRUL 1E2WA 2JELH 3RG1C 5HYJB 3OXSB 4HMDA 4TV3A 1U8LB 1NIFA 1FN4B 5DSCA 4OZIE 2O26U 4ANVA 3WL9A 4QOKB 1J8KA 3GKWH 3KPRD 3NJNA 1XF5A 4TLTA 2YMXL 1QG3A 2B9BA 2IH8A 3EJZD 4HG4K 2RHEA 3OKEA 3L6FB 3T5WA 4BKLB 4YAQA 2Y72A 3HBQA 3NYKA 4WWKB 4UM9A 1T22A 1EEZA 2GIXA 4BCYA 1P9MA 5AW3B 3OKMB 1GSKA 4XCEA 1N68A 3ULSA 4NZJA 3ZTJG 3V0FA 5D1ZD 4OSUL 3BUIA 1ZMYA 4IDJL 4R5VA 2N0KA 5E8OA 3SDAD 4H2AA 3CAFA 5MERB 4OLWH 4H1LG 1T7YA 3VXQA 3MRDB 4HJJL 1G4MA 4KVCL 3PXHA 3TO2B 2C9SA 1BVLB 4NNPH 3B3IA 2OK0L 3RU8H 3DIDA 2ARJA 4KROC