5B1JA

Crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Structure and Function of Copper Nitrite Reductase
doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jA02
3ABLB 1BQ5A 4DP1X 1PAZA 1NICA 5IY5B 3TU6A 1E30A 1E67A 1PZBA 1OE3A 3NJIA 4G71B 1KBVA 2IDSA 4P5SA 3T6VA 4A2DA 4E9TA 3FYEB 3QQXA 3HEIB 4KNTA 3JTBA 4JKNA 1L9SA 2I7SA 1W6WA 1ZV2A 3TBBA 4Q89A 4DP7X 4K9JA 1NIBA 1MZYA 4YSRA 3NJNA 3OM3B 1AZBA 3JT2A 4QLWA 2GSMB 2AZUA 2YXWA 1PLCA 3PPSA 4DP2X 2EINB 4FA7B 4A67A 4CSZA 1CC3A 1URIA 1EZLA 2BZ7A 5AZUA 1GY1A 1OE2A 1UATA 1AZRA 4GP5B 1OV8A 3WG7B 2IH9A 2XUWA 1SDDB 3ZIYA 2IDFA 1JZFA 3CZUB 1X9RA 1OOWA 1SDDA 2WSDA 1NWPA 3WKPA 2WO2B 2B08A 1ILUA 4E9VA 2PPEA 3T71A 1E5YA 2AZAA 2EIJB 2H47C 3ZBMA 5I26A 3TASA 2XWZA 2PP8A 4DP5X 2FT7A 4HIPA 2GI0A 4DP4X 1AS7A 2P80D 1PMYA 1L9OA 3SQRA 3T9WA 1L9QA 3DTUB 3GDCA 1IUZA 3NJMA 1WAEA 3MX0B 1RKRA 5D4HA 4AKOA 3QJTB 3N2JA 4KO9A 1ADWA 3FSAA 2FWLB 1CYXA 2MTAA 4YSTA 3EH3B 1JZEA 4E9QA 2XX1A 4UF7C 3H56A 3EF4A 2UXTA 3FSZA 3NYKA 3FS9A 3WNIA 2OJ1A 4A68A 2YAEA 2BW4A 7PAZA 1AIZA 1GS8A 1AZNA 3T6XA 1A4BA 3NSYA 2JFCA 4G7RB 4KO7A 1PLAA 1WA0X 1OE1A 1FA4A 3NJJA 1ASQA 3OMAB 1PZCA 4KOCA 5EHFA 1NINA 4GYBA 3FYIB 1XB3A 2XU9A 2XV2A 3FU8A 4YVUA 4YSPA 3FQ2A 3RYMA 4A2HA 1V54B 3FSVA 4BWUA 4PAZA 3UGEA 1AS8A 4AX3A 2PPDA 3UACA 1GS7A 4BK5C 1CUOA 4L0PB 1KCWA 1J5DA 1HAUA 5B7MA 2GIMA 1VLXA 2FTAA 4E9YA 2YXVA 1JXFA 4KO5A 6PCYA 1ET5A 3FU7A 4WKXA 2I85A 2YARA 2ZOOA 5PCYA 3FU9A 3FPYA 4X4KA 2OV0A 1BAWA 1M9WA 1PNDA 2IDQA 2VW7A 2A3TA 2HXAA 2HX8A 8PAZA 1KDIA 4DPCX 2IWFA 3AG1B 1ASOA 2XYBA 1TKWA 3GYRA 3DIVA 5F7BA 2QPEB 3ABKB 3L45A 5B1KA 3U25A 3SBPA 2IAAC 4YL4A 1PY0A 4TXVB 2YAHA 4GXFA 1BYOA 1F56A 1AG6A 1PF3A 3IEAA 1MG3C 5D4IA 4F2EA 3QPKA 3NJHA 4JHVA 5I6KA 2DWSA 1SF5A 2J56A 2UX6A 3S3CB 2BP0B 1L9RA 1ID2A 3EH4B 1PZAA 2BP0A 4YVNA 1N68A 2NRDA 3PAUA 1W8EA 2UXVA 2TSAA 2QDWA 4YSQA 3NT0A 3AY2A 1RCYA 4G70B 2PP9A 2Q5BA 1QHQA 1KBWA 6PAZA 4AI7A 1AQ8A 1OCZB 5I5MA 4HZ1A 2YAFA 4PCYA 3ASNB 3X1EA 2GC7C 4DP0X 3NP3A 2DYSB 3V9EA 2PPFA 1ASPA 2LLNA 1M56B 2QPDB 5ANHA 2PCFA 1IC0A 2VM3A 3CVCA 5I6MA 4YSCA 3NSDA 5B1JC 1BXVA 1ZIAA 1NIFA 2UXFA 3HB3B 5I5JA 5TK4A 1BEXA 3AG2B 2VM4A 4G7QB 1N70A 1SHWA 1JZIA 2HRGA 1J9TA 2BZCA 3PCYA 1R1CA 1OCCB 1PLBA 4YSUA 3QJRB 3TBCA 2IDTA 2J57A 1NPJA 2CCWA 1X9UA 5FC9A 1L9PA 2CUAA 1GSKA 3QJSB 3UAEA 1JVLA 1BQRA 1SNRA 1B3IA 1MZZA 4HCGA 4DP8X 2HLEB 1EHKB 2R7EB 1A65A 2DYRB 1A8ZA 2ZWNA 2PP7A 2H3XC 2R7EA 3FQYA 4DP9X 4NERA 2EIMB 2YAOA 2GHZA 1NZRA 2YAQA 3X1FA 2YAMA 3AZUA 3S3DB 3X1BA 5AKRA 3SBQA 1E65A 4F2FA 4NB7A 5I6PA 3T6ZA 1PCSA 2XX0A 5PAZA 2BWIA 4JHUA 4E9WA 3OQRA 2BP8B 1ETJA 3KW7A 5B3SB 1ET8A 1CYWA 3C75A 4A2GA 2FQDA 2HRHA 4NAJA 4YSDA 3EHBB 3CG8A 2XXGA 1HAWA 1E5ZA 1AR1B 3CVBA 4UAHA 3CDZB 3N55A 2RACA 1IBZA 3NP4A 3CDZA 3QJVB 3WNJA 3UADA 2FQFA 1A4AA 2UXGA 1OF0A 2Y1AA 4GY4A 4YSOA 5I6LA 1DZ0A 5D4JA 1GR7A 3BVDB 2FT6A 4MFHA 1NWOA 3H4FA 4QKTA 2I7OA 5I5IA 2XVBA 1WA2X 3S8FB 4DPBX 4CSPA 1NIEA 2YQBA 2IH8A 2BO0A 2VN3A 3G5WA 3CVDA 3OMIB 3S8GB 1TEFA 1AAJA 2VW6A 1NPNA 1IBYA 1YLBB 1A3ZA 2X88A 3PAVA 2MRYA 1NDTA 3X2QB 2P80A 1JVOA 4G72B 1ET7A 3OMNB 2FJSA 1MG2C 1ZIBA 2ZONA 3NJKA 4DP6X 2J5WA 2WO3B 2PLTA 1QNIA 3FPXA 2FQGA 3SBRA 1KDJA 1BXAA 1AANA 2HX9A 4M4RB 2VMJA 3PLYA 1GYCA 1SHXA 1T5KA 3IBOA 2DWTA 3WI9A 3ZDWA 3QJQB 5B1AB 5AFAA 2Q9OA 4E9XA 5I6NA 1ZPUA 2JKWA 3ABMB 2N0MA 3FT0A 4W1TA 2HX7A 1ZDQA 3BQVA 3AG3B 5TK2A 3NJFA 4HALA 1JZJA 1KGYE 1V10A 3ERXA 3D12B 1AZUA 3V9CA 1KV7A 3X1GA 3ASOB 4P5RA 4BWWA 1J9RA 1ILSA 1NTDA 1OCOB 2BWDA 2W88A 4G7SB 3NSCA 4N4YB 2PPCA 3DKHA 1GW0A 1XMEB 2J55A 4DPAX 3PAZA 2W8CA 2GC4C 2JXMA 3T6WA 1MDAA 5B1BB 1GY2A 1M57B 3PXLA 4ZK8A 4W9ZA 2ZXWB 1KCBA 1ZDSA 2IWEA 2VW4A 2QDVA 5B1JA 1J5CA 2YAPA 3IN0A 3H4HA 2OCCB 4KNSA 3AW5A 2CAKA 1L9TA 2AFNA 4A66A 1AZCA 1NIAA 4EF3A 1NIDA 3IE9A 2AVFA 1JXDA 2XV3A 4HHWA 4KOBA 4BWTA 1AOZA 1JZGA 5LDUA 1V55B 1FFTB 2DV6A 1J9QA 1SF3A 2CJ3A 1AS6A 4YSEA 5I6OA 1XB8A 2XV0A 4WTQA 1WS8A 1AACA 3FSWA 4N8UA 9PCYA 2GBAA 5E9NA 1TU2A 4KNUA 1HFUA 2PCYA 4HCFA 2XLLA 2H5UA 1SFHA 1OCRB 4AKQA 1SJMA 3TA4D 4Q8BA 3UABA 2X87A 2HZHA 4YSAA 2CALA 4RH4A 3MBWB 3NSFA 1BQKA 1XB6A 2BP8A 4BXVA 4AZUA 1KYAA 1GS6X 1A4CA 3S3BB 5F7AA 3ZX1A 3NJLA 3NJGA 2FQEA 4BXSV 1QLEB 4HAKA 5I28A 5B7EA 1JZHA 4HCIA 3AG4B 2PPAA 1AG0A 4A2FA 2IWKA 4F7KA 4FAAB 2Y69B 4AKPA 1TEGA 1JERA 2EIKB 3ABGA 4M3HA 3UAAA 1DYZA 4E9RA 5A7EA 2VSMB 1CURA 1WS7A 2AANA 2B3IA 3WKQA 1J9SA 4YSSA 1W6LA 7PCYA 2GB2A 1SFDA 1JXGA 4E9SA 1WA1X 4ENZA 2UX7A 1BXUA 1JOIA 2QT6A 3GXUB 1FWXA 2IDUA 3OD3A 4BDVB 3FU7B 1RZQA 4BDVA 3IN2A 4A2EA 2FT8A 3FQ1A 2CBPA 2XXFA 4GP8B 2E86A 5B7FA 4UANA 1IKOP 2EILB 2TSBA 4KO6A 1PNCA 2BHFA 2DY2A 3EH5B 4GP4B 4HHGA 3QJUB 2BW5A 2VSKB 2FNWA 3X1NA 3WIAA 1BYPA 3KW8A 1RZPA 1I53A
chains in the Genus database with same CATH superfamily
