5B1LC

The mouse nucleosome structure containing h3t
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 33
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lC00
2RVQC 3AZNC 5B31A 5DNND 3C1BD 3REJD 2YFVB 3W96B 3X1SC 5AY8B 2HUEC 3AZJD 3AZFD 1KX3C 5B33C 4H9QA 3UTAC 4DRBA 3MGSD 1P3BD 2NQBC 3TU4B 4ZBJC 1P3IA 3WKJA 5B24C 3WTPA 5GT3A 5B0YD 4XUJD 4CSRA 3REKB 5AV9A 1KX4C 3AZKA 4YM6D 1TZYA 3AZLC 5FUGA 5AV5C 4J8XC 3RELC 4EO5B 1P3LD 5GSUD 1P3IB 3WKJB 1ID3D 3WTPB 5GT3B 5B31C 4WU8D 3KWQB 1P34D 3KUYA 5AV9B 4Z66A 4WNNA 4G92B 3AFAA 1EQZA 4J8UD 3MVDC 5B40B 3MGRD 5AV8A 1TZYB 3V9RA 1ULYA 3A6ND 3AZED 1P3KD 1H3OA 4QLCD 1U35D 3AZIA 5B32A 4KUDC 5B0ZA 3X1TB 1BH8A 3AZGD 1HQ3D 3KUYB 4Z66B 3VH6T 5BT1C 3AZMA 4WNNB 3AV1D 1EQZB 3LELA 3W97D 2PYOA 3AZKC 4Z5TD 1P3PA 3V9RB 4LD9D 3B0CT 5CPKD 1H3OB 3MGQC 4CAYB 5GT0B 5CPJD 3LZ0A 3KXBA 3AZIB 5B32B 3REHB 3AZMB 5B2IA 3LELB 5AVCD 2AROA 4Z2MG 2PYOB 3AFAC 3MNNB 1P3PB 4G91C 1R4VA 5AV8C 3NQUA 5AVBD 3X1VD 3REKD 4XZQD 3LZ0B 3KXBB 5C3IC 5B0ZC 1P3FB 1M18D 3X1UA 5B2IB 1F66C 2AROB 1M1AC 3LELC 3B6FC 5CP6A 1M19A 4J8WD 3NQUB 3KWQD 4YS3A 5BS7A 3WA9C 3C1BA 5B40D 5B2JA 5CPIB 4KGCA 4R8PD 1P3MD 2F8NA 3MGPD 5CP6B 3X1TD 4H9PA 4YS3B 5E5AC 3AZNA 3AV2D 5B2JB 3X1SA 1P3OD 5GT0D 4WU9A 3B0DC 3W98D 5B33A 4NE5A 4KGCB 5BNVB 3UTAA 3X1UC 3O62C 2NZDD 3AYWC 2NQBA 1KX5C 5F99D 1M19C 4H9PB 3REHD 1BH9A 3AZNB 3C1CC 5AV6A 5B24A 5G49B 3X1SB 3MNND 4H9NB 5DNNC 3C1BC 1AOID 3REJC 2HIOA 1KX4A 3LJAA 1KX3B 5B33B 1BFMA 2LY8A 3UTAB 3AZFC 1P3GD 4AWLC 2NQBB 4E45A 3MGSC 4ZBJB 1BH9B 1P3FD 5GXQD 5B24B 3LZ1A 3VH6W 2CV5A 3B6GD 5B0YC 1KX4B 5JRGD 4JJND 3B0CW 3MVDA 4WU9C 3AZLB 3AN2D 4NE3A 5B1MD 5AV5B 4J8XB 3RELB 5BO0A 5CPID 3REID 1ZLAA 1P3LC 5GSUC 5B31B 5AV6C 4KUDA 2HIOC 3MVDB 3VH6A 4H9SA 3LJAC 4H9QB 4J8UC 3MGRC 5BO0B 3MGQA 5JA4A 5DNMD 4HGAC 3AZEC 1ZLAB 1B67A 1P3AA 1KU5A 1N1JA 4KUDB 3LZ1C 2CV5C 4CSRB 2RVQD 3B0BA 3AZGC 3AZKB 3W97C 5FUGB 3MGQB 4Z5TC 5JA4B 3AZHD 4LD9C 2FJ7D 5CPKC 1KX3D 1ZLAC 1N1JB 5CPJC 3WAAA 3AV1B 5KDMA 1F66A 3UTBD 1M1AA 4J8VD 4UUZA 3AFAB 1S32A 3B6FA 4G91B 4H9SC 5AV8B 5AVCC 4ZUXA 1TAFA 3W96D 5AY8D 3VH5T 5B1LA 5AVBC 3X1VC 3WA9A 1P3AC 4XZQC 5C3IB 3W99A 3AZLD 5B32G 2JSSA 4J8XD 4X23A 5KDMB 5B0ZB 3RELD 1BH8B 3TU4D 1F66B 1M1AB 4UUZB 3B6FB 5B31D 4ZUXB 1TAFB 5E5AA 1HTAA 4J8WC 3WA9B 3WTPE 3WAAC 3UT9A 2IO5C 1P3ID 3WKJD 3O62A 3AYWA 1KX5A 1S32C 1P3MC 3WTPD 5GT3D 4ZUXC 5E5AB 3C1CA 5AV9D 5B1LC 5DNNA 3REJA 3W99C 1TZYD 3AV2C 3B0DB 4H9OA 4X23C 1P3OC 3AZJA 3AZFA 3W98C 4NE6A 3X1UB 3O62B 3AYWB 1KX5B 3MGSA 1P3BA 1M19B 5F99C 3C1CB 3KUYD 4Z66D 1EQZD 3AFAD 5DNNB 3C1BB 5AV8D 3REJB 5B0YA 4XUJA 4H9OB 1AOIC 3AZFB 3R45A 4AWLB 3UT9C 4YM6A 3AZID 2F8NB 1P3GC 3MGSB 5B32D 5B0ZD 1P3LA 5GSUA 1ID3A 3AZMD 3LELD 2PYOD 1P3PD 5B0YB 4WU8A 1P34A 3B6GC 4WU9B 5JRGC 4JJNC 3AZJC 4J8UA 3LZ0D 3KXBD 3MGRA 3NQJA 5B1MC 3A6NA 3AZEA 1P3KA 1P3BC 1P3LB 5GSUB 4QLCA 1U35A 1ID3B 4WZSB 5AV6B 5B2ID 2AROD 2HIOB 3AZGA 1HQ3A 4XUJC 3LJAB 3AV1A 4J8VA 4J8UB 3W97A 3VH5W 3MGRB 3NQJB 4Z5TA 4YM6C 4LD9A 4HGAB 3W96A 3A6NB 3AZEB 5CPKA 5DNMC 5CPJA 1ID3C 2BYKA 3LZ1B 5B31G 2CV5B 5CP6D 1M19D 4WV4B 3AZGB 4YS3D 4WU8C 1P34C 5AVCA 3W97B 4Z5TB 5B2JD 2BYMA 4LD9B 5CPKB 5AVBA 3X1VA 3AZHC 3REKA 3A6NC 1P3KC 3VH5A 4XZQA 2FJ7C 5CPJB 4KGCD 4QLCC 1U35C 2BYKB 2F8ND 1M18A 1HQ3C 4NFTA 3AZND 3UTBC 5AVCB 3AV1C 4J8VC 2F8NH 2BYMB 3X1SD 2L5AA 4J8WA 5AVBB 3KWQA 3X1VB 3W96C 5AY8C 1P3AB 4H9RA 4XZQB 4WU9D 5B33D 3UTAD 5B40A 2NQBD 5BNXA 3TU4C 1M18B 4R8PA 5AV6D 5B24D 1P3MA 3MGPA 3X1TA 4J8WB 2HIOD 1KX4D 3LJAD 4H9RB 3REKC 3AV2A 5AV5D 3WAAB 5BNXB 1P3OA 5CHLB 2IO5B 4CAYA 5GT0A 3W98A 4EO5C 1S32B 4R8PB 1P3MB 1P3IC 1M18C 3WKJC 3LZ1D 2NZDA 4KHAA 3MGPB 2CV5D 5F99A 3WTPC 5GT3C 3REHA 5B1LB 3KWQC 3MVDD 5AV9C 4G92C 3AV2B 3W99B 3MNNA 5B40C 4X23B 1P3OB 1AOIA 1TZYC 3W98B 1ZLAD 1P3GA 2NZDB 4R8PC 4KHAB 4KUDD 5F99B 3MGPC 3X1TC 5BT1D 1P3FA 5GXQA 3KUYC 2F8NK 4Z66C 1JFIA 4DRAA 3AZKD 1EQZC 1AOIB 3B6GA 3MGQD 1A7WA 5JRGA 4JJNA 3UT9B 1P3AD 5GT0C 1P3GB 3AN2A 5B1MA 3AZIC 4E44A 2NZDC 5CPIA 5B32C 3REIA 3REHC 5GXQB 1JFIB 3AZMC 2PYOC 3B6GB 3MNNC 1P3PC 5JRGB 4JJNB 3AZJB 3UTBB 3AN2B 5B1MB 2F8NG 3LZ0C 3KXBC 1P3BB 3WAAD 5DNMA 3REIB 1F66D 4M6BA 1M1AD 5BNVA 1S32D 1P3FC 5GXQC 3B6FD 5B2IC 2AROC 4ZUXD 4XUJB 5B1LD 3R45B 3WA9D 4YM6B 3W99D 5G49A 3AN2C 4H9NA 3AZHA 1Q9CA 4X23D 5DNMB 2FJ7A 5CPIC 1KX3A 3REIC 1WWIA 2YFWA 2CWEA 1F1EA 3KSYA 4WU8B 1P34B 5CP6C 5E5AD 3UTBA 4YS3C 5BS7C 2YFVA 5B2JC 3AZHB 2HUEB 1P3KB 5AY8A 2FJ7B 3UT9D 4QLCB 1U35B 2YFWB 3X1UD 3O62D 3AYWD 3AZLA 1KX5D 4Z2MH 5AV5A 4KGCC 4J8XA 1WWSA 3RELA 3TU4A 1HQ3B 3C1CD 1B6WA 4J8VB