3GB7B 3U2JA 1S3RA 2WBJA 3SCMB 4MMZB 4DO6A 2AHIA 3ZQXA 4PJXE 2OZ4L 3O4LD 4QTHB 5IMKA 2VDKB 4P3DB 4JPWH 2W60A 1YVLA 2OTUB 3UOAB 5DK2A 4R4FL 1MJJB 1A7OL 4KX9A 4P3CL 1J05A 3DNKA 4B96A 4KNTA 4J23A 3N1QC 5D72H 3FTYA 3PRZA 5I1KH 1CGTA 2IH3B 4M48L 3HE7B 3VGAC 1MZYA 1QBAA 4GUPA 4WEBH 2NLJB 1UD4A 3TN0C 2XWDA 3VMNA 1TIUA 3NSXA 4NQTA 3BQUB 1I7ZA 3L95B 4FKKA 1QRND 2F58L 3IFOB 3RWGB 2P46B 2YO3A 1OHQA 4ATWA 4ZD3H 4PY7B 1UATA 1AZRA 2Y1VA 2WWNA 1HL9A 1CVRA 3LHPL 3PNWB 3I6GA 3Q8EA 2WIMA 3QDGB 2A4EA 3I6KA 2WO2B 1A6UH 1JVKA 3MCKA 3LIZL 4PJBE 2B2XL 2E47A 5IHWA 2BSTA 1FNFA 1KB5B 3HHSA 1I1AA 2H9GA 3GSNH 3OJMB 4TOYL 3IS1X 4AQZA 4P46B 3S35L 1KC5H 1ZLVH 4EPSA 2L4OA 2A4CA 2ICWA 2EDJA 3KXFA 5DURB 2JJWA 1UWEL 4QTFA 5D7SL 1A6PA 5DEFA 2V2XA 3U6RB 1ZHNA 4MYPA 1L9OA 1MJUH 2XN9E 4LO9A 5AAWA 2ID5A 1IUZA 3ARVA 4U6VH 4NO0D 5JMOC 4LZKA 2AJ3A 2H1LM 2ICWI 4PVLA 4YHPA 5CF3A 3MRGA 2EXYD 4TQ8A 1UQSB 3P30L 5CZRA 1OW0A 4FEMA 3D0VB 1AQDA 2X10A 2VABA 4MXQD 4QXVA 5IBTL 4GSDH 2BS8A 4XNMA 4OCLC 2EYSB 2UY6B 3ZE2B 1ZVHA 4JM2C 2EECA 2QJDA 4I89A 3UO8B 1RD6A 1HOEA 3KPPA 2XA8L 1CO1A 4FCHA 2XQ0A 1BFVH 1WUNT 3VI3E 2H32B 4JY4A 2XXCB 2ZCKL 1DSFH 2QLYA 5DJCB 1S5HA 3X3FH 4H25B 4MA3B 1W0VA 5MENA 2JQAA 2VR9A 1UENA 2YMXH 1G1OA 1PZCA 1VZGA 3K4ZA 1GH7A 5HD8C 1ZVSB 3L81A 4MCMA 1FBIH 5AYUH 4B7LA 4NQDB 2A1WH 3AB0C 1XSJA 1IGIH 4QOKA 1BZEA 4XXCC 2MOVA 4LVEA 3V4VH 1CUOA 3FB7A 1EEUA 3VGBA 3ARDA 2KUTA 4OUOA 2CRMA 5JXEC 5BOPA 4D7PA 5CCKL 1IC7H 1CIDA 1ECYA 3B5GA 5JR1L 3KGSA 1AKJA 2N7SA 1KCVL 3LXBA 1NFAA 1R3LA 3VFNB 2NCEA 3FU7A 4F2MA 5IW6B 4GRLB 4FNLL 2EYTB 4LEBA 1OL0A 4LQFL 4LCUB 1BVNT 3LNFA 4HIIB 5KSVA 1MHHB 3GMNB 1UTDA 2JKRM 3V6ZA 1SUHA 4HAFA 1SEBB 3JTSB 5GZND 3G08A 5F44A 3ECUA 1A25A 4NEHB 4PJCA 5FGBA 5D96C 5JHMA 3VE0B 4Q9QH 5FX3A 2MQ3A 1KYUA 2O6FA 2ORBL 1D6EA 2VNCA 3WTVA 1DFXA 3O3DB 1QYGL 4FTVE 3L4XA 2D0GA 1BVZA 3L1OH 2ZP0T 4QHKI 4YLBA 1MG3C 1MCWM 3G6AB 2A9DA 4HD5A 2BNRA 3TO4D 5JYMA 2HT3C 3PDOA 3ZKXC 1GJWA 1HCFX 4HZAA 5K9JL 2IQ9L 1TOXA 4L05A 3QBTB 3Q5YA 1MCDA 5JPMB 5BZWA 4X6CA 2XI9A 3EUUA 3GLDA 3TNNB 5AENA 4LESA 3BQUA 4MJHA 4WI3A 4PRBB 5GGUA 2Q5BA 1FFOB 2YN5A 3N85L 2DB8A 1P4BL 1ZXQA 1OCZB 1CI5A 2YAFA 3L4VA 3PNWA 4OF5A 2YPVA 1MSPA 4JBSA 3H85A 4X9FA 3M7OA 4X7SH 4M7LL 4UAOB 4I0PC 4UUJA 1JZ7A 2ZCHH 4JM4L 4ODHL 4LIQL 3OHMB 1DQTA 4NP4L 3KVPA 3NCXA 4HIHB 3FN3A 2BVOB 5D93C 3LQZA 1BBDL 1MFAH 3U6RA 1GC1L 1R9FA 2DBLL 3EO0A 4JFHE 1XDTT 4UV7L 3LHAA 1QSEE 1SQMA 3A24A 3F7QA 4NZ8A 5E4IA 5AAWC 3FCTB 1FDLH 3INUL 1UQSA 1OP5H 4Y5XB 1T5WB 4X6EB 3QJSB 3WJJA 2BSED 5EV7A 5C09D 3ZE1F 3FQWB 2EYSA 4WV1B 1XGUB 3B9AA 3H9SE 5ES4B 2P45B 2P43B 2DYRB 1PL3A 1G9NC 3P73B 5J57B 1MW2A 1CWVA 4HS6A 2EIMB 3NOIA 4TSCL 3L4ZA 2XACC 2J88L 4AY0A 2DLGA 1PCSA 4XVJH 1ZKAA 4KQ4L 4Y7OC 5ANMA 5GJSL 1U8KB 2ED7A 4CAGA 4KJQC 3PWLB 2VXTH 3O6LL 4M6ML 1I8MA 5B4MD 5FA3B 4UQAA 5H94B 3UH8A 4J4PC 3FF7A 1L7IL 1JXJA 5CR1A 2GJ6A 3GSNA 2DQEL 1NGWB 4NAJA 4N3TA 4APXA 1H15A 2GSGB 2R15A 1D5BB 3SDXF 2DLTA 3SDCD 3HZYB 3HUJF 4J3WA 2JV6A 1XSIA 2F0CA 2XXMB 4MBOA 4KI5F 1D9KC 3ARDC 3CXDH 3OKDA 1JPSL 3VVWA 2C3GA 4L3ED 4RQQA 1GJIA 4NN7B 1ZK5A 4LLQB 2ENYA 4HIIA 1NWOA 1K6QH 2IPTL 4RISH 3WYRA 4YHYC 5LGHL 4F8LA 3VD7A 1KIQB 5DTFA 3NIFF 4KVNL 1MCKA 5E94B 1QZNA 3JTSA 5E5MB 5KVFE 1E6OH 2FR4A 3U30C 1FVDA 3H9HA 1NIEA 2DQGH 2WKLA 3OQ3B 2GJPA 4BE6A 3IGAA 3OJ2C 1ES0A 3QORB 3DBXA 3A6BL 5FGBC 2BRQA 5CEYB 5HHMD 4KQ3L 5ADPH 3WY1A 4JZNB 5LDSA 3MBEB 1S8DB 2ESVE 3G6AA 4MMZC 3SCMC 2WGNB 3TT1H 5I2IB 3U4BH 1I8IB 3DX7A 1MIMH 3B4NA 2DS4A 4ONGH 2H2SD 4WUKH 2A5UA 4J3SA 1XGZA 3L54A 4MNHA 1YG9A 2IQAB 4HZLB 3V4VA 4TSBL 2FNBA 3HE7C 5AG8A 1HHJB 4QAMB 2DQTH 1FFOA 3BYTA 3DVIA 4MJ5B 5D7LB 5CU5A 1QUPA 2LFGA 5ECGA 3PWPE 3P3RA 1F6LL 1JUFA 3BQUC 5TPWL 2CE6A 1H3PL 2CR3A 5D5MB 4XO9A 4YE4L 4EN3D 2HLFD 1HEZA 1M1SA 4X6DF 1XZWA 3HFMH 4G6MH 4U1LB 5CHNA 4PJ9A 4QRRB 3NSCA 5BNXD 2EDFA 5LBVA 3WS6A 4OKDA 2W8CA 4DH2A 4AC4A 4JN1L 1GKEA 4I85A 5BQ7A 2VXVL 1GY2A 3P3UA 4ZAKD 1LQSR 1U8MB 2CGYA 35C8H 4P46C 3G9VA 5B1JA 4AH2A 3HLAB 1KJ3H 3BKYH 5A2LH 1CT8B 2RIKA 5BUAA 4OJAA 2J4WL 4U1MA 3EBAA 2XG4A 4XPGH 1XIWD 4JPSA 4RA3A 3NIDE 5K59E 4X6EA 5FWRA 3IJ9A 2SEBA 1ESOA 1DQQB 4MYWB 4FFWD 3KYAA 3R8QA 3TNMB 1YNLL 3WO4B 3CZGA 3QEUA 4AUJA 3GEWB 1RIUL 4JCLA 3U4AA 3RKDC 2FJHA 1NGPH 5B38A 2WLHA 3CV5A 4QRUB 4K23H 4XB3A 5FLUA 1S7XA 4HMDA 1OY3B 1SXNA 3UP6A 5F89A 3EJPA 3O9WB 3SO3B 2I9TB 1INEH 3FQNB 2E6QA 2K70A 3MOBL 1DBJH 4MDIA 5BO1L 5GS1A 3OBAA 1QR4A 4IIQB 2XN9D 3A5VA 4M6OL 1U8KA 2E7HA 2WUBH 4XNQA 3PWLA 3PXHA 3OKKA 2DJUA 4GKOA 4U1KB 1NC4A 2QVKA 1O5DT 1A4CA 2BMKB 4YHML 3ZX1A 1LL1A 3CDGA 2ATPA 4NUGL 4PTTB 3M1BA 1OAJA 4ADJA 3SPVB 3QUZD 4HCIA 2IALA 4PJHE 3O2WL 3WJMA 1X5LA 2TRHA 2GSGA 1D5BA 5SV3A 2EDEA 5KVEE 1BCIA 1PU0A 2HYMA 3ABGA 3GI9H 3VAEA 4MCNA 1HWHB 1OK8A 5E6ID 4Z77A 4HIJB 5HI4C 6FABH 1RJCA 1F1GA 3GBMH 3RFZB 1I85A 3CK0L 1XF5A 3P2BA 5E08H 3RLSA 3FFOA 1T03H 5I1LA 3C8DA 2QPFA 3LS5H 4JPIA 4P99A 3VRIA 2W0FB 2KYIA 4GRLC 4E41A 1T1ZA 3NFNB 5TDNB 2MNJB 1ML0A 3MVSA 1SVZA 4V1DD 4PYGA 5HY9A 2AK1L 3HPJB 3VM5A 1PKQB 2EDDA 1EFXD 4UT9H 5F9OH 3KPOA 2XXFA 1HJBC 5JTWA 1E90A 4Q97A 1NOAA 2WAQA 1OD9A 4LDCA 3D4GA 4F5CA 1BD2E 4DESA 3OKNB 4IHBA 3ZTNH 1F4HA 3BEWB 2OXGB 3VFUB 2XCMC 1HC1A 1KXQE 1PNCA 1TENA 3EH5B 3PIQA 3UTTE 4AXWA 5I71B 1ZPLA 3HPLA 4WW2F 3ESOA 1GIGL 2VSKB 3RVWD 1XV8A 3J8F7 1S8DA 3GS4A 4JEGB 3FQYA 3ZUNC 5IREA 1E5CA 4UDUB 1NICA 5G4NA 4U0RB 5LHDA 5TF1H 5K39B 4QAWA 3QUKA 4LMQE 1OE3A 1LK2B 4JRFA 2K3HA 4UQ9A 3LNIA 2D7NA 2IQAA 3MA9L 1PEZA 4HZLA 1P5VB 3GO1H 3GHEH 1B4JL 4J3VA 5JPMC 4POZD 4FQ2H 4GLRI 4ZMVA 3FAWA 3UYRH 3ULAB 4GEJA 5D5MA 1OTSC 1E9QB 1NLDH 3L7EB 2J20A 3N42F 1XH1A 5DJYB 5EO9B 3MO1B 3X12A 4ETQB 4U1LA 1Q1JL 2DDQH 3KPNB 3LNHA 1GW6A 4OZFH 3IXAA 1A14L 3FB8B 1T1WB 4RGOL 4UAOC 2BWQA 5D7IA 5AKSA 3KLDA 4NKOB 1Q9KA 3NMEA 3BRFA 4M5YL 3N1GC 3TX4A 3PREA 1QZ1A 1YY9D 4XCYB 4KKLD 4ETYA 3WTWA 1IFHL 3RUGF 2Z8VC 2E9JA 1E5YA 4IQHA 2D3NA 4IYKA 5E2UH 4XI5D 2WVSA 4TSAH 1SY6H 3O6FA 4BH8B 2HPOA 2K1MA 1HQRA 2JH2A 3ZXAC 4XBPB 4E0RA 5FM8A 1SEQH 2AABH 1ACYH 1DQQA 2YK1L 1ZHBA 3HC3L 4XGZA 5AW3B 5DFWH 3DYPA 1K4CA 4TQIA 1MFCH 4Y5XC 1RKRA 2XSKA 3PHAA 4XB7A 3SDAB 2WLLA 2XC8A 2CG9X 1P1VA 4O51A 4WV1C 1Z2KA 3FOMA 3O9WA 2JI2A 2K7PA 4RSYA 5I82A 3T3PB 3W57A 3TEZA 2GBUA 3VD9A 1EHLH 4XVUC 4PJFB 5L88L 4RNRB 4G8FB 3LEYL 4IIQA 3RL2A 1MCHA 1VERA 4E5XG 4R7VA 2WINB 3MUGB 4M9OA 1DJYA 3SJVB 3RVXD 4QRRE 4B0MM 2VDMH 4MLIA 1X5XA 4FJ6A 3MJ8A 1A4BA 1X7QA 4NNPH 4AW4A 2Q76A 2X6UA 2BMKA 1UXLA 5C08A 3QQ3B 3QUMH 2D4DA 5T1MA 3CZFB 4NM4L 4NQUA 2CKBH 1UB6B 4Q56A 4QRFA 4UMSA 1TQVA 5FLVA 3Q48A 4FNRA 4HC1L 2WXNA 4XPFH 3UCQA 3FQRB 3H9SD 2ENPA 3LMJH 2Y6SC 1S7SA 2AJUL 2F54A 1QWUA 3VFOB 3JYBA 3QWQB 3KPTA 1Q0XL 3BZFA 4KC3B 3EBGA 2PPDA 1BFSA 3EDFA 4BK5C 3RFZA 2ZUQB 4TTGA 1UYWH 4YXKH 5B7MA 1CLYH 4C47A 4MJIA 4UOJA 3ZO0A 3MUY1 4UIKH 4Y4HD 4KK6C 1II4E 4X4ZA 8FABA 1HL4A 3OMZA 4JPWL 5TDNA 4NN7C 4QXTA 2ZJSH 3GSOA 5AUMB 2OMZB 3HPJA 3J27A 3BOVA 1B88A 3LKSA 4MD4B 5I1KL 3U0TB 4FRWA 2HX8A 3BEWA 3F7VB 3SYOA 3VFUA 4WEBL 4F7PB 1WAAF 4FFVD 3RE0A 4KRLB 2ZQKA 4WK0B 5FUCC 3QORC 3EFFB 3DIVA 3O2VL 1EIBA 1NUFA 1K3ZA 4UDUA 4ZD3L 4AVJA 1XAKA 4HDIA 1DCEA 1BIHA 3MBEC 1PY0A 3H53A 3P4OB 4NQSB 4NRZB 5CJQH 1J11A 5K39A 1QO3B 5L6YL 1MAMH 1KBBA 1PF3A 4JO4L 1NC2D 4YBHA 4G8IA 1QFUH 1A6UL 3ZIMA 4JUTA 4Q2ZB 5T1JA 3FO9A 3R4DA 3L4WA 1XMWA 1AXSA 3IGUA 1YECH 3ZYJA 1G7JB 1ID2A 3AS3A 4Y9CA 5T3XH 1KC5L 1V05A 3H7BB 5GISH 1W8EA 4AUUA 4NHUA 4PY8J 4RMSA 2OM5A 2LVCA 2OJZH 4CC4C 5DJYA 1MJUL 1TVBB 1WE5A 3AY2A 3MO1A 4H8HA 3ZDZB 1K8IB 4U6VL 4ETQA 2ESVD 3IT8D 4HK0B 2O30A 4ZSOA 4PCYA 4NKOA 5JUEL 5CEZH 5JDJA 1Y18B 3ASNB 4L4TD 4AUYA 5C0AE 2G2NA 2EO1A 3GBNL 4H0GA 4Z7VE 3L3KB 4Z7WF 1E3ZA 4QRBA 1MXDA 2EQDA 3H42H 5J7CC 1ZXKA 2AV7B 2HCZX 3MLPA 3R18A 4N0RA 1INQB 3HG4A 3L3GA 3QZNA 3NSDA 4YSCA 5G5DB 1JYNA 1E6JH 2ITCB 4A39A 3S4SG 1MXGA 1DSFL 3KPSA 2NY4D 4HFUL 3X3FL 1JZIA 1D2OA 1IC4H 4KI1A 4CVXA 3WE1A 2ZKYA 3PCYA 3QZWG 4XMKH 2YMXL 1XGRB 4NKIL 4K94H 3FHEA 2BSSA 4JUSA 3S8WA 1L9NA 2B39A 2IBGA 3HKFA 3WO4C 2RB8A 4A1RA 5AYUL 3KYMA 1L9PA 2A1WL 1E50A 2F18A 1IGIL 3JWDH 4NQXB 3HAEH 2VRKA 1IGTB 1EEYB 1XL6A 4XP1L 1VENA 2O5ZH 2VR6A 3NQKA 4Q6IB 3V4PH 1JWSB 5KG9B 5CJXA 3O9WC 2ZWZA 4OIBA 3SO3C 5HJBA 2ZWNA 5FHAL 4ALAH 2XG5B 1IC7L 3VXMB 1CG9B 3HA0A 4IIQC 4OLVH 2GHZA 4HWZA 3UROR 3QQ3A 4OZFA 1NCDH 2X28A 4ABWA 3BGFB 4PHXA 4F2FA 3HS0A 1IAOB 3W2DH 2MCPL 1M9SA 5FW8A 5ABAA 4Z7OB 1A3QA 5EWIL 3O0RH 1JXKA 4YHIA 4ZZFA 3B3BA 3OQRA 2VDLB 3WEXA 3D52A 4R90H 4HUVA 1CLVA 2CO7A 1RUPH 4WLCA 4PGEA 2KI6A 1CYWA 4S1DC 2YEQA 4PR5B 1SY6A 5E56A 4Q9QL 4B3VA 3ECQA 1WBZA 1I9IL 5KSBE 1EO5A 4Y4KB 1A6AA 1LYQA 3GMMA 3T8MA 3SEPA 4FHKA 4TQHA 2PWFA 4BM7A 3RFZC 4I3SH 2DTSA 1A7BA 3L1OL 4Z3TA 1BAFH 3VU2A 1WWCA 1HSBB 5AUMA 4W9JC 5BW7A 4I1NB 1IM9B 4JPKH 4UZSA 1URLA 1YDPA 3U0TA 4Y19B 3E80A 2JE8A 4ODSL 4C83A 3P40A 3UBGA 3SKJH 4CC0A 3F7VA 3HAEB 2I60H 4YDJB 2EH8H 2BVTA 4HH8A 1DVZA 1NFDA 1MHCA 1HINL 3MV9B 2PO6D 2I07B 3KNBB 3QNZB 5EZPA 5I71C 3IJHA 1E43A 3QZLA 1YLBB 2F7QA 1A3ZA 1EDYA 3ULVH 4NQSA 4KVPA 1IU1A 3TIEB 5DK0A 1NDGB 2FJSA 3QUMA 4FJZA 2L7UA 2CKBA 5CM1A 4FQPA 4U0RC 3QZMA 1ETB1 2P8PA 1TVDA 5MERB 1KWKA 1CL7L 4M8QB 4WWKD 1IKFH 5AW2B 3CFDB 5J6HB 2V5SA 2ZX5A 2PETA 1GPOH 4IRSA 4MS6A 4KU1A 5AVZB 3TVMD 4PREB 1BD2D 1IGYB 1THAA 2YFOA 3HFFA 2OYMA 4EKJA 5KSAA 2O5NA 3FUHA 3LAFA 4TVPE 5G2NA 4AGMA 1I8AA 5HYJD 4DERA 1TMCB 1T5XA 3ZDXE 1K8IA 3MJ9H 3ML9A 4U1JA 4U6YB 3ZSSA 5IHLB 4U6TA 4P07A 2HX7A 2VTFA 9CGTA 3WU1A 4YBLB 2EXWD 1KGYE 3Q6GH 3ERXA 3SKOA 2WXOA 1JGLL 5FA4B 3MRHA 4AQOA 4Z7QE 3VYPA 4Z7NF 2P5WB 4LCWB 4R4NC 5CR8A 2NR6D 3AS2A 4ZOCA 1TQCB 1HILB 1INQA 5AW7B 3MRMB 4GRWF 2ITCA 2JXMA 4MA8H 4KXAA 5KYXA 3SY6A 4PWIA 3OTTA 3PXLA 3GJFB 4BQ9A 5ICYA 4QHPA 3HI5H 3TBVB 1IAIH 4JO3H 4HJJH 5BO0D 2NX5E 5IW3A 1FP5A 4XVJL 3TZVD 2E8ZA 1AHWB 2VXTL 4CGUB 1NIAA 3IWVA 2B0SH 2AVFA 3JVGA 4HPYH 3WFDL 5BOZG 4PPTA 5BRZD 3SDAC 1LO3H 1E2WA 1JYXA 1MELA 1EEYA 4X80H 1AS6A 1JWSA 1KTKE 4NRXA 3R8BB 3B2XA 1JK8B 3DRTA 3MLYH 1UUSA 2FO4A 1R5IB 4PGCB 2NY1D 3B1UA 2XG5A 1TSRA 3VXMA 4ZNEA 4JFXA 5KAQF 3EOBB 2KZBA 3VH8B 1TU2A 3LXAA 4WO4D 3GXNA 4Y1AD 1D6VH 3CHRA 4DKFL 3CXDL 4MSWB 4OD2B 3SBWA 4HCFA 2IADA 4X4MA 3FKUS 3V9FA 2DEXX 3CUPA 5HYQB 4RMQA 1F4XH 4RISL 1K6QL 2EDHA 3CC1A 1MRDH 3IGFA 4L8DB 3MBWB 3NSFA 3TV8A 1U91B 1BQKA 2J8OA 4XPHH 4NPKA 4AVHA 3X17A 3PG2A 4NQEE 3MV7E 4QNPE 4UDTB 