chains in the Genus database with same CATH superfamily
2RVQC 2Y2LA 3AZNC 5B31A 2ZY5A 5DNND 3C1BD 3REJD 2YFVB 3W96B 3X1SC 5AY8B 3A1IA 2HUEC 3AZJD 3AZFD 1KX3C 5B33C 4H9QA 3UTAC 4DRBA 3MGSD 1P3BD 1PZRA 2NQBC 3TU4B 2ZY2A 4ZBJC 1P3IA 2RIQA 3WKJA 5B24C 3WTPA 5GT3A 5B0YD 4XUJD 4CSRA 3REKB 5AV9A 1KX4C 3AZKA 4YM6D 2FFFB 1TZYA 3AZLC 5FUGA 5AV5C 2VQRA 4J8XC 3RELC 4EO5B 1P3LD 5GSUD 1P3IB 3WKJB 1ID3D 2Y2NA 3KFUG 3WTPB 5GT3B 5B31C 4WU8D 3KWQB 1P34D 3KUYA 5AV9B 4Z66A 4WNNA 4G92B 3AFAA 1EQZA 4J8UD 3MVDC 3EG5B 5B40B 5AV8A 3MGRD 1TZYB 3V9RA 1ULYA 3A6ND 3AZED 1P3KD 1H3OA 4QLCD 1U35D 3AZIA 5B32A 4KUDC 5B0ZA 3X1TB 1BH8A 3AZGD 1HQ3D 3KUYB 4Z66B 3VH6T 5BT1C 3AZMA 4WNNB 3AV1D 1EQZB 3LELA 3W97D 2PYOA 3AZKC 4Z5TD 2BG1A 3V9RB 1P3PA 4LD9D 3B0CT 5CPKD 1H3OB 3MGQC 4CAYB 5GT0B 5CPJD 3LZ0A 3KXBA 3AZIB 5B32B 3REHB 3AZMB 5B2IA 3LELB 5AVCD 2AROA 4Z2MG 3EPKA 3AFAC 2PYOB 3MNNB 1P3PB 4G91C 2DF4C 1R4VA 5AV8C 3NQUA 5AVBD 3X1VD 3REKD 4XZQD 3LZ0B 3KXBB 5C3IC 5B0ZC 1P3FB 1M18D 3X1UA 5B2IB 1F66C 2AROB 1M1AC 3LELC 3B6FC 5CP6A 1M19A 4J8WD 3NQUB 3KWQD 4YS3A 5BS7A 3WA9C 3C1BA 2G5IC 5B40D 5B2JA 5CPIB 4KGCA 4R8PD 1P3MD 2F8NA 1W2EA 3MGPD 5CP6B 3X1TD 4H9PA 4YS3B 5E5AC 3AZNA 3AV2D 5B2JB 3X1SA 1P3OD 5GT0D 4WU9A 3B0DC 3W98D 3P5JB 4NE5A 5B33A 4KGCB 5BNVB 3UTAA 3X1UC 2Y2IA 3O62C 3AYWC 2NQBA 1KX5C 2NZDD 5F99D 1M19C 4H9PB 3REHD 1BH9A 3AZNB 3C1CC 5AV6A 5B24A 5G49B 3X1SB 3MNND 4H9NB 5DNNC 3C1BC 1AOID 3REJC 2HIOA 1KX4A 3LJAA 1KX3B 5B33B 1BFMA 2LY8A 3UTAB 2Y2KA 3AZFC 1P3GD 4AWLC 2W8SA 2NQBB 4E45A 3MGSC 4ZBJB 1BH9B 1P3FD 5GXQD 2Y2PA 5B24B 3LZ1A 3VH6W 2CV5A 3B6GD 5B0YC 1KX4B 5JRGD 2Y2GA 4JJND 3B0CW 3MVDA 4WU9C 3AZLB 3AN2D 4NE3A 5B1MD 5AV5B 4J8XB 3RELB 5BO0A 5CPID 3REID 1ZLAA 1P3LC 5GSUC 5B31B 5AV6C 4KUDA 3EPLA 1Z2CB 2HIOC 3MVDB 3VH6A 4H9SA 3LJAC 4H9QB 4J8UC 3MGRC 5BO0B 3MGQA 5JA4A 5DNMD 4HGAC 3AZEC 1ZLAB 1B67A 1P3AA 1KU5A 1N1JA 4KUDB 3F6TA 3LZ1C 2CV5C 4CSRB 2JCHA 2RVQD 3B0BA 3AZGC 3AZKB 3W97C 5FUGB 3MGQB 4Z5TC 5JA4B 3AZHD 4LD9C 2FJ7D 5CPKC 1KX3D 1ZLAC 1N1JB 5CPJC 3WAAA 3AV1B 5KDMA 1F66A 3UTBD 1M1AA 4J8VD 4UUZA 3AFAB 1S32A 3B6FA 4G91B 4H9SC 5AV8B 5AVCC 4ZUXA 1TAFA 3W96D 5AY8D 3VH5T 2Y2HA 5B1LA 5AVBC 3X1VC 3WA9A 1P3AC 4XZQC 5C3IB 3W99A 3AZLD 5B32G 2JSSA 4J8XD 4X23A 5KDMB 5B0ZB 3RELD 1BH8B 3TU4D 1F66B 1M1AB 4UUZB 3B6FB 5B31D 4ZUXB 1TAFB 5E5AA 1HTAA 4J8WC 2ZY4A 3WA9B 3WTPE 3WAAC 3UT9A 2IO5C 1P3ID 3WKJD 3O62A 3AYWA 1KX5A 1S32C 1P3MC 3WTPD 5GT3D 3A1KA 4ZUXC 5E5AB 2ZM5A 3C1CA 5AV9D 2DQNC 5B1LC 5DNNA 3REJA 4UPKA 1TZYD 3W99C 3AV2C 3B0DB 4H9OA 4X23C 1P3OC 3AZJA 3AZFA 3W98C 4NE6A 3X1UB 3O62B 3AYWB 1KX5B 3MGSA 1P3BA 1M19B 5F99C 3C1CB 3KUYD 4Z66D 1EQZD 3AFAD 5DNNB 3C1BB 5AV8D 3REJB 5B0YA 4XUJA 4H9OB 1AOIC 3AZFB 3R45A 2G5HC 4AWLB 3UT9C 4YM6A 3AZID 2F8NB 1P3GC 3MGSB 5B32D 5B0ZD 1P3LA 5GSUA 1ID3A 3AZMD 3LELD 2PYOD 1P3PD 5B0YB 4WU8A 1P34A 3B6GC 4WU9B 5JRGC 4JJNC 3AZJC 4J8UA 2J8PA 3LZ0D 3KXBD 3MGRA 3NQJA 5B1MC 3A6NA 3AZEA 1P3KA 1P3BC 1P3LB 5GSUB 4QLCA 1U35A 1ID3B 4WZSB 5AV6B 2XD1A 5B2ID 2AROD 2HIOB 3AZGA 1HQ3A 4XUJC 3LJAB 3AV1A 4J8VA 4J8UB 3W97A 3VH5W 3MGRB 3NQJB 4Z5TA 4YM6C 4LD9A 4HGAB 3W96A 3A6NB 3AZEB 5CPKA 5DNMC 5CPJA 2XD5A 1ID3C 2BYKA 3LZ1B 5B31G 2CV5B 5CP6D 3EPJA 1M19D 4WV4B 3AZGB 4YS3D 4WU8C 1P34C 5AVCA 3W97B 4Z5TB 5B2JD 2BYMA 4LD9B 5CPKB 5AVBA 3X1VA 3AZHC 3REKA 3A6NC 1P3KC 3IP4C 3VH5A 4XZQA 2FJ7C 5CPJB 4KGCD 4QLCC 1U35C 2F2AC 2BYKB 4WJ3C 2F8ND 1T3UA 1M18A 1HQ3C 4NFTA 3AZND 3UTBC 5AVCB 3AV1C 4J8VC 2F8NH 2BYMB 3X1SD 2L5AA 4J8WA 5AVBB 3KWQA 3X1VB 2Y2JA 3W96C 5AY8C 1P3AB 4H9RA 4XZQB 4WU9D 5B33D 3UTAD 5B40A 2NQBD 5BNXA 3TU4C 