1WC7B 3ARBB 1E6OL 4J3XA 1IKNC 1X6NA 3BLPX 2DQGL 3AFLA 4PR5A 4X5WB 1CFQB 1EEZB 1GRWA 4L5FH 3DUSA 4TRPH 4PJ7E 2F15A 2G9HB 4Y4KA 4OV5B 4GO8A 3BE1H 3UAAA 1DYZA 2ZUQC 3SQBB 4DUVA 5ADPL 4JFYB 2Q0ZX 2G2RA 3WKQA 4MLSA 2OTWA 3BWUF 1VGKB 4IJ3B 3JWNH 1RK1A 5JO5B 3SKMB 3U4BL 1J88A 5I5RA 5IROD 5EU6A 1CPUA 1SN0A 1JZ4A 3TXAA 1MIML 1AGDB 4O5LH 4ONGL 3SPIA 3G6JE 4WUKL 1BXUA 3CAFA 4HH9B 3HI6H 4Y5VB 5L2JB 2W92A 4NM8H 5I1JH 2NY3B 3HAEA 5BS0E 2P5PA 3RURA 3V4PA 1RZQA 4YFLI 3UPRB 3LRGA 4PJDB 3TV3H 2AK4E 3RNKA 4X5QA 1NPUA 1WEJL 1UJ3B 2AQPA 3BVVA 1OZUA 2CZNA 2H8PB 5KJ7E 2BW5A 4RFOH 3EXLA 1AJ7L 3M88A 3PF2A 3V0WH 3EH1A 4FYSA 3THMH 4XMPH 4G6ML 4NI3A 1COBA 1U4FA 2LV4A 5F7DA 4M8QA 4NZTH 4YC2B 1UM4H 4TNGA 5J6HA 1TQWA 2IPKA 3WFCH 4NJAH 4OR1A 4C56A 2PR4L 1DBKL 3QXDA 4LLDA 1QPKA 4RAUA 1IGYA 4UV4H 3OZ9H 3P4NB 3O6MH 4HWNA 5DZJA 3AGWA 4HLJA 3MR9A 1KJ3L 2EIEA 3BKYL 4OFVA 4ZXBB 4PIBA 3DX4A 3LKRA 4Q89A 4DZBB 4JFPB 4MDJB 3QXAA 5GS0D 3QJFB 5SWZD 4JLRA 4N0FB 3ZT5A 3PAYA 4PMFA 3JT2A 5DO8A 4HHAB 2EDXA 4HLZH 4F9LA 3H0TB 1IEAB 3IJYB 4HKXA 1KCRH 1RSFA 1QAWA 1OE2A 4BSWA 4K23L 1HEJC 1UXWB 4L1BA 1HILA 1YJDL 4JFDE 2XQYK 2FYVA 2WSDA 2G4GA 1TTBA 1INEL 2R83A 1OAKH 1DBJL 3K3QA 5ESAA 1S6NA 1IM3A 3VWKB 1FZOB 4L9LB 1WH0A 3CX2A 3TASA 4J3OD 4XO5A 2WUBL 1AHWA 3KWXA 4HKJB 5C2UB 2HFEA 1E7UA 2AGJH 4HIPA 3ETSA 3L17A 3L1FA 1UM6L 2WP3O 3RB7A 2E7CA 1CICB 2QTVA 5J12B 4LF3B 1R5IA 3N2JA 4IKLA 4PGCA 1ADWA 4L1DA 5EO1B 3B7UX 4XNUL 4YIQA 5CZVH 3PDGA 3MJ9A 6FABL 1BXXA 3GBML 2C3WA 3ZTJH 5E08L 1A2YA 4KMLB 1EA9C 5ICZA 3WNIA 2XWTA 4OSUL 2Z34A 2P5WE 1FFPB 2FJUB 3LS5L 3RL1B 5D8JH 4CILA 4L8DA 3BGFC 2WM0A 4QYOB 1FCCA 1WPCA 2H3KA 3WUZA 4FI7A 4JJ5B 4UT9L 5L2KA 4F7CB 2QMKA 4KOCA 1EEZA 1H6FA 3APNA 1MFEL 4AYDC 3WNOA 4PRDB 3ZTNL 2EIZA 3OAYK 3ARFB 2WXIA 4PJ5B 1ORQB 4ILDA 2CK0L 2P26A 5LO7A 4Y4KC 3MQIA 1EJOH 1J5DA 4MAYB 1TCRA 1IAII 4XC1H 4Y5VA 2ZOLB 3V95A 4P2OB 2FO8A 3FQTB 4ZTEA 2X4SB 3GO1L 3UPRA 2CMRH 2PXYB 4YHKH 1E4XI 3KLKA 2BOBB 3GHEL 4NQVA 2OV0A 4PJDA 4QRAA 2K6WA 2QADB 1M9WA 3W81A 1FAIH 3W0WE 5C7ZA 2IVFC 3UYRL 3AITA 1CS6A 3FN9A 5EOQL 1ASOA 2DJMA 1NLDL 2H8PA 1QI3A 2H6OA 5EBWB 2X38A 2VL4A 4LHUB 3DXAA 4XRCA 2NXZD 2D03H 3N0AA 1NUDA 4N8VG 4F8NA 1HHHB 3Q6FB 4F7TB 4YL4A 3NIGE 2A9NL 4Z7AA 1T3FA 2JKIS 4GXFA 4TNFA 3EUDA 3GXDA 3W5NA 2JCCE 1HCVA 3IDGB 1RJYB 1TFHA 1UJTA 2J56A 2Z9TA 1F41A 4M6NL 5E2UL 1DQJA 4L0ZA 5E99H 3O0LA 4TSAL 1SY6L 3CSYA 1F0LA 4Y9FA 2HVJB 3QJFA 4N0FA 3RWDB 3UTZB 4OUUA 3OB0K 5L4MA 2TSAA 2FDBP 1LP9B 1SEQL 1WFOA 2AABL 4HHAA 1ACYL 4LIQE 4YBLC 3H0TA 1IEAA 4JK0D 1P4IL 4G9DA 4LRIC 1TVHB 2KHAA 5ACZA 2YMOA 1X5GA 1UXWA 2X4QA 2JLLA 4JFEB 4XODA 2PTTA 1NBZB 4ODWB 3OPZH 1H3TA 1QFPA 1TQCC 2Z92B 5AALA 3FFCD 2X2UA 3VXRB 5C86A 1JN6A 3WL9B 2HVBA 4MBRA 1FZOA 3QIWB 4L9LA 1UA6L 2K9FB 4NS0A 3AXIA 1BZ9B 3X11B 3IGKA 3F04A 3ZKND 3HB3B 2VDML 3BMVA 5IMOB 2CM6A 3ARZA 3ZVVA 4OM1H 2XTSA 4NNPL 4Q58C 5B39B 3ULVC 2B15A 1SHWA 1RUKH 2R9HD 5GGTH 1AHWC 1R1CA 3T2OA 2XVKA 2CKBL 1H5BB 1KJVB 3WIHH 2ZCZA 3QG6B 4XPFL 3II3A 1TETL 2ZOWA 3LMJL 5DQDH 5FC9A 5B21A 3X13A 1L7TH 2WWMD 4U3SA 2OR9H 2IDCA 3E1F1 3O3AA 5HI5D 3VRJB 1G9ML 2RMNA 4HKBA 2W0LA 1KIRA 5DS8A 5GGRY 5E24E 4YXKL 4DKTA 2CD0A 2ETWA 2NX5D 1CLYL 3QQ9D 4XAWH 2DAVA 5D2LF 2F53A 4GW1A 2P8MB 5AEAA 2ZJSL 3QZBA 4PJEE 1SOKA 3AZUA 5EF3A 4MCYA 5DMGD 2YA2A 3BZDA 4KK5D 3EXJA 1LDSA 4JJ5A 1QBLH 3TLRA 1M7IB 4OF6A 1H3WM 2ZX8A 1TTCA 3ARBC 2BP8B 2NTFB 4R4BA 1M1XA 3TA3D 3ARFA 4U49A 3QB7C 5A2AA 1ORQA 5AW1B 1QTPA 4CMMB 3WMSA 3CN1A 5C0RH 2R0WL 2DM3A 3VACA 4G9FB 3FULA 2XXGA 4LGRB 3WIFA 5FPIA 1HI6B 5IJDC 3OHXB 4MAYA 4WW1B 4IJ3C 5DUBB 3D69B 3BP6B 3C6LB 3KLHC 3QJVB 2O93L 1JGDA 3FQTA 4APQB 3U0WH 5I1EH 2X4SA 4HYTB 1CTNA 4QYAA 4KUCD 4NQED 4Y5VC 3WJLA 4EIZC 5AD0B 3RX5A 1BVKB 2NY3C 3SDXA 1RVFH 1YECL 2XIIA 5GGSB 5T3XL 1NCAL 2VL5B 3VFPB 3VG9B 5GISL 2ITFA 1BIIB 4KY1H 4XR8C 5I5IA 4XNDA 4KX7A 4AEIL 5EBWA 1AE6H 1A7RH 3B2MA 2FJFB 3CHPA 1UJ3C 4LDLB 4LHUA 2VMDA 1I8LA 4OZGA 4P2AA 4HS8L 3B43A 3HC2A 2UV3A 1HDMB 4J27A 4N26A 3Q6FA 3LV3A 4PGBB 5IK3B 1QFWH 1FVCB 1ZT4B 4MQ7B 2N3JA 4PJGE 3TFBA 3KPLB 4YC2C 5CD3A 1QNIA 3LRMA 2N7BA 5FYKU 3ALXA 5BS0D 4K2UL 3VWJD 3CDYA 3H42L 2YA0A 1WHOA 4FULA 1JNLH 4RFNB 1MHPH 4HUXB 1AANA 1JGEA 2Q7NA 3DPBB 2ZXGA 5EOCH 4CMHB 1E6JL 1GGBL 1U8QA 5DRZB 4MD5A 3WNKA 2HVJA 1RUAH 1GA2A 3RWDA 4ZXBC 4OCRH 4E9XA 3LB6C 5LDUA 1IC4L 1A6WH 4WGVB 2AMUA 2O6EA 5C07E 3RJOA 3O41A 1RURL 1CDHA 1ZDQA 4K94L 4JB9H 3F6IA 3P4LA 4JKPH 4JFEA 4ZMYA 2DQCL 3WUWB 3ASOB 2AV1A 3SGJC 3JWDL 1E8WA 4JX0A 2CDEB 4P4KB 3V4PL 3DKHA 4Y2LA 2CGRH 3QIWA 2BIQA 3FRPG 4Q6YA 5DUMH 3QNXB 1XGQA 3P77A 3T2NL 1MDAA 4X6DA 4YDVA 4L9LC 4QKXB 3FH7A 4OLVL 5FYLH 4ZS6C 5B39A 4FDWA 2IH1A 4WNJA 1R47A 1M7DA 2V6HA 2WANA 2XDHA 3WMQA 5ILTH 3W2DL 3V5DA 3IAPA 4BZ1H 5LJYH 3TOPA 4GO6B 3QG6A 3MXVH 2LGNA 5KYWB 3N91A 1CICC 2AEQH 2XV3A 4FS0A 4JFDD 4BWTA 2BVUA 4HXAL 5FHBH 4F8PA 5J12C 4MX7B 2RALA 2CJ3A 3NTCL 1UOVA 2X9YA 1A47A 1O6SA 2BCKB 1NM4A 2VO5A 2AXWA 4UIMB 2W9DH 3ARWA 1T0MA 4WSKA 5IEHB 4ODXB 4I77H 2BIMA 2P8MA 4MWFA 2OULB 1VGEL 3HG2A 3L3HA 1G4MA 4F33B 3I3BA 4WO0A 5C0BB 1SJMA 2OS7A 1E42A 2OPCA 3SE8L 3QVAA 4JPKL 5BVJB 4YSAA 5HHXH 3SKJL 2C34A 1FV1A 4AYBA 2BP8A 2NTFA 3VXOB 5DJ8B 5AW9B 1F11B 2I60L 4HUUB 2EH8L 5C0DB 1J8RA 2XKSA 4PLJD 4X0KA 5HGDA 5I8OL 2R2EB 5AVWB 4WUUB 5JW4N 3ARFC 4GG6E 3AMLA 4G9FA 5GRVK 4FAAB 1CLOH 1HI6A 3MRCB 3OHXA 2VKXA 2XTJE 3OKLA 1KCSH 3G5ZB 5GGTA 3V0AC 3GMPA 2E7DA 1X7SA 3BP6A 1MFNA 3RGVD 1BBJB 4OZ4B 1J87A 4APQA 4MAYC 3WIHA 3UJIH 1HKFA 2GB2A 1WCQA 2O26U 2QHRH 3L2LA 1M2VB 3EIFA 3W9EB 4L3CA 3HMXL 1IKFL 3CBKB 4P2OC 1MW1A 1RIVH 1GPOL 2EEDA 2IDUA 2PXYC 3L3JB 2ZAHA 1XSKA 5JORB 5IFJB 3QPXL 2QADC 4PRHB 5DFVC 4OGZA 3OAUL 2KMWA 4EXPX 2FJFA 4U3XA 2I27N 1JSYA 2RBLA 2X1OA 4RX4D 1KTCA 3QUYD 5D7KE 2YRLA 4PTUA 4H40A 1C5BL 5DZ9A 5EIVA 2LQRA 3V4LA 4GEIA 2M1KA 1FG9C 3Q6GL 5IK3A 1DJSA 1U21A 4HHGA 2LU5A 1FNAA 4CSTA 3PQYA 5ESVA 2J8UB 1WG3A 3MCLH 4QOKE 1BJ1J 3BWAB 1NUGA 3Q8AA 4XPBH 4KZEH 1I53A 2JK5B 4WWID 1ZS2A 4P57A 4HIXH 2R0LH 4BIKA 4LP8A 5CUSL 4JR9H 4POYA 1ACXA 1TPXB 1NGXA 2EVFA 4WW2A 3W0WD 4P5TD 1EO8L 4MA8L 1PIGA 7FABH 1MCBA 3PHOB 1JNHA 4A2DA 4GKSB 2HUEA 2VLRB 3HI5L 4JO3L 3N1PC 4HJJL 1Q94A 3BAIA 2EDRA 3FUEA 4FMKA 4DP7X 2OTPA 4HK3N 1SRDA 2VJ0A 5AB1A 4ZFFB 1OTTC 1A6VH 3WEBA 4H5SA 1OGAA 4HPYL 4F8OA 4QLWA 5FW6A 5ALBH 1NAMH 1NAKH 1PLCA 2YXWA 4J3UA 1LO3L 4R97B 4DTGL 4PJCE 4AL8C 2CDEA 4UU9B 2Y24A 1UFGA 3MHZA 3MLYL 4HKZB 1C08B 2JB5H 4RVBA 1PBYA 1BZ8A 5CNHA 1NWPA 2YRPA 3BH4A 3FTVA 4GQPH 3RFRA 3QIWC 4R0LB 4OFQA 4E9VA 3BIKA 4FLHA 2BNRE 3HB3C 1W8OA 5I26A 4FA6A 5BRPA 5IF0B 3OWEA 3OC8A 5I19H 3ARQA 3IDJA 3DIFA 3QWOB 4PW3A 3L4TA 3LNDA 2H1PL 1MRDL 1V7NH 4JRWA 1S2EA 5BUPA 4DP5X 4XPHL 3RUGA 3MC0A 4PIRF 1H5BC 4WJ5B 3SZKC 1C12B 1PMYA 3BT0A 2MPAH 1XVSA 3S9DB 4MX7A 2VZ1A 1QFWI 4P2QA 4JZJB 2HKFL 1T04B 2G0LA 4L5FL 3UDWA 4TRPL 1OSEA 5EC2B 2BCKA 1EVUA 5HPMB 2OMWA 2VJ8A 3SPGA 4UIMA 3T8VA 3BE1L 4ODXA 4D3CH 4EI5A 1JWMB 4GW4A 4RGNE 2MTAA 3L5IA 5A1AA 3ETBJ 3S2CA 3BUYB 1P7QB 4UF7C 4F33A 5C0BA 1CE6A 1OM3L 1T22B 2OJ1A 4O5LL 3DYMA 2X4RB 3TN0D 1A7QL 4AE0A 1GS8A 3V0VB 3HI6L 2MIZA 1U2CA 3IE4A 1IB5A 2VDPH 2EH7L 4HJ1A 4NM8L 4F1ZA 3ISRA 2FGWL 4G7RB 4OQTL 5I1JL 4L8CB 1LTXA 2JSFA 2KDGA 3MNWB 5C0DA 2ZUXA 1CK0H 3EOTH 4LVHB 4PB0H 4AW7A 1EFQA 1YAZA 1VEMA 5HHVH 3FYIB 4MMYA 5D71L 1EBAA 2XV2A 5EU7C 3MRCA 4MJJA 5ADOL 2UY7B 2BS9A 3UXFA 2DEWX 2DQIL 1FRGH 2A4ZA 3C5ZB 5LCVL 4AQ1B 4BWUA 2Q3AA 3EJTA 4JHWL 3JUYA 4R8WL 1DVFB 2OMUB 3OHXC 4XMPL 4W4NA 4ZPVA 3THML 3IDUA 4BZ1A 3LPPA 2VUOA 4NZTL 3W9EA 5L0QB 3C6LC 1UM4L 4QXGH 5DYOA 4RMVA 4APQC 1D3CA 1JWUB 3CSGA 4MA1B 4NJAL 3WFCL 3ULUC 3MJGX 3JV6A 4I5BB 3TBSA 4UV4L 6PCYA 3OZ9L 5IT2H 3BZ5A 3UEZA 3A0OA 3O6ML 2NY0D 5D6CA 1J0IA 5FKAA 1JHKH 1REIA 4IHOB 4U6XB 2RGSA 4WFGE 4X7CC 5FYKD 1QEXA 5ANME 3VG9C 4ANVA 2VXQL 4OFDA 4UM9B 3O6KH 2ZT9C 2AQSA 4E9LA 5KYYB 5EUOB 3T09A 2J8UA 2G5RA 1W72H 3QZPA 2GJ6E 3MGTA 3UBHA 1IMHC 2PTVA 5F9WB 5B1KA 3GJEA 2YEZB 4S1RH 2EO9A 3K46A 3MYJB 1WAAA 1RAMA 4JCMA 1N2RB 4GRWH 4ELMF 2ZNXA 4RFNC 4YNYA 1F6AA 1CMOA 3PHOA 4A6YL 1OAKL 2NY5C 5LGYA 2IOIA 4IU2A 5TFSL 1N8ZB 2VLRA 4O2EB 2G2PA 5HD8D 4CMHC 2C3VB 4O2FA 5G55A 1KULA 4QHMB 4DN4H 2XT1B 1HH9A 3D1MC 1NDMB 4LSUH 4A7TA 1A3RL 2BP0A 1F18A 3PAUA 3AT0A 4Z3GA 5AYTA 1YN6B 1ACCA 2Q1EA 5SWSB 2PYEB 3CJJA 2ZE0A 1W15A 3NT0A 1DQVA 4ORGA 5IV2B 4DEUA 1KBWA 2EVGA 6PAZA 4HA1A 1D5MA 4UU9A 3RJQB 3SPJA 1AQ8A 3FU5A 2BK8A 3LKQB 4N87A 4FQLL 3O8XD 3ATDA 3KWTA 1A9EB 4PJIB 2GQHA 4P4KC 5CZVL 4NCDA 3UPCA 3X1EA 4M5TA 2DYSB 3B6SB 4LHJB 2GSIA 3CFCH 3DWTA 3INOA 1TJGH 4X42A 4S0SD 5I6MA 2EE3A 5I17A 3BD4A 5D8JL 1AQMA 5EUKA 3CZLA 3G5XA 4Z7WA 4KTYA 3RWIA 3GMLB 3VCLA 4Y9BA 1GOFA 1CR9L 1OCCB 1CGXA 1G94A 4EIGB 3QWNA 3I9IA 3TBCA 4CBZA 3WY2A 2A9MH 4JRXD 4H1LH 1AO7A 2WBJD 2YN3A 4OTXL 4YHNB 3UAJA 5A2IH 4XOAA 5DK3A 1DQIA 1X5KA 1BM7A 2LLLA 5EN3A 4QO1B 2HT3D 4BSVA 4U05A 1JI1A 4KPHL 1U2HA 2V0AA 3IFNL 1EJOL 1YEHH 1DQKA 3P1VA 1DANT 2K4WA 2GPZA 2AQ3A 3OSVA 4FQHA 1CGYA 4XC1L 5DR5L 1NAMA 1PPIA 4X8JA 3ARPA 1I1CA 1HHGB 4EVNB 2P24B 3X1FA 3BP5B 3J2PA 4DUXA 4BEIA 2NZ1A 2WBKA 5JHDD 1GTFA 2CMRL 1T4KA 2QSCH 3V0HA 1EHAA 3DA0A 1S9WB 2FEDC 1FAIL 3OB0H 5EU5B 5LGJA 2NW2B 1HOCB 5EEWA 3T0WA 4A2MA 1AP2A 4ERSL 3S3JA 4FYQA 3NZHH 2P48B 1ICTA 1NOFA 1ZLSH 1KTDB 3DC0A 4JG0H 3DHMA 1KFAH 1ZA6B 2D03L 2F5BH 4KDTC 3QAQA 4PUBH 2B4CH 4NXSA 1IX2A 3HVNA 1I1AD 4KJWC 3RY4A 4K7PH 5T1DL 3MUHL 2VDOL 4YEEA 1D7CA 4EOWH 1KEML 3UZQB 5LXVA 2FQFA 4WU7A 4XPAH 3KXFD 4YDKH 5F1NB 1BMZA 4X5XB 4AEFA 5HJDA 1IIIA 3KPRA 3MRJB 2VISB 5E99L 1KXTB 3DO4A 2QKSA 4D0BA 3MUUA 2PWDA 4QGTA 3ZE0B 1MLBB 2YOAA 3A6OA 3EYQC 1YUHB 1HXYA 2A38A 4LXFA 5LWYH 2X53A 1EMTH 2BJMH 1JZ6A 1O6TA 4HXBH 2YQBA 3WN5A 1G9EA 3OMIB 1BSIA 1NMAH 2D31B 2MPVA 2P80A 1N2RA 5B8CA 3CFNA 3OPZL 3O3EB 1FL3B 2ITDB 3BHBA 3CPUA 1M53A 4J2XA 1TPXC 1FFRA 1N8ZA 3D09A 3DX9A 3LRKA 4KJQD 1IRAY 1TJIH 2C3VA 4MKTA 3VTAA 5L8LB 1BVNP 4ZW3A 5MEND 1NDMA 2M83A 2VMJA 5D7KD 3D18A 4E41E 2DWTA 4G6FD 3RX8A 3CVIH 4OM1L 1XF2B 1YN6A 2XQYA 1MREL 4EQ3A 5GGTL 1RUKL 2OCJA 1TJHH 2YRZA 2H0JA 5IV2A 4XXWC 4QHUB 4DO5A 2W91A 2XICA 1T1YB 3GZOA 3WIHL 3UTPE 4F5CE 