1M18B 4R8PA 5AV6D 5B24D 1P3MA 3MGPA 2ZY3A 3X1TA 4J8WB 2HIOD 1KX4D 3LJAD 4H9RB 3REKC 3AV2A 5AV5D 3WAAB 5BNXB 1P3OA 5CHLB 2IO5B 3AL0C 4CAYA 5GT0A 3W98A 4EO5C 1S32B 4R8PB 1P3MB 1P3IC 1M18C 3WKJC 3LZ1D 2NZDA 4KHAA 3MGPB 2CV5D 5F99A 3WTPC 5GT3C 3REHA 5B1LB 3KWQC 3MVDD 5AV9C 2JE5A 4G92C 3AV2B 3W99B 3MNNA 5B40C 4X23B 1P3OB 1AOIA 1TZYC 2Y2MA 2Y2OA 3W98B 1ZLAD 1P3GA 2NZDB 4R8PC 4KHAB 4KUDD 3EPHA 5F99B 3MGPC 3X1TC 5BT1D 1P3FA 5GXQA 3KUYC 2F8NK 4Z66C 1JFIA 4DRAA 3AZKD 1EQZC 1AOIB 3B6GA 3MGQD 1A7WA 5JRGA 4JJNA 3UT9B 1P3AD 5GT0C 1P3GB 3AN2A 5B1MA 4DQYB 2Y2QA 3AZIC 3FDDA 4E44A 2NZDC 5CPIA 5B32C 3REIA 3REHC 5GXQB 1JFIB 3AZMC 2PYOC 3B6GB 3MNNC 1P3PC 5JRGB 4JJNB 3AZJB 3UTBB 3AN2B 3H0LC 5B1MB 2F8NG 3LZ0C 3KXBC 1P3BB 3WAAD 5DNMA 3REIB 1F66D 4M6BA 1M1AD 5BNVA 1S32D 1P3FC 5GXQC 3B6FD 5B2IC 2AROC 4ZUXD 4XUJB 5B1LD 3R45B 3WA9D 4YM6B 3W99D 5G49A 3AN2C 4H9NA 3AZHA 1Q9CA 4X23D 5DNMB 2FJ7A 5CPIC 1KX3A 3REIC 1WWIA 2YFWA 3H0RC 2CWEA 1F1EA 3KSYA 4WU8B 1P34B 5CP6C 5E5AD 3UTBA 4YS3C 5BS7C 2UWXA 2YFVA 5B2JC 3AZHB 2HUEB 1P3KB 5AY8A 2FJ7B 3H0MC 3UT9D 4QLCB 1U35B 2YFWB 3X1UD 3O62D 3AYWD 3AZLA 1KX5D 4Z2MH 5AV5A 4KGCC 4J8XA 1WWSA 3RELA 3TU4A 1HQ3B 3C1CD 1B6WA 4J8VB
chains in the Genus database with same CATH topology
2RVQC 2Y2LA 3AZNC 5B31A 2ZY5A 5DNND 3C1BD 3REJD 2YFVB 3W96B 3X1SC 5AY8B 3A1IA 2HUEC 3AZJD 3AZFD 1KX3C 5B33C 4H9QA 3UTAC 4DRBA 3MGSD 1P3BD 1PZRA 2NQBC 3TU4B 2ZY2A 4ZBJC 1P3IA 2RIQA 3WKJA 5B24C 3WTPA 5GT3A 5B0YD 4XUJD 4CSRA 3REKB 5AV9A 1KX4C 3AZKA 4YM6D 2FFFB 1TZYA 3AZLC 5FUGA 5AV5C 2VQRA 4J8XC 3RELC 4EO5B 1P3LD 5GSUD 1P3IB 3WKJB 1ID3D 2Y2NA 3KFUG 3WTPB 5GT3B 5B31C 4WU8D 3KWQB 1P34D 3KUYA 5AV9B 4Z66A 4WNNA 4G92B 3AFAA 1EQZA 4J8UD 3MVDC 3EG5B 5B40B 5AV8A 3MGRD 1TZYB 3V9RA 1ULYA 3A6ND 3AZED 1P3KD 1H3OA 4QLCD 1U35D 3AZIA 5B32A 4KUDC 5B0ZA 3X1TB 1BH8A 3AZGD 1HQ3D 3KUYB 4Z66B 3VH6T 5BT1C 3AZMA 4WNNB 3AV1D 1EQZB 3LELA 3W97D 2PYOA 3AZKC 4Z5TD 2BG1A 3V9RB 1P3PA 4LD9D 3B0CT 5CPKD 1H3OB 3MGQC 4CAYB 5GT0B 5CPJD 3LZ0A 3KXBA 3AZIB 5B32B 3REHB 3AZMB 5B2IA 3LELB 5AVCD 2AROA 4Z2MG 3EPKA 3AFAC 2PYOB 3MNNB 1P3PB 4G91C 2DF4C 1R4VA 5AV8C 3NQUA 5AVBD 3X1VD 3REKD 4XZQD 3LZ0B 3KXBB 5C3IC 5B0ZC 1P3FB 1M18D 3X1UA 5B2IB 1F66C 2AROB 1M1AC 3LELC 3B6FC 5CP6A 1M19A 4J8WD 3NQUB 3KWQD 4YS3A 5BS7A 3WA9C 3C1BA 2G5IC 5B40D 5B2JA 5CPIB 4KGCA 4R8PD 1P3MD 2F8NA 1W2EA 3MGPD 5CP6B 3X1TD 4H9PA 4YS3B 5E5AC 3AZNA 3AV2D 5B2JB 3X1SA 1P3OD 5GT0D 4WU9A 3B0DC 3W98D 3P5JB 4NE5A 5B33A 4KGCB 5BNVB 3UTAA 3X1UC 2Y2IA 3O62C 3AYWC 2NQBA 1KX5C 2NZDD 5F99D 1M19C 4H9PB 3REHD 1BH9A 3AZNB 3C1CC 5AV6A 5B24A 5G49B 3X1SB 3MNND 4H9NB 5DNNC 3C1BC 1AOID 3REJC 2HIOA 1KX4A 3LJAA 1KX3B 5B33B 1BFMA 2LY8A 3UTAB 2Y2KA 3AZFC 1P3GD 4AWLC 2W8SA 2NQBB 4E45A 3MGSC 4ZBJB 1BH9B 1P3FD 5GXQD 2Y2PA 5B24B 3LZ1A 3VH6W 2CV5A 3B6GD 5B0YC 1KX4B 5JRGD 2Y2GA 4JJND 3B0CW 3MVDA 4WU9C 3AZLB 3AN2D 4NE3A 5B1MD 5AV5B 4J8XB 3RELB 5BO0A 5CPID 3REID 1ZLAA 1P3LC 5GSUC 5B31B 5AV6C 4KUDA 3EPLA 1Z2CB 2HIOC 3MVDB 3VH6A 4H9SA 3LJAC 4H9QB 4J8UC 3MGRC 5BO0B 3MGQA 5JA4A 5DNMD 4HGAC 3AZEC 1ZLAB 1B67A 1P3AA 1KU5A 1N1JA 4KUDB 3F6TA 3LZ1C 2CV5C 4CSRB 2JCHA 2RVQD 3B0BA 3AZGC 3AZKB 3W97C 5FUGB 3MGQB 4Z5TC 5JA4B 3AZHD 4LD9C 2FJ7D 5CPKC 1KX3D 1ZLAC 1N1JB 5CPJC 3WAAA 3AV1B 5KDMA 1F66A 3UTBD 1M1AA 4J8VD 4UUZA 3AFAB 1S32A 3B6FA 4G91B 4H9SC 5AV8B 5AVCC 4ZUXA 1TAFA 3W96D 5AY8D 3VH5T 2Y2HA 5B1LA 5AVBC 3X1VC 3WA9A 1P3AC 4XZQC 5C3IB 3W99A 3AZLD 5B32G 2JSSA 4J8XD 4X23A 5KDMB 5B0ZB 3RELD 1BH8B 3TU4D 1F66B 1M1AB 4UUZB 3B6FB 5B31D 4ZUXB 1TAFB 5E5AA 1HTAA 4J8WC 2ZY4A 3WA9B 3WTPE 3WAAC 3UT9A 2IO5C 1P3ID 3WKJD 3O62A 3AYWA 1KX5A 1S32C 1P3MC 3WTPD 5GT3D 3A1KA 4ZUXC 5E5AB 2ZM5A 3C1CA 5AV9D 2DQNC 5B1LC 5DNNA 3REJA 4UPKA 1TZYD 3W99C 3AV2C 3B0DB 4H9OA 4X23C 1P3OC 3AZJA 3AZFA 3W98C 4NE6A 3X1UB 3O62B 3AYWB 1KX5B 3MGSA 1P3BA 1M19B 5F99C 3C1CB 3KUYD 4Z66D 1EQZD 3AFAD 5DNNB 3C1BB 5AV8D 3REJB 5B0YA 4XUJA 4H9OB 1AOIC 3AZFB 3R45A 2G5HC 4AWLB 3UT9C 4YM6A 3AZID 2F8NB 1P3GC 3MGSB 5B32D 5B0ZD 1P3LA 5GSUA 1ID3A 3AZMD 3LELD 2PYOD 1P3PD 5B0YB 4WU8A 1P34A 3B6GC 4WU9B 5JRGC 4JJNC 3AZJC 4J8UA 2J8PA 3LZ0D 3KXBD 3MGRA 3NQJA 5B1MC 3A6NA 3AZEA 1P3KA 1P3BC 1P3LB 5GSUB 4QLCA 1U35A 1ID3B 4WZSB 5AV6B 2XD1A 5B2ID 2AROD 2HIOB 3AZGA 1HQ3A 4XUJC 3LJAB 3AV1A 4J8VA 4J8UB 3W97A 3VH5W 3MGRB 3NQJB 4Z5TA 4YM6C 4LD9A 4HGAB 3W96A 3A6NB 3AZEB 5CPKA 5DNMC 5CPJA 2XD5A 1ID3C 2BYKA 3LZ1B 5B31G 2CV5B 5CP6D 3EPJA 1M19D 4WV4B 3AZGB 4YS3D 4WU8C 1P34C 5AVCA 3W97B 4Z5TB 5B2JD 2BYMA 4LD9B 5CPKB 5AVBA 3X1VA 3AZHC 3REKA 3A6NC 1P3KC 3IP4C 3VH5A 4XZQA 2FJ7C 5CPJB 4KGCD 4QLCC 1U35C 2F2AC 2BYKB 4WJ3C 2F8ND 1T3UA 1M18A 1HQ3C 4NFTA 3AZND 3UTBC 5AVCB 3AV1C 4J8VC 2F8NH 2BYMB 3X1SD 2L5AA 4J8WA 5AVBB 3KWQA 3X1VB 2Y2JA 3W96C 5AY8C 1P3AB 4H9RA 4XZQB 4WU9D 5B33D 3UTAD 5B40A 2NQBD 5BNXA 3TU4C 1M18B 4R8PA 5AV6D 5B24D 1P3MA 3MGPA 2ZY3A 3X1TA 4J8WB 2HIOD 1KX4D 3LJAD 4H9RB 3REKC 3AV2A 5AV5D 3WAAB 5BNXB 1P3OA 5CHLB 2IO5B 3AL0C 4CAYA 5GT0A 3W98A 4EO5C 1S32B 4R8PB 1P3MB 1P3IC 1M18C 3WKJC 3LZ1D 2NZDA 4KHAA 3MGPB 2CV5D 5F99A 3WTPC 5GT3C 3REHA 5B1LB 3KWQC 3MVDD 5AV9C 2JE5A 4G92C 3AV2B 3W99B 3MNNA 5B40C 4X23B 1P3OB 1AOIA 1TZYC 2Y2MA 2Y2OA 3W98B 1ZLAD 1P3GA 2NZDB 4R8PC 4KHAB 4KUDD 3EPHA 5F99B 3MGPC 3X1TC 5BT1D 1P3FA 5GXQA 3KUYC 2F8NK 4Z66C 1JFIA 4DRAA 3AZKD 1EQZC 1AOIB 3B6GA 3MGQD 1A7WA 5JRGA 4JJNA 3UT9B 1P3AD 5GT0C 1P3GB 3AN2A 5B1MA 4DQYB 2Y2QA 3AZIC 3FDDA 4E44A 2NZDC 5CPIA 5B32C 3REIA 3REHC 5GXQB 1JFIB 3AZMC 2PYOC 3B6GB 3MNNC 1P3PC 5JRGB 4JJNB 3AZJB 3UTBB 3AN2B 3H0LC 5B1MB 2F8NG 3LZ0C 3KXBC 1P3BB 3WAAD 5DNMA 3REIB 1F66D 4M6BA 1M1AD 5BNVA 1S32D 1P3FC 5GXQC 3B6FD 5B2IC 2AROC 4ZUXD 4XUJB 5B1LD 3R45B 3WA9D 4YM6B 3W99D 5G49A 3AN2C 4H9NA 3AZHA 1Q9CA 4X23D 5DNMB 2FJ7A 5CPIC 1KX3A 3REIC 1WWIA 2YFWA 3H0RC 2CWEA 1F1EA 3KSYA 4WU8B 1P34B 5CP6C 5E5AD 3UTBA 4YS3C 5BS7C 2UWXA 2YFVA 5B2JC 3AZHB 2HUEB 1P3KB 5AY8A 2FJ7B 3H0MC 3UT9D 4QLCB 1U35B 2YFWB 3X1UD 3O62D 3AYWD 3AZLA 1KX5D 4Z2MH 5AV5A 4KGCC 4J8XA 1WWSA 3RELA 3TU4A 1HQ3B 3C1CD 1B6WA 4J8VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  3AZN C;  5B31 A;  5DNN D;  3C1B D;  3REJ D;  2YFV B;  3W96 B;  3X1S C;  5AY8 B;  2HUE C;  3AZJ D;  3AZF D;  1KX3 C;  5B33 C;  4H9Q A;  3UTA C;  4DRB A;  3MGS D;  1P3B D;  2NQB C;  3TU4 B;  4ZBJ C;  1P3I A;  3WKJ A;  5B24 C;  3WTP A;  5GT3 A;  5B0Y D;  4XUJ D;  4CSR A;  3REK B;  5AV9 A;  1KX4 C;  3AZK A;  4YM6 D;  1TZY A;  3AZL C;  5FUG A;  5AV5 C;  4J8X C;  3REL C;  4EO5 B;  1P3L D;  5GSU D;  1P3I B;  3WKJ B;  1ID3 D;  3WTP B;  5GT3 B;  5B31 C;  4WU8 D;  3KWQ B;  1P34 D;  3KUY A;  5AV9 B;  4Z66 A;  4WNN A;  4G92 B;  3AFA A;  1EQZ A;  4J8U D;  3MVD C;  5B40 B;  3MGR D;  5AV8 A;  1TZY B;  3V9R A;  1ULY A;  3A6N D;  3AZE D;  1P3K D;  1H3O A;  4QLC D;  1U35 D;  3AZI A;  5B32 A;  4KUD C;  5B0Z A;  3X1T B;  1BH8 A;  3AZG D;  1HQ3 D;  3KUY B;  4Z66 B;  3VH6 T;  5BT1 C;  3AZM A;  4WNN B;  3AV1 D;  1EQZ B;  3LEL A;  3W97 D;  2PYO A;  3AZK C;  4Z5T D;  1P3P A;  3V9R B;  4LD9 D;  3B0C T;  5CPK D;  1H3O B;  3MGQ C;  4CAY B;  5GT0 B;  5CPJ D;  3LZ0 A;  3KXB A;  3AZI B;  5B32 B;  3REH B;  3AZM B;  5B2I A;  3LEL B;  5AVC D;  2ARO A;  4Z2M G;  2PYO B;  3AFA C;  3MNN B;  1P3P B;  4G91 C;  1R4V A;  5AV8 C;  3NQU A;  5AVB D;  3X1V D;  3REK D;  4XZQ D;  3LZ0 B;  3KXB B;  5C3I C;  5B0Z C;  1P3F B;  1M18 D;  3X1U A;  5B2I B;  1F66 C;  2ARO B;  1M1A C;  3LEL C;  3B6F C;  5CP6 A;  1M19 A;  4J8W D;  3NQU B;  3KWQ D;  4YS3 A;  5BS7 A;  3WA9 C;  3C1B A;  5B40 D;  5B2J A;  5CPI B;  4KGC A;  4R8P D;  1P3M D;  2F8N A;  3MGP D;  5CP6 B;  3X1T D;  4H9P A;  4YS3 B;  5E5A C;  3AZN A;  3AV2 D;  5B2J B;  3X1S A;  1P3O D;  5GT0 D;  4WU9 A;  3B0D C;  3W98 D;  5B33 A;  4NE5 A;  4KGC B;  5BNV B;  3UTA A;  3X1U C;  3O62 C;  2NZD D;  3AYW C;  2NQB A;  1KX5 C;  5F99 D;  1M19 C;  4H9P B;  3REH D;  1BH9 A;  3AZN B;  3C1C C;  5AV6 A;  5B24 A;  5G49 B;  3X1S B;  3MNN D;  4H9N B;  5DNN C;  3C1B C;  1AOI D;  3REJ C;  2HIO A;  1KX4 A;  3LJA A;  1KX3 B;  5B33 B;  1BFM A;  2LY8 A;  3UTA B;  3AZF C;  1P3G D;  4AWL C;  2NQB B;  4E45 A;  3MGS C;  4ZBJ B;  1BH9 B;  1P3F D;  5GXQ D;  5B24 B;  3LZ1 A;  3VH6 W;  2CV5 A;  