4GQRA 4R97C 4OJFH 4K3JH 1SXAA 3ARDD 3HG1E 3PL6A 3X1GA 5E2WL 2W65B 4KHXH 1WGVA 4G7SB 1ZCRA 4P49A 1AKJD 1YPZF 3B6SA 5DQ9B 1FFNB 2ADJB 4MZRA 5CMAB 3CDCA 5F0JB 4R0LC 4FN0A 4OD1L 4EI6B 3NUKA 2CNZA 4ZPTB 1E8ZA 1UVQB 3B7SA 1W72A 4M7ZB 5CIPB 5EZJA 3V55A 2MCMA 5IB1B 1EAOA 2IWEA 5B3NA 2B1AL 3HRPA 2QDVA 4KUCF 3VG0H 2DYPD 1I8UA 2BFGA 5HDBB 1QBLL 1QX1A 4M1DH 1D5XA 4FJYA 5ESQA 1L9TA 5HYSA 3E38A 1S78C 5AB0A 3QPQD 4J39A 4XX1G 5MI0B 4YHNA 4JZJC 4KOBA 4OKVB 4QR7A 2IMNA 1ZOXA 2L7QA 3F7RA 3Q1EA 1K8DB 1FFTB 1HQ4A 3T2PA 5C0RL 4HU2A 5SWSE 2XV0A 2BNRD 4BE5A 5DRNB 5F1SA 5D7IE 2HPTA 3ESVF 4NBYB 1HHGA 1WO2A 2A6JB 4OCSH 3HE6B 1CDBA 1JHTB 2IG2H 5I1EL 4M62H 3ECWA 3KBPA 1GOGA 4FZEH 5C7XH 2OMYB 3BQUD 2OSWA 3T4YA 4D8PB 1J1PH 2VQTA 2QL1A 3QCVH 1E4KA 1QSFB 4LVHC 2WZPD 1AD9B 1KJMB 1MHEA 4N2KA 2WXKA 5T1KB 5HTSA 3MRIB 3ULSB 2R1WB 5F7AA 5FO9A 1J0ZA 2DMGA 4FFZH 1A7RL 5C9JA 1LE9B 4I3GA 4Z7UF 1AQKH 4PH8A 1QWNA 1MJ8L 4PJAB 3C5ZC 4UI2A 2IWKA 2VWEE 3TBTA 3V0EA 4AQ1C 4F7KA 2EEXA 1ZTXL 4TLKA 1WZMA 1Q8MA 1QG3A 3QT2A 4LU5H 4QHNB 4E9RA 4GG8A 5FYJH 4MNGB 5L0QC 3FJTA 3IB4A 1J9SA 2GK2A 4OF3A 5KS9B 7PCYA 5F1NA 4MA1C 1QP1A 4JCWA 1U9KA 1OGTA 2GJZA 4QRPA 1JNLL 2K9UA 3MRJA 4H1LA 5CS7A 1MHPL 5EBLB 1UM5L 1B3JA 2YD3A 3EYFA 2EXSA 4JRYA 4EN3A 3OD3A 3VI4F 3MNMA 3ETBF 1MLBA 2UWEB 2OCFD 4I8DA 5C08E 3ILQC 1YUHA 3RKDD 1A6WL 4HS3B 4KROD 4JAMB 3GSRB 4M5SA 5B7FA 1QQDA 4HWBH 5JNYA 3UPAA 4DGIH 2LHAA 4G7YL 4ENEC 2ARJQ 4JKPL 4V2CB 1YNTB 2F54E 3MRKB 1B6DA 3O3EA 5DJ0A 1YEIH 5F9WC 4X8XA 3RY6A 3AM8A 1OAYL 2ICWJ 5E1QA 4QPEA 43CAA 1CLZH 1MLCA 1X6LA 3N43B 1NCHA 4MRCA 1KCLA 1MY7A 1RUMH 4RZKA 4MJIE 4XMWA 2X0WA 4WJG3 1E30A 1E67A 3QJXA 3TU6A 1BA9A 2UVEA 1B0GA 3KDMA 4E9TA 4LCIH 1XF2A 1I7UA 2DKUA 3LD8B 1T4WA 4MTMA 4H0IA 3JTBA 3L4YA 2RQEA 1U6AH 3EFDL 3Q01A 2OP4H 5EU4B 2GJ6D 1PTZA 1QFHA 2HFFB 4A63A 4BZ1L 3MXVL 1BQHG 2CJUH 3WIIH 3EFOB 5JQIB 2AEQL 4UQDA 1SVBA 5E8OA 1ZT1B 4U1NB 4HEPG 4R7LA 2HMIC 1URIA 3U2SB 1O5PA 1J8HB 1FFNA 1X5JA 4GRLD 1YEEH 3JTTB 1VPOH 5H4ZA 3VD0A 1UZ6E 5E0FA 3ATEA 3EYOB 1Y6KR 4LSRH 2W9DL 3BN3B 3TS8A 5DSCA 4KKRA 5IB1A 1FH5H 3IJSB 4FYRA 4NO2A 2BOLA 5SX4H 2QZQA 2AC0A 1LO5B 4P9HH 2AZAA 3T0EA 4NKQB 1U8PA 2WQSA 1F45A 5I1AA 3DK2A 2MEJB 4M8RA 5HHXL 3RKPA 3T3MF 4CU7A 3VXUE 2GIYA 1P4UA 5IVXF 2PWGA 1RSYA 4OKVA 4QWWC 1AS7A 3D0LA 4S1SH 4P06A 2N1TE 5ETUB 1I7TA 2GG1A 2IAMB 4X7FC 2VT0A 4ZW6A 2ZUTA 2D7QA 3QNYB 3ZY7A 2R8SH 3D34A 5D4HA 4ZSOE 3H54A 1CLOL 2YC1B 2A83B 3MX0A 1AIFB 2WIIA 3QWRA 1KCSL 3BN9C 3JV0A 2AJXH 2AITA 1H8NA 5F3FA 4ZYKB 5AW0B 3S3PA 1MWAH 4LE8A 3D7PA 2XX1A 1K4DB 3SE4A 2VIRB 2X44D 3UJIL 1GYWA 2X9XA 3M07A 3KLAB 4GSQA 5IKCB 2RAMA 2NUTB 4QHKJ 4JNXA 2YAEA 3T6XA 1QSFA 1JPTH 2P1YA 3C12A 2W94A 4PJ6A 3ZTEA 1AD9A 1J5HA 4CJ0A 1S3KH 3MRIA 3ULSA 3KPSE 5HHOA 2XQBH 1FL5B 3FTWA 4G7VH 5AL0A 2ZG1A 4K15A 4K5OA 3U83A 5DVOA 5IWLA 8CGTA 1G6RB 2QGCA 3G7TA 2H2PC 4ONFH 5ICXA 3L3OB 2GTWB 3IU4H 1U3HA 4WTZA 4A2HA 2D0FA 4JFOA 3MRBA 3V10A 3LRLA 2IGLA 2X40A 1R46A 1T7ZA 1AS8A 1TYEB 5KVMC 4GMSL 5F88B 2IPUG 3A4DA 4XPBL 5HGHA 4L0PB 1TTFA 5E8EB 2APWA 1ZGLM 1WD8A 4HIXL 2R0LL 5DC4B 2EE2A 4WY7H 4JR9L 5A6LA 3D85B 4NT6A 2UYLB 1EHXA 4ZTPH 7FABL 5SX5K 1RPQA 1T6WA 3VFGH 3DVGA 3ES6A 2SODB 1C5DB 4GIAA 5JPNB 3OXRB 3VX0A 3FU9A 3AS0A 2CLRB 1HZHH 1WZ1H 2XKNB 3B9KB 3ESMA 3MGOB 1ROCA 1OP9A 3O45B 4X4KA 2D3JA 2IDQA 4TUUA 1U95A 1UACH 2R69L 3FL7A 4Y0GA 4DKEL 4UT6H 4WNQB 5K9KB 2R2CA 1A6VL 3QQ4B 4UQ2A 1TKWA 1G6VK 5ALBL 1NAML 1KGCD 3BVXA 3D87B 4JY5H 1I31A 1HX0A 4WFHE 1NOLA 3B2UD 4D2NA 4WHCA 1ZVNA 2QEJA 1R4XA 2P28B 3AM8C 5FO8B 1P84J 4B5EA 3AACA 4FFZA 3S4SB 3E8VA 2NQCA 2QVIA 4JHVA 1NC4D 3K6SA 4LFHG 3ZDYB 2DWSA 3IJEB 2VDRH 3DV6A 2EXTA 3QZWB 1ETZA 2Y6SD 3QXWA 1G7LA 4W93A 1QI4A 1NBVL 2FWSA 1J1OH 5I19L 2XNAA 4L1TA 4KH9A 1BGXH 4K9EC 2B4CC 1N0LB 3HHMA 5AWNH 4PVMA 3LDBB 4WU5B 1MFMA 1NFDE 2MPAL 4G5ZH 5ENWB 1GAFH 5GRJL 2PP9A 4GUOA 3U2SA 3QEGH 2XVLA 1VFAB 2L0DA 2FEEL 4AI7A 5A6MA 3BSZH 1CF1A 4MB5A 2WNGA 5I5MA 4E5XA 4HZ1A 3H2PA 4B53A 3IDXH 4HV8A 5DZPA 3QC6X 3EYOA 3VD4A 3JWOH 1USZA 3BPCA 4FXKB 4I48B 4C59B 4D3CL 2GC7C 2NDGA 4HETA 3V9EA 4EBQL 1JPFA 2PPFA 4HWBA 3NCYP 2Q86B 1YYLH 1Q9LB 1MEXH 4M7ZC 1KF9B 2Y7QB 4CKVX 1MW3A 3WFBH 5I74B 2CJSA 4UB0H 4Y9EA 4ZFZA 3TYFB 2ZXDA 3AG2B 2VDPL 2VM4A 3I3DA 4N0UB 1IGCH 1CK0L 2DQMA 1JGIA 2YOCA 3EOTL 2YR3A 4PB0L 4HUWA 5CEXA 5MI0C 2IAMA 1HE7A 4P2YA 3VGGA 5K1JA 1IBGH 5DJDB 2FWUA 5HHVL 1X9UA 2YC1A 2CNYA 2D9CA 2H41A 1FRGL 3L4UA 3QDMB 3FT4B 2XFXB 5E0QA 4JM2F 2OW6A 5I1HH 5ISZB 4WVRA 5DJZB 4DW2H 3PABA 1DUZA 4N2DA 3D3VA 4LGPB 5D1XA 2IC2A 3H2WA 3KLAA 1WHPA 5IKCA 1DBBH 1XCQB 2PP7A 2NUTA 2R7EA 5E00B 5T5FH 2WXRA 5D7JA 3R7QA 5IOPA 1AHMA 4KTGA 2BY3A 2V2TA 2VN7A 5FDWA 2Y6TE 3CHQA 1XXDC 5IT2L 3QR0A 4ICXA 3U4EA 1ZS8A 2CA3A 2ZAIA 3QA3A 4M1GH 4H88H 1JHKL 1ITCA 2CM5A 1PX3A 3NZSA 4L48A 4J1UA 4PV9A 5TE4L 1HJCA 3MSPA 5C1MB 1W2KT 3I02B 1NC2A 4DFIA 1UA3A 3OL2A 2APXA 4EKXA 1OQXA 4D9QD 3Q1SH 1ET8A 3W11D 4DVRH 1W72L 2E59A 3RWCA 2A0LD 5T3XE 2OR8A 2LE9A 2V8LA 1P4LB 3N41B 4S1RL 3GIZL 2V5RA 3CFKB 3DYOA 3AJ7A 3QFJA 2RACA 3EO1B 2NY6B 