3B6G D;  5B0Y C;  1KX4 B;  5JRG D;  4JJN D;  3B0C W;  3MVD A;  4WU9 C;  3AZL B;  3AN2 D;  4NE3 A;  5B1M D;  5AV5 B;  4J8X B;  3REL B;  5BO0 A;  5CPI D;  3REI D;  1ZLA A;  1P3L C;  5GSU C;  5B31 B;  5AV6 C;  4KUD A;  2HIO C;  3MVD B;  3VH6 A;  4H9S A;  3LJA C;  4H9Q B;  4J8U C;  3MGR C;  5BO0 B;  3MGQ A;  5JA4 A;  5DNM D;  4HGA C;  3AZE C;  1ZLA B;  1B67 A;  1P3A A;  1KU5 A;  1N1J A;  4KUD B;  3LZ1 C;  2CV5 C;  4CSR B;  2RVQ D;  3B0B A;  3AZG C;  3AZK B;  3W97 C;  5FUG B;  3MGQ B;  4Z5T C;  5JA4 B;  3AZH D;  4LD9 C;  2FJ7 D;  5CPK C;  1KX3 D;  1ZLA C;  1N1J B;  5CPJ C;  3WAA A;  3AV1 B;  5KDM A;  1F66 A;  3UTB D;  1M1A A;  4J8V D;  4UUZ A;  3AFA B;  1S32 A;  3B6F A;  4G91 B;  4H9S C;  5AV8 B;  5AVC C;  4ZUX A;  1TAF A;  3W96 D;  5AY8 D;  3VH5 T;  5B1L A;  5AVB C;  3X1V C;  3WA9 A;  1P3A C;  4XZQ C;  5C3I B;  3W99 A;  3AZL D;  5B32 G;  2JSS A;  4J8X D;  4X23 A;  5KDM B;  5B0Z B;  3REL D;  1BH8 B;  3TU4 D;  1F66 B;  1M1A B;  4UUZ B;  3B6F B;  5B31 D;  4ZUX B;  1TAF B;  5E5A A;  1HTA A;  4J8W C;  3WA9 B;  3WTP E;  3WAA C;  3UT9 A;  2IO5 C;  1P3I D;  3WKJ D;  3O62 A;  3AYW A;  1KX5 A;  1S32 C;  1P3M C;  3WTP D;  5GT3 D;  4ZUX C;  5E5A B;  3C1C A;  5AV9 D;  5B1L C;  5DNN A;  3REJ A;  3W99 C;  1TZY D;  3AV2 C;  3B0D B;  4H9O A;  4X23 C;  1P3O C;  3AZJ A;  3AZF A;  3W98 C;  4NE6 A;  3X1U B;  3O62 B;  3AYW B;  1KX5 B;  3MGS A;  1P3B A;  1M19 B;  5F99 C;  3C1C B;  3KUY D;  4Z66 D;  1EQZ D;  3AFA D;  5DNN B;  3C1B B;  5AV8 D;  3REJ B;  5B0Y A;  4XUJ A;  4H9O B;  1AOI C;  3AZF B;  3R45 A;  4AWL B;  3UT9 C;  4YM6 A;  3AZI D;  2F8N B;  1P3G C;  3MGS B;  5B32 D;  5B0Z D;  1P3L A;  5GSU A;  1ID3 A;  3AZM D;  3LEL D;  2PYO D;  1P3P D;  5B0Y B;  4WU8 A;  1P34 A;  3B6G C;  4WU9 B;  5JRG C;  4JJN C;  3AZJ C;  4J8U A;  3LZ0 D;  3KXB D;  3MGR A;  3NQJ A;  5B1M C;  3A6N A;  3AZE A;  1P3K A;  1P3B C;  1P3L B;  5GSU B;  4QLC A;  1U35 A;  1ID3 B;  4WZS B;  5AV6 B;  5B2I D;  2ARO D;  2HIO B;  3AZG A;  1HQ3 A;  4XUJ C;  3LJA B;  3AV1 A;  4J8V A;  4J8U B;  3W97 A;  3VH5 W;  3MGR B;  3NQJ B;  4Z5T A;  4YM6 C;  4LD9 A;  4HGA B;  3W96 A;  3A6N B;  3AZE B;  5CPK A;  5DNM C;  5CPJ A;  1ID3 C;  2BYK A;  3LZ1 B;  5B31 G;  2CV5 B;  5CP6 D;  1M19 D;  4WV4 B;  3AZG B;  4YS3 D;  4WU8 C;  1P34 C;  5AVC A;  3W97 B;  4Z5T B;  5B2J D;  2BYM A;  4LD9 B;  5CPK B;  5AVB A;  3X1V A;  3AZH C;  3REK A;  3A6N C;  1P3K C;  3VH5 A;  4XZQ A;  2FJ7 C;  5CPJ B;  4KGC D;  4QLC C;  1U35 C;  2BYK B;  2F8N D;  1M18 A;  1HQ3 C;  4NFT A;  3AZN D;  3UTB C;  5AVC B;  3AV1 C;  4J8V C;  2F8N H;  2BYM B;  3X1S D;  2L5A A;  4J8W A;  5AVB B;  3KWQ A;  3X1V B;  3W96 C;  5AY8 C;  1P3A B;  4H9R A;  4XZQ B;  4WU9 D;  5B33 D;  3UTA D;  5B40 A;  2NQB D;  5BNX A;  3TU4 C;  1M18 B;  4R8P A;  5AV6 D;  5B24 D;  1P3M A;  3MGP A;  3X1T A;  4J8W B;  2HIO D;  1KX4 D;  3LJA D;  4H9R B;  3REK C;  3AV2 A;  5AV5 D;  3WAA B;  5BNX B;  1P3O A;  5CHL B;  2IO5 B;  4CAY A;  5GT0 A;  3W98 A;  4EO5 C;  1S32 B;  4R8P B;  1P3M B;  1P3I C;  1M18 C;  3WKJ C;  3LZ1 D;  2NZD A;  4KHA A;  3MGP B;  2CV5 D;  5F99 A;  3WTP C;  5GT3 C;  3REH A;  5B1L B;  3KWQ C;  3MVD D;  5AV9 C;  4G92 C;  3AV2 B;  3W99 B;  3MNN A;  5B40 C;  4X23 B;  1P3O B;  1AOI A;  1TZY C;  3W98 B;  1ZLA D;  1P3G A;  2NZD B;  4R8P C;  4KHA B;  4KUD D;  5F99 B;  3MGP C;  3X1T C;  5BT1 D;  1P3F A;  5GXQ A;  3KUY C;  2F8N K;  4Z66 C;  1JFI A;  4DRA A;  3AZK D;  1EQZ C;  1AOI B;  3B6G A;  3MGQ D;  1A7W A;  5JRG A;  4JJN A;  3UT9 B;  1P3A D;  5GT0 C;  1P3G B;  3AN2 A;  5B1M A;  3AZI C;  4E44 A;  2NZD C;  5CPI A;  5B32 C;  3REI A;  3REH C;  5GXQ B;  1JFI B;  3AZM C;  2PYO C;  3B6G B;  3MNN C;  1P3P C;  5JRG B;  4JJN B;  3AZJ B;  3UTB B;  3AN2 B;  5B1M B;  2F8N G;  3LZ0 C;  3KXB C;  1P3B B;  3WAA D;  5DNM A;  3REI B;  1F66 D;  4M6B A;  1M1A D;  5BNV A;  1S32 D;  1P3F C;  5GXQ C;  3B6F D;  5B2I C;  2ARO C;  4ZUX D;  4XUJ B;  5B1L D;  3R45 B;  3WA9 D;  4YM6 B;  3W99 D;  5G49 A;  3AN2 C;  4H9N A;  3AZH A;  1Q9C A;  4X23 D;  5DNM B;  2FJ7 A;  5CPI C;  1KX3 A;  3REI C;  1WWI A;  2YFW A;  2CWE A;  1F1E A;  3KSY A;  4WU8 B;  1P34 B;  5CP6 C;  5E5A D;  3UTB A;  4YS3 C;  5BS7 C;  2YFV A;  5B2J C;  3AZH B;  2HUE B;  1P3K B;  5AY8 A;  2FJ7 B;  3UT9 D;  4QLC B;  1U35 B;  2YFW B;  3X1U D;  3O62 D;  3AYW D;  3AZL A;  1KX5 D;  4Z2M H;  5AV5 A;  4KGC C;  4J8X A;  1WWS A;  3REL A;  3TU4 A;  1HQ3 B;  3C1C D;  1B6W A;  4J8V B; 