3MRLA 4PWEA 3UJTH 5DF0A 3KM1A 4JHAH 5DLMH 1ZHLB 3L3DA 4YSOA 2VXUH 3B9KA 4X4ME 5LGKA 5JW3H 3LIUA 4DN4L 1WIPA 1CIUA 1YN7B 2FT6A 1G7QA 4WI0B 5AOMA 4NSKA 4LSTH 2ODHA 4OZHB 1MWAA 4ZDHB 4WENB 1VSCA 4H26A 1WA2X 1AR2A 1ZLUK 1FZMB 2XBZA 3O9WD 4LOVA 2GK0B 4JJOA 2HP4A 4CRPA 4BHUA 5ERWA 5IG7A 1M71B 3O81A 3PAVA 1NDTA 3F85A 5F71A 4XZUA 4G72B 4XO4A 1T0PB 1K2DB 3IKKA 2N7AA 3G04B 1JFQH 1ETA1 2OX5B 4FZ8L 5EDXA 1Y1UA 3S4SA 3VFWB 4LCVA 4HIEA 1EV2E 1G9MC 3ZL1A 2E7LA 3CFCL 1OZTG 5C08D 5I8KH 5EU6E 3BAXA 1TJGL 2EYRB 1B90A 1G0DA 2EIBA 3LD8C 3WEOA 1MFDH 1OT1A 3F12B 4U6HA 3A6CL 2BERA 4DJMA 2F54D 4YGVA 2XWJB 2GKIA 3NZ8B 3GGWA 1T7WA 1VFAA 2XPGB 4PW9A 3BQVA 2X4OB 5DJ2B 3G5VB 2CIIB 3QS3A 2W38A 2WOBA 3UTSB 1RV6X 4MJID 3B56A 1K72A 4AE1A 3BPOB 4S11A 5JW5A 2W88A 4MB1A 3DETC 4XHJC 5DFAA 4HSCX 3F5WB 4TMPA 1T0NA 4UT6A 5IHUH 4KRNA 4DPAX 1HYRC 5C3TA 1FNLA 2GC4C 2ZSWB 2K3TA 5CILH 4C56E 5JQHC 3VJ6A 1KZYA 4WEMB 3TYFA 3ME0A 5TDPB 1IC5H 5FS5A 4NFDA 3KLSA 2BDNH 1ZSDB 5DU7A 4HOXA 1IO4C 3GTVA 2PW1A 3FDWA 2J1ZA 4K7FB 5FGRA 2QSCL 4UT7H 1JRHI 2FBJL 5LBSH 3CXFA 4PRIB 5DUPH 3CMOH 3RY5A 4FYTA 2XV6B 1JZGA 2A73B 2D7PA 2IAMC 2XFXA 3FB5B 1D7BA 3NZHL 1MCPH 3EG9A 3GS7A 2CA4A 2P5EB 4LCCB 5KN5A 1ZLSL 3RDTB 1AGEB 2UVFA 2VZ3A 1KFAL 3QHZL 3GUTB 4KXCA 3REVA 4CSSA 3PJSA 3ZE1B 1N5AB 2HT2D 2E27L 1WS8A 2CPUA 1S9XB 9PCYA 3GD1C 3SGKA 1EZSA 3D2UB 1M05B 2PO6A 2JB6B 4FFYH 3S2AA 4EOWL 1IAKA 5JZ7C 5E1AA 4N2GA 4XPAL 3BP4B 2VLJB 3BSZA 5CGYC 1OCRB 1OK0A 4F7MB 4A6YB 4DAGL 3VXSB 2GHWB 4UQCA 2OR7A 4OCXH 4LLYB 1GKOA 5M7QA 3BZEA 4I88A 2DN7A 1AGCB 2CHDA 1N6QH 3JBG7 1HTYA 2F6AA 4R4ND 4C4KT 5I28A 4WWKA 1EMTL 2BJML 3L3OC 5B7EA 1A3LH 3LRSB 1KLFB 4ZQKB 4ZI8A 1O7DE 1P4LA 3QSKB 4CUCA 1NMAL 4L4VA 4AJ0A 4IOIA 2D2CC 1YMMB 2PW2B 1U3YA 2AANA 4DKDC 5C9KA 1XF3B 1UEYA 3VNYA 5JIIA 2LVEA 1ZHLA 5DRWB 3JV4A 3KPSD 3MV8B 4X99B 1JXGA 4I2XA 4B5ZA 5CGTA 4ENZA 1YN7A 1XR9A 1Z9OA 3B2PA 3FTGA 4NENB 3GNML 1JOIA 5IB5B 4WK2B 1DE4B 5JPNC 3B9KC 1FZKA 2B14A 2YQGA 3RWJA 3CVIL 1A0QH 4BGDA 4ZDHA 3S98A 5KZCD 1EJ6A 1MCJA 2VRQA 2ZSVB 3MJ7B 4N0CC 5I30H 1FZMA 1KGJA 1TJHL 4S1QH 4DK3A 3DJRA 1KEGH 1H3VA 5T5FA 3QIBB 3NEOA 1OB1B 2X1XR 3HNVL 1M71A 4XBMA 2W5PA 3FHAA 3I50H 3RILA 5EEYA 4NDMA 1KV3A 2BHFA 3HBZA 5EEXA 2RCSH 2L8AA 1OXYA 3C60A 4K3JL 4OJFL 3QJUB 4UNIA 5D1QE 5L8JB 4Y4FB 2GTZA 3VFWA 3VO0A 2R2BB 5IUCA 3RZCA 1V7ML 5IFAL 2QQNH 2A6IA 25C8L 2X2JA 3B7RL 4FOMA 2PWHA 3LPFA 3TZVA 4ZO8A 3S96B 1ZT7A 4DK6A 3AQYA 2OJEA 1PZBA 3QYMA 3LKOB 4PRPB 2V2WB 2H3NA 2P8LA 3F12A 3FYEB 3GSUA 4MMXB 4RDBA 3QQXA 1SHMA 4X6CF 2XWJA 1L9SA 3VG0L 2I7SA 1TITA 4FF9A 2CRZA 4XVOA 3R1GH 4M1DL 2WY3B 3HKZA 2XPGA 3LDBC 4JN2A 4GI6A 4WFHD 4ODTH 1MNUL 3G5VA 4IKJA 2X4NA 4Y1AA 3W37A 4ORZC 3UTSA 2WQ8A 3QIUA 3ZHFA 3DXAE 3CPLB 4KKCD 5E8NB 3IU3B 3F5WA 4GXUM 4FXKC 3L5HA 2BIHA 3TURA 2OLDA 3HBQA 3IRPX 1DDHB 2MCAA 2J6EH 4WDIB 1QLFB 3RWEB 1QFOA 2DEYX 1BQSA 4L5FE 4MJ6B 1L3NA 4P04A 2VDOB 4M62L 4QEGA 4ZUVB 2JJTC 4PSPA 5CP7A 5I74C 3CFEB 5C7XL 1OB0A 5E6RB 1J1PL 5JA8B 4RDQF 4L0YA 3KDPB 3QCVL 4M8VA 3DUUB 4ONHB 4P9MH 2DL9A 3QI9A 2AQ1A 3JWNE 1GYAA 1F4WH 1F8TH 4CN4A 4FFZL 4R7NA 3SDDB 4LCCA 1MCIA 3IDNB 1UCBL 3QEQA 3RDTA 3U9UB 1AGEA 1AQKL 3L5XL 3FNKA 5IW1A 4P5KA 3ZE2F 3GUTA 1MQKH 1XWVA 3TWYA 3QJTB 5C2BH 3EOAA 3NCBB 2ZIDA 4LU5L 3PWNB 1H9VA 6CGTA 5KUMA 4IBWA 1FLRL 1B4LA 2Q8BL 5C8JB 1SJXA 2BNQB 4M7KH 3VUAA 1A6ZB 4B9FA 5AW8B 1OM9A 5E2VH 3K8KA 5KSAD 1UT1A 2GJJA 3SGKC 1YRKA 3LZRA 3CLFL 3Q43A 1KNOB 3BAWA 2GVYA 1AGCA 4MNQB 1FZJB 3VGHA 3VXPB 1OE1A 4IIZA 5CD5C 5JOEA 4AWJC 1KPUB 4W9IC 3C6EA 5I1GL 1SYVA 3MNDA 2MOGA 3RYMA 3F7PC 2NXYD 5IEKB 5D2NE 3WE6B 1YEIL 3CC5B 3DX8B 2ZXEB 4RFEB 3V7AG 3UACA 2GFBB 2X6VA 5LBSA 5CLTA 4N1EA 5DRWA 2OK0L 1V27A 1A4JA 3MV8A 4IGBA 4X99A 1NBYA 4M5ZL 1HAUA 4D0CB 1MI5E 3KHQA 1ED3B 2NY6C 5GSRB 5TH2B 5IB4B 5SWZA 4E9YA 3T08A 1AGFA 1DSWA 1JK9A 4UZUA 3WFHB 2F53E 1GVIA 4MGXA 1ET5A 4KVCL 3ZE1E 2CDGA 1RY7B 5C0ND 1OT2A 1XHHA 2E9IA 1JV2B 3LQAL 1U6AL 5I1CL 5C3IA 3N44B 2OP4L 4X8GA 1WITA 2YZ8A 1X4YA 5T3XD 3CQFA 4FFYA 3VXSE 1H3XA 5GRVL 2R2BA 2Y23A 2WLIA 3ML8A 4Y16B 3VXMD 2WQAA 1HESA 2BXYA 2CUMA 3T65B 4YBQD 4NBXB 3P9LB 1YEEL 3TL5A 1VPOL 3KPQB 3D05A 5CEZD 2Y1YA 3LKOA 4PRPA 4NNYA 1TZOA 3LSOA 3NJHA 4G80B 1B0RA 4P9HL 5D1ZA 2VLKA 2YD5A 2J1XA 1P5UB 3D5OF 3T77B 3SDXE 3MCG1 1R3IH 4K3DH 5KEZA 1H0DA 2C9VA 1A21A 3HUJE 4M3KB 3KPMB 4JGUA 5HJGA 4NC1C 3HNSH 1AGBB 4UCFA 4Y4KD 4KI5E 3ZSTA 2AKRB 4G6KH 2QDWA 4YSQA 4S1SL 4G70B 4JY6B 32C2B 5EBMB 5AW4B 5DWUL 4X6BA 2R8SL 2WWKT 1YUKB 3HZVB 2WNXA 1QPPA 3QZOA 3NIFE 4OBRA 4AZ8B 4NQCB 1J10A 1A5FH 2AJXL 2DPKA 4Y19D 3OR7B 5DHVB 1TO4A 4PGJA 5TGBB 1QLFA 4UQ3B 3RWEA 2PCFB 1T80A 4N9GB 1ZHKB 1CD1A 3VFSB 2ENJA 1WLHA 3KJ6H 3N50A 4QRSA 1U58A 4W68A 3DUUA 4ZMWA 4NYLA 5IMLA 3FH8A 3RVUC 3GTNA 4TUOA 1J9TA 2XQBL 3B34A 3P0VH 4G7VL 4OGAD 3TP4A 4I0KA 3ZHDA 3IDNA 3U9UA 4Z0BH 4LEXH 1PDKB 1RZ8B 4NKMA 3L9YA 4LCCC 3RDTC 1OAUL 3PWNA 3GRGA 2CUAA 1MFBH 3GI8H 5F96H 4C56D 4QT5B 3BUTA 5DI8A 1D5RA 1HIMH 3FCUB 1NH6A 1A6ZA 5GRXG 1A65A 3SKNB 5ALCL 2UUDK 1OPGH 4WY7L 4CVZB 5I0VA 1LILA 3VFMB 