#chains in the Genus database with same CATH topology
 2RVQ C;  2Y2L A;  3AZN C;  5B31 A;  2ZY5 A;  5DNN D;  3C1B D;  3REJ D;  2YFV B;  3W96 B;  3X1S C;  5AY8 B;  3A1I A;  2HUE C;  3AZJ D;  3AZF D;  1KX3 C;  5B33 C;  4H9Q A;  3UTA C;  4DRB A;  3MGS D;  1P3B D;  1PZR A;  2NQB C;  3TU4 B;  2ZY2 A;  4ZBJ C;  1P3I A;  2RIQ A;  3WKJ A;  5B24 C;  3WTP A;  5GT3 A;  5B0Y D;  4XUJ D;  4CSR A;  3REK B;  5AV9 A;  1KX4 C;  3AZK A;  4YM6 D;  2FFF B;  1TZY A;  3AZL C;  5FUG A;  5AV5 C;  2VQR A;  4J8X C;  3REL C;  4EO5 B;  1P3L D;  5GSU D;  1P3I B;  3WKJ B;  1ID3 D;  2Y2N A;  3KFU G;  3WTP B;  5GT3 B;  5B31 C;  4WU8 D;  3KWQ B;  1P34 D;  3KUY A;  5AV9 B;  4Z66 A;  4WNN A;  4G92 B;  3AFA A;  1EQZ A;  4J8U D;  3MVD C;  3EG5 B;  5B40 B;  5AV8 A;  3MGR D;  1TZY B;  3V9R A;  1ULY A;  3A6N D;  3AZE D;  1P3K D;  1H3O A;  4QLC D;  1U35 D;  3AZI A;  5B32 A;  4KUD C;  5B0Z A;  3X1T B;  1BH8 A;  3AZG D;  1HQ3 D;  3KUY B;  4Z66 B;  3VH6 T;  5BT1 C;  3AZM A;  4WNN B;  3AV1 D;  1EQZ B;  3LEL A;  3W97 D;  2PYO A;  3AZK C;  4Z5T D;  2BG1 A;  3V9R B;  1P3P A;  4LD9 D;  3B0C T;  5CPK D;  1H3O B;  3MGQ C;  4CAY B;  5GT0 B;  5CPJ D;  3LZ0 A;  3KXB A;  3AZI B;  5B32 B;  3REH B;  3AZM B;  5B2I A;  3LEL B;  5AVC D;  2ARO A;  4Z2M G;  3EPK A;  3AFA C;  2PYO B;  3MNN B;  1P3P B;  4G91 C;  2DF4 C;  1R4V A;  5AV8 C;  3NQU A;  5AVB D;  3X1V D;  3REK D;  4XZQ D;  3LZ0 B;  3KXB B;  5C3I C;  5B0Z C;  1P3F B;  1M18 D;  3X1U A;  5B2I B;  1F66 C;  2ARO B;  1M1A C;  3LEL C;  3B6F C;  5CP6 A;  1M19 A;  4J8W D;  3NQU B;  3KWQ D;  4YS3 A;  5BS7 A;  3WA9 C;  3C1B A;  2G5I C;  5B40 D;  5B2J A;  5CPI B;  4KGC A;  4R8P D;  1P3M D;  2F8N A;  1W2E A;  3MGP D;  5CP6 B;  3X1T D;  4H9P A;  4YS3 B;  5E5A C;  3AZN A;  3AV2 D;  5B2J B;  3X1S A;  1P3O D;  5GT0 D;  4WU9 A;  3B0D C;  3W98 D;  3P5J B;  4NE5 A;  5B33 A;  4KGC B;  5BNV B;  3UTA A;  3X1U C;  2Y2I A;  3O62 C;  3AYW C;  2NQB A;  1KX5 C;  2NZD D;  5F99 D;  1M19 C;  4H9P B;  3REH D;  1BH9 A;  3AZN B;  3C1C C;  5AV6 A;  5B24 A;  5G49 B;  3X1S B;  3MNN D;  4H9N B;  5DNN C;  3C1B C;  1AOI D;  3REJ C;  2HIO A;  1KX4 A;  3LJA A;  1KX3 B;  5B33 B;  1BFM A;  2LY8 A;  3UTA B;  2Y2K A;  3AZF C;  1P3G D;  4AWL C;  2W8S A;  2NQB B;  4E45 A;  3MGS C;  4ZBJ B;  1BH9 B;  1P3F D;  5GXQ D;  2Y2P A;  5B24 B;  3LZ1 A;  3VH6 W;  2CV5 A;  3B6G D;  5B0Y C;  1KX4 B;  5JRG D;  2Y2G A;  4JJN D;  3B0C W;  3MVD A;  4WU9 C;  3AZL B;  3AN2 D;  4NE3 A;  5B1M D;  5AV5 B;  4J8X B;  3REL B;  5BO0 A;  5CPI D;  3REI D;  1ZLA A;  1P3L C;  5GSU C;  5B31 B;  5AV6 C;  4KUD A;  3EPL A;  1Z2C B;  2HIO C;  3MVD B;  3VH6 A;  4H9S A;  3LJA C;  4H9Q B;  4J8U C;  3MGR C;  5BO0 B;  3MGQ A;  5JA4 A;  5DNM D;  4HGA C;  3AZE C;  1ZLA B;  1B67 A;  1P3A A;  1KU5 A;  1N1J A;  4KUD B;  3F6T A;  3LZ1 C;  2CV5 C;  4CSR B;  2JCH A;  2RVQ D;  3B0B A;  3AZG C;  3AZK B;  3W97 C;  5FUG B;  3MGQ B;  4Z5T C;  5JA4 B;  3AZH D;  4LD9 C;  2FJ7 D;  5CPK C;  1KX3 D;  1ZLA C;  1N1J B;  5CPJ C;  3WAA A;  3AV1 B;  5KDM A;  1F66 A;  3UTB D;  1M1A A;  4J8V D;  4UUZ A;  3AFA B;  1S32 A;  3B6F A;  4G91 B;  4H9S C;  5AV8 B;  5AVC C;  4ZUX A;  1TAF A;  3W96 D;  5AY8 D;  3VH5 T;  2Y2H A;  5B1L A;  5AVB C;  3X1V C;  3WA9 A;  1P3A C;  4XZQ C;  5C3I B;  3W99 A;  3AZL D;  5B32 G;  2JSS A;  4J8X D;  4X23 A;  5KDM B;  5B0Z B;  3REL D;  1BH8 B;  3TU4 D;  1F66 B;  1M1A B;  4UUZ B;  3B6F B;  5B31 D;  4ZUX B;  1TAF B;  5E5A A;  1HTA A;  4J8W C;  2ZY4 A;  3WA9 B;  3WTP E;  3WAA C;  3UT9 A;  2IO5 C;  1P3I D;  3WKJ D;  3O62 A;  3AYW A;  1KX5 A;  1S32 C;  1P3M C;  3WTP D;  5GT3 D;  3A1K A;  4ZUX C;  5E5A B;  2ZM5 A;  3C1C A;  5AV9 D;  2DQN C;  5B1L C;  5DNN A;  3REJ A;  4UPK A;  1TZY D;  3W99 C;  3AV2 C;  3B0D B;  4H9O A;  4X23 C;  1P3O C;  3AZJ A;  3AZF A;  3W98 C;  4NE6 A;  3X1U B;  3O62 B;  3AYW B;  1KX5 B;  3MGS A;  1P3B A;  1M19 B;  5F99 C;  3C1C B;  3KUY D;  4Z66 D;  1EQZ D;  3AFA D;  5DNN B;  3C1B B;  5AV8 D;  3REJ B;  5B0Y A;  4XUJ A;  4H9O B;  1AOI C;  3AZF B;  3R45 A;  2G5H C;  4AWL B;  3UT9 C;  4YM6 A;  3AZI D;  2F8N B;  1P3G C;  3MGS B;  5B32 D;  5B0Z D;  1P3L A;  5GSU A;  1ID3 A;  3AZM D;  3LEL D;  2PYO D;  1P3P D;  5B0Y B;  4WU8 A;  1P34 A;  3B6G C;  4WU9 B;  5JRG C;  4JJN C;  3AZJ C;  4J8U A;  2J8P A;  3LZ0 D;  3KXB D;  3MGR A;  3NQJ A;  5B1M C;  3A6N A;  3AZE A;  1P3K A;  1P3B C;  1P3L B;  5GSU B;  4QLC A;  1U35 A;  1ID3 B;  4WZS B;  5AV6 B;  2XD1 A;  5B2I D;  2ARO D;  2HIO B;  3AZG A;  1HQ3 A;  4XUJ C;  3LJA B;  3AV1 A;  4J8V A;  4J8U B;  3W97 A;  3VH5 W;  3MGR B;  3NQJ B;  4Z5T A;  4YM6 C;  4LD9 A;  4HGA B;  3W96 A;  3A6N B;  3AZE B;  5CPK A;  5DNM C;  5CPJ A;  2XD5 A;  1ID3 C;  2BYK A;  3LZ1 B;  5B31 G;  2CV5 B;  5CP6 D;  3EPJ A;  1M19 D;  4WV4 B;  3AZG B;  4YS3 D;  4WU8 C;  1P34 C;  5AVC A;  3W97 B;  4Z5T B;  5B2J D;  2BYM A;  4LD9 B;  5CPK B;  5AVB A;  3X1V A;  3AZH C;  3REK A;  3A6N C;  1P3K C;  3IP4 C;  3VH5 A;  4XZQ A;  2FJ7 C;  5CPJ B;  4KGC D;  4QLC C;  1U35 C;  2F2A C;  2BYK B;  4WJ3 C;  2F8N D;  1T3U A;  1M18 A;  1HQ3 C;  4NFT A;  3AZN D;  3UTB C;  5AVC B;  3AV1 C;  4J8V C;  2F8N H;  2BYM B;  3X1S D;  2L5A A;  4J8W A;  5AVB B;  3KWQ A;  3X1V B;  2Y2J A;  3W96 C;  5AY8 C;  1P3A B;  4H9R A;  4XZQ B;  4WU9 D;  5B33 D;  3UTA D;  5B40 A;  2NQB D;  5BNX A;  3TU4 C;  1M18 B;  4R8P A;  5AV6 D;  5B24 D;  1P3M A;  3MGP A;  2ZY3 A;  3X1T A;  4J8W B;  2HIO D;  1KX4 D;  3LJA D;  4H9R B;  3REK C;  3AV2 A;  5AV5 D;  3WAA B;  5BNX B;  1P3O A;  5CHL B;  2IO5 B;  3AL0 C;  4CAY A;  5GT0 A;  3W98 A;  4EO5 C;  1S32 B;  4R8P B;  1P3M B;  1P3I C;  1M18 C;  3WKJ C;  3LZ1 D;  2NZD A;  4KHA A;  3MGP B;  2CV5 D;  5F99 A;  3WTP C;  5GT3 C;  3REH A;  5B1L B;  3KWQ C;  3MVD D;  5AV9 C;  2JE5 A;  4G92 C;  3AV2 B;  3W99 B;  3MNN A;  5B40 C;  4X23 B;  1P3O B;  1AOI A;  1TZY C;  2Y2M A;  2Y2O A;  3W98 B;  1ZLA D;  1P3G A;  2NZD B;  4R8P C;  4KHA B;  4KUD D;  3EPH A;  5F99 B;  3MGP C;  3X1T C;  5BT1 D;  1P3F A;  5GXQ A;  3KUY C;  2F8N K;  4Z66 C;  1JFI A;  4DRA A;  3AZK D;  1EQZ C;  1AOI B;  3B6G A;  3MGQ D;  1A7W A;  5JRG A;  4JJN A;  3UT9 B;  1P3A D;  5GT0 C;  1P3G B;  3AN2 A;  5B1M A;  4DQY B;  2Y2Q A;  3AZI C;  3FDD A;  4E44 A;  2NZD C;  5CPI A;  5B32 C;  3REI A;  3REH C;  5GXQ B;  1JFI B;  3AZM C;  2PYO C;  3B6G B;  3MNN C;  1P3P C;  5JRG B;  4JJN B;  3AZJ B;  3UTB B;  3AN2 B;  3H0L C;  5B1M B;  2F8N G;  3LZ0 C;  3KXB C;  1P3B B;  3WAA D;  5DNM A;  3REI B;  1F66 D;  4M6B A;  1M1A D;  5BNV A;  1S32 D;  1P3F C;  5GXQ C;  3B6F D;  5B2I C;  2ARO C;  4ZUX D;  4XUJ B;  5B1L D;  3R45 B;  3WA9 D;  4YM6 B;  3W99 D;  5G49 A;  3AN2 C;  4H9N A;  3AZH A;  1Q9C A;  4X23 D;  5DNM B;  2FJ7 A;  5CPI C;  1KX3 A;  3REI C;  1WWI A;  2YFW A;  3H0R C;  2CWE A;  1F1E A;  3KSY A;  4WU8 B;  1P34 B;  5CP6 C;  5E5A D;  3UTB A;  4YS3 C;  5BS7 C;  2UWX A;  2YFV A;  5B2J C;  3AZH B;  2HUE B;  1P3K B;  5AY8 A;  2FJ7 B;  3H0M C;  3UT9 D;  4QLC B;  1U35 B;  2YFW B;  3X1U D;  3O62 D;  3AYW D;  3AZL A;  1KX5 D;  4Z2M H;  5AV5 A;  4KGC C;  4J8X A;  1WWS A;  3REL A;  3TU4 A;  1HQ3 B;  3C1C D;  1B6W A;  4J8V B; 
#chains in the Genus database with same CATH homology