1JZ3A 3HR5B 2A77L 1LEIA 4HGWB 1HNGA 4X6DE 2J2ZB 4MNQA 3KM2A 2YAQA 1FZJA 3O4LB 2QTEA 1P84K 4AV4A 2OMTB 4F57L 1HZHL 1WZ1L 3DMMB 3BAEH 4N8VA 2HJKA 1VACB 3K71B 1UACL 2J6EA 5C0EB 4AM0A 3H55A 4I7ZC 2BNUB 1ETJA 2CO4A 5E8DH 4WKZB 2XA3A 4ZG1A 2GFBA 4JY5L 3SY0A 3AUWB 2H6PB 4IBUA 4WWNA 2DRUA 3TT3L 4MZ3A 1HAWA 1D5ZA 4Z3HA 1U93B 1QRNB 3AWGA 1H8SA 1S7UA 1T7VA 2YKKA 3ULVD 2DQ6A 2QKIB 1ULVA 3IETA 2HT4D 3N55A 1XCTB 3QDJA 4FNTA 4K7PX 5GGVY 3TWCH 3K80A 2WCGA 2HG5A 4P0DA 1KLGA 1OLLA 2PCPB 1A1NB 5HBBA 2Z31A 4QHLB 5T1LB 3DHJA 1AYRA 2VDRL 3RAJH 5EF0A 4HJGA 3G5YA 3AQDA 5SWQB 4Y1TA 1BEYH 4HF5H 1U92A 3HNTH 4N0YL 1BGXL 5DUJA 2I7OA 4YHLH 3VSUA 4KJYB 2OA9A 4EAEA 3K91A 4WI5A 1DQMH 5AWNL 1NKGA 3VH8G 2EEFA 4KHTH 1KYOJ 3QIBC 3UEQA 3W82A 1IQDB 3T4AB 3K81A 3F7YB 3EBIA 3C08H 1GAFL 1ZLVK 2VCOA 3T65A 1KZQA 3QEGL 4RCAA 4Y4FC 3BSZL 4UBDC 3FRPB 5KANG 4TNEA 3IDXL 4NO0B 1RP9A 4FQCH 3JWOL 4DP6X 3EJYC 3FPXA 4XNXH 3FMGL 4G80A 1OARH 1KUMA 2B5IB 3DHPA 3LNEA 1MEXL 4MMXC 5L2KD 2YPKB 2AJZA 3IBOA 1DLHB 2W9LA 3A21A 3QUGA 1UG9A 2R1XA 5AOJA 4GPVA 5I6NA 5D5MF 1L9MA 2JKWA 1L4IA 2ZOKA 5FB8B 3OLEA 3BVWA 4PLKD 4NNXA 4JY6A 4RESB 5E9DE 1IBGL 3FOLB 3NJFA 3EJQA 4B6ZA 3BH8B 3KLHD 2KC0A 4AZ8A 4M1CD 3L08A 2AP2A 5BOJA 1TMQA 4OGYL 1OHZA 3PQYE 2FIKB 3VMPA 3KYOB 3WHXB 3BJ91 5TGBA 5IJKA 5KJ4A 1NTDA 5I1HL 1D7DA 2JIXB 4PJ8B 4DW2L 1LO2L 2Y0SA 4N9GA 2PUQT 4OI9A 3IPBA 1ZHKA 4XP9H 5AOZA 2WB7A 4ZOBA 2OQJB 3ZW3A 3FQXB 5AW6B 4W9ZA 2ZXWB 1FYTE 1FO0B 2BRRL 1I3GH 3TBYA 2G0KA 2K78A 4IEFB 3FF8A 1J5CA 1WV7T 2Z4QA 2FZ3B 3GXMA 3DXAD 1P53A 1F4AA 5DD6B 2MQCA 1PDKA 2AFNA 3SD2A 1RZ8A 3AU1A 4RWHA 4QRQB 3SDDC 4LAJH 1JXDA 1OGAE 5D4QA 3C8KB 1SMAA 2CLZA 3VFRB 3ZKMC 1I3RA 3WKMH 2HTKC 5AOLA 4YQXH 1SF3A 4BCZA 1PG7H 3I6SA 2R59A 5TQ2H 2XWXA 4GKNB 1Z3GL 5CCJA 4JGNA 1AI1L 4NFCA 4JFFA 5LNDA 4NPYB 4N8UA 3VFMA 2AXGB 5IBLD 5KSBB 4QF1A 1GZPB 1JTOA 5D9SA 4IRJA 1H3GA 5DLML 1ZTXE 2VXUL 3UABA 3DMMA 5JW3L 3EYVA 3MUJA 2WYHA 4HSAC 4KKNA 3POHA 4H8WH 1P7KA 3K71A 5D7HA 3TO4B 4LSTL 1XB6A 4AZUA 3CHOA 3RUGE 4PBDA 5FM5M 4BXSV 4OFPA 5EULV 4WHYH 3RPIB 5I23A 1NGZB 1W8NA 1KT2B 1Z1WA 2B20A 4P2QE 4XCCL 1RJLB 1G1CA 2IWGA 3FB6A 1G7HA 2EIKB 4N6QA 2Z8RA 3OX8B 4ZS6D 3D39A 5A16A 1C5CH 2WNKA 1KPVB 3C9NB 1FG2A 5C0JB 3BPLB 2YUVA 2PCPA 4Z7UA 2PCXA 1A1NA 3OLDA 5CJBA 3MGAA 2NNFA 5EBGA 1SFDA 1R3HA 3RNQA 2V7HB 5I8KL 3LZLA 5FECA 2NPLX 4X50A 1MFDL 1QUNB 2AJSH 4I87A 4HOWA 3KWWA 2D9QB 2RHEA 1A66A 2DMCA 3FUMA 2YPLB 5JIPA 4GI8A 1LM8V 5F7UA 2EILB 4P2RA 4Y5YB 3QFDA 1R19A 5B3JF 3FRPA 4Y16C 3VI4A 1DJXA 3F3HA 1RQ5A 3TCXA 1TNMA 4Y2OB 3AY4A 4H8VA 4IMLA 3W39B 3X1NA 4F9PC 1T2XA 2ARWA 1S9VB 3LKPA 3WIAA 2F53D 4AGPA 2QSVA 4DP1X 3WV0A 5IHUL 5C09B 5GGRB 1DJHA 1U36A 3UBXB 2N0KA 1P5UC 1TYRA 1WTGT 1SHSA 5FUOH 2V17H 1R0AL 4OI7A 2BDNL 3BGMA 3GBEA 3U0PB 3ARFD 4PJ5D 3WS3B 1ZV2A 1XGTA 4NHCH 1A6TA 1GMIA 3A67H 1ZLWK 3CN3A 5LBSL 1Q9WB 1Y1DA 3FOLA 3GIVB 5DUPL 1KYDA 4X9GA 3DURA 2EDMA 3PHQA 1BQLL 1R3JB 4MAYD 3QUXB 2FIKA 4NZRH 3MREB 4XNAA 3WHXA 3IFPB 1MCPL 4OLZH 3B2VH 4GAFB 4PJ8A 3CH1A 5AZUA 1DEEA 4YDMA 1OV8A 3RBSA 3WG7B 2XUWA 2IDFA 1WAAE 3M17A 5DFVD 2IANA 4ZMPA 3FQXA 5CBEA 3WKPA 5LQBH 4JE0A 2B08A 4PV1C 4QRTB 3TBWB 2PPEA 5KVDL 3QISA 3SDCB 5A40E 1JZDC 2RFXB 1WF5A 2X1PA 1Y6NR 2FZ3A 4LHUD 1JV5A 4OCXL 3BD5A 3H6JA 4U7SA 3BT2L 4ZO7A 3CZJA 3MKKA 1KBKA 2DH2A 4J8RA 3T9WA 1PFOA 5MEOA 3MCYA 2OSXA 3T3PF 1A3LL 5IHHA 1KG0A 2AXFB 4PJFF 4RGMB 3E9UA 1ONQB 4PI2A 3WLWC 3FUIA 4GKNA 1WVZA 2A6KA 5TDOB 1T89A 3BUDA 4ZX6A 3QHTC 3ZU8A 3HW7A 3DGGA 3GHPA 3TGXA 1OANA 3FSZA 2IGFL 4JO2H 1LK3L 2DD8H 5FGCE 1N9PA 2RJMA 3GSQB 2MKLC 2EZ0C 2V8MA 2FX8H 2O6DA 4Z7WE 1F97A 3DMMC 1A0QL 1JD7A 4JFED 2E5EA 3STZA 3VD5A 5I30L 3RPIA 4CDGC 1NGZA 5EHFA 5DJXB 4URKA 1KEGL 3U79A 3FO2B 1ZWIB 4OZIB 1KIUB 3QIWD 2DQUL 1BOGB 1AO7E 1CBJA 2KLTA 2RCSL 2DQFB 4W4OA 3C9NA 1TZHA 1H8LA 2DZEA 2K8MA 4D94A 4RRPA 5KOVC 1KJ2L 3H1ZA 5HJ3B 4HJUA 3VDAA 2QKIC 4PJXB 1Q0YH 2ODIA 4LOUD 4LLMB 3NFSH 1C8QA 2ZKHH 2A2QT 2ZZUT 4PRNA 3DDFA 1T6VN 4TM9A 2EABA 3JSSA 1O75A 1S7WA 2JQZA 2DIAA 5CGBA 1PCXA 2OSLA 1P6AB 2YPLA 4ZAKB 2WW8A 5HGBB 4M43H 2Y22A 3O11A 4ODTL 4Y5YA 5JQ6H 3T4AC 3P9MA 2IIJA 2B16A 3KYNA 5DDHB 5IQNA 5IJVB 2OL3H 4X5RA 3VGEA 3F7LA 2Y72A 4U4IA 1ZV9A 2G5BA 5KBNC 1I1YB 3ZR5A 3FXIC 4TUJB 4F15B 1SZNA 2IAAC 3P0YH 3BXNB 2EXYC 2YAHA 4GXUN 4IK6A 4U1SA 1B0WA 2B5IC 1NMBL 1J5OH 4I13B 3N04A 1E8YA 4MXQC 4PJBB 2R4RH 2Z1PA 2J6EL 5FK9A 1S9YB 1CFSA 4DOHE 3OR6B 1NFIB 2XZQL 1OP4A 1U8JA 2A9BA 3WS3A 3KPRE 2AI0H 1RXLA 4F3FB 3UBXI 1JYVA 4GW5B 3ZDZF 1Q9WA 5H2BA 2DLFH 3D4YA 2NRDA 3IMVA 4G9FD 1T66C 2X41A 2XN9B 4P9ML 2MNUA 1R3JA 3MRRA 1F4WL 1F8TL 2HKHH 3MREA 1TLMA 5FO7B 3KVQA 3LRHA 3TN0A 4APQD 1G9NH 4CNIB 4X4YA 1TZIA 1XH3B 3FW6A 3GXFA 1MQKL 5KSUA 1RZIB 3QUZB 4KGJA 2JJSC 4PJ8C 4M03A 1UOKA 2Y1ZA 2BINA 4AENA 1A1OB 3DGDA 1WWWX 2X70B 4M7KL 3ZK0A 5I8EB 2RFXA 3D06A 4W6WB 3ZR6A 5IIEA 5E2VL 2VM3A 4C58B 5SV4A 5KYUA 3VI3B 2IFGA 4OVVA 1QLEH 4D0DB 3GT6A 1ND0B 5DCCA 3L5WB 2EIDA 1GYUA 1TJXA 3RHWF 4R2GD 1N70A 2X6MA 5K1NA 3ISYA 1U0QA 3PQYD 1RZKC 2ADIB 5CN1A 1ZA3B 2AXFA </