 2RVQ C;  2Y2L A;  3AZN C;  5B31 A;  2ZY5 A;  5DNN D;  3C1B D;  3REJ D;  2YFV B;  3W96 B;  3X1S C;  5AY8 B;  3A1I A;  2HUE C;  3AZJ D;  3AZF D;  1KX3 C;  5B33 C;  4H9Q A;  3UTA C;  4DRB A;  3MGS D;  1P3B D;  1PZR A;  2NQB C;  3TU4 B;  2ZY2 A;  4ZBJ C;  1P3I A;  2RIQ A;  3WKJ A;  5B24 C;  3WTP A;  5GT3 A;  5B0Y D;  4XUJ D;  4CSR A;  3REK B;  5AV9 A;  1KX4 C;  3AZK A;  4YM6 D;  2FFF B;  1TZY A;  3AZL C;  5FUG A;  5AV5 C;  2VQR A;  4J8X C;  3REL C;  4EO5 B;  1P3L D;  5GSU D;  1P3I B;  3WKJ B;  1ID3 D;  2Y2N A;  3KFU G;  3WTP B;  5GT3 B;  5B31 C;  4WU8 D;  3KWQ B;  1P34 D;  3KUY A;  5AV9 B;  4Z66 A;  4WNN A;  4G92 B;  3AFA A;  1EQZ A;  4J8U D;  3MVD C;  3EG5 B;  5B40 B;  5AV8 A;  3MGR D;  1TZY B;  3V9R A;  1ULY A;  3A6N D;  3AZE D;  1P3K D;  1H3O A;  4QLC D;  1U35 D;  3AZI A;  5B32 A;  4KUD C;  5B0Z A;  3X1T B;  1BH8 A;  3AZG D;  1HQ3 D;  3KUY B;  4Z66 B;  3VH6 T;  5BT1 C;  3AZM A;  4WNN B;  3AV1 D;  1EQZ B;  3LEL A;  3W97 D;  2PYO A;  3AZK C;  4Z5T D;  2BG1 A;  3V9R B;  1P3P A;  4LD9 D;  3B0C T;  5CPK D;  1H3O B;  3MGQ C;  4CAY B;  5GT0 B;  5CPJ D;  3LZ0 A;  3KXB A;  3AZI B;  5B32 B;  3REH B;  3AZM B;  5B2I A;  3LEL B;  5AVC D;  2ARO A;  4Z2M G;  3EPK A;  3AFA C;  2PYO B;  3MNN B;  1P3P B;  4G91 C;  2DF4 C;  1R4V A;  5AV8 C;  3NQU A;  5AVB D;  3X1V D;  3REK D;  4XZQ D;  3LZ0 B;  3KXB B;  5C3I C;  5B0Z C;  1P3F B;  1M18 D;  3X1U A;  5B2I B;  1F66 C;  2ARO B;  1M1A C;  3LEL C;  3B6F C;  5CP6 A;  1M19 A;  4J8W D;  3NQU B;  3KWQ D;  4YS3 A;  5BS7 A;  3WA9 C;  3C1B A;  2G5I C;  5B40 D;  5B2J A;  5CPI B;  4KGC A;  4R8P D;  1P3M D;  2F8N A;  1W2E A;  3MGP D;  5CP6 B;  3X1T D;  4H9P A;  4YS3 B;  5E5A C;  3AZN A;  3AV2 D;  5B2J B;  3X1S A;  1P3O D;  5GT0 D;  4WU9 A;  3B0D C;  3W98 D;  3P5J B;  4NE5 A;  5B33 A;  4KGC B;  5BNV B;  3UTA A;  3X1U C;  2Y2I A;  3O62 C;  3AYW C;  2NQB A;  1KX5 C;  2NZD D;  5F99 D;  1M19 C;  4H9P B;  3REH D;  1BH9 A;  3AZN B;  3C1C C;  5AV6 A;  5B24 A;  5G49 B;  3X1S B;  3MNN D;  4H9N B;  5DNN C;  3C1B C;  1AOI D;  3REJ C;  2HIO A;  1KX4 A;  3LJA A;  1KX3 B;  5B33 B;  1BFM A;  2LY8 A;  3UTA B;  2Y2K A;  3AZF C;  1P3G D;  4AWL C;  2W8S A;  2NQB B;  4E45 A;  3MGS C;  4ZBJ B;  1BH9 B;  1P3F D;  5GXQ D;  2Y2P A;  5B24 B;  3LZ1 A;  3VH6 W;  2CV5 A;  3B6G D;  5B0Y C;  1KX4 B;  5JRG D;  2Y2G A;  4JJN D;  3B0C W;  3MVD A;  4WU9 C;  3AZL B;  3AN2 D;  4NE3 A;  5B1M D;  5AV5 B;  4J8X B;  3REL B;  5BO0 A;  5CPI D;  3REI D;  1ZLA A;  1P3L C;  5GSU C;  5B31 B;  5AV6 C;  4KUD A;  3EPL A;  1Z2C B;  2HIO C;  3MVD B;  3VH6 A;  4H9S A;  3LJA C;  4H9Q B;  4J8U C;  3MGR C;  5BO0 B;  3MGQ A;  5JA4 A;  5DNM D;  4HGA C;  3AZE C;  1ZLA B;  1B67 A;  1P3A A;  1KU5 A;  1N1J A;  4KUD B;  3F6T A;  3LZ1 C;  2CV5 C;  4CSR B;  2JCH A;  2RVQ D;  3B0B A;  3AZG C;  3AZK B;  3W97 C;  5FUG B;  3MGQ B;  4Z5T C;  5JA4 B;  3AZH D;  4LD9 C;  2FJ7 D;  5CPK C;  1KX3 D;  1ZLA C;  1N1J B;  5CPJ C;  3WAA A;  3AV1 B;  5KDM A;  1F66 A;  3UTB D;  1M1A A;  4J8V D;  4UUZ A;  3AFA B;  1S32 A;  3B6F A;  4G91 B;  4H9S C;  5AV8 B;  5AVC C;  4ZUX A;  1TAF A;  3W96 D;  5AY8 D;  3VH5 T;  2Y2H A;  5B1L A;  5AVB C;  3X1V C;  3WA9 A;  1P3A C;  4XZQ C;  5C3I B;  3W99 A;  3AZL D;  5B32 G;  2JSS A;  4J8X D;  4X23 A;  5KDM B;  5B0Z B;  3REL D;  1BH8 B;  3TU4 D;  1F66 B;  1M1A B;  4UUZ B;  3B6F B;  5B31 D;  4ZUX B;  1TAF B;  5E5A A;  1HTA A;  4J8W C;  2ZY4 A;  3WA9 B;  3WTP E;  3WAA C;  3UT9 A;  2IO5 C;  1P3I D;  3WKJ D;  3O62 A;  3AYW A;  1KX5 A;  1S32 C;  1P3M C;  3WTP D;  5GT3 D;  3A1K A;  4ZUX C;  5E5A B;  2ZM5 A;  3C1C A;  5AV9 D;  2DQN C;  5B1L C;  5DNN A;  3REJ A;  4UPK A;  1TZY D;  3W99 C;  3AV2 C;  3B0D B;  4H9O A;  4X23 C;  1P3O C;  3AZJ A;  3AZF A;  3W98 C;  4NE6 A;  3X1U B;  3O62 B;  3AYW B;  1KX5 B;  3MGS A;  1P3B A;  1M19 B;  5F99 C;  3C1C B;  3KUY D;  4Z66 D;  1EQZ D;  3AFA D;  5DNN B;  3C1B B;  5AV8 D;  3REJ B;  5B0Y A;  4XUJ A;  4H9O B;  1AOI C;  3AZF B;  3R45 A;  2G5H C;  4AWL B;  3UT9 C;  4YM6 A;  3AZI D;  2F8N B;  1P3G C;  3MGS B;  5B32 D;  5B0Z D;  1P3L A;  5GSU A;  1ID3 A;  3AZM D;  3LEL D;  2PYO D;  1P3P D;  5B0Y B;  4WU8 A;  1P34 A;  3B6G C;  4WU9 B;  5JRG C;  4JJN C;  3AZJ C;  4J8U A;  2J8P A;  3LZ0 D;  3KXB D;  3MGR A;  3NQJ A;  5B1M C;  3A6N A;  3AZE A;  1P3K A;  1P3B C;  1P3L B;  5GSU B;  4QLC A;  1U35 A;  1ID3 B;  4WZS B;  5AV6 B;  2XD1 A;  5B2I D;  2ARO D;  2HIO B;  3AZG A;  1HQ3 A;  4XUJ C;  3LJA B;  3AV1 A;  4J8V A;  4J8U B;  3W97 A;  3VH5 W;  3MGR B;  3NQJ B;  4Z5T A;  4YM6 C;  4LD9 A;  4HGA B;  3W96 A;  3A6N B;  3AZE B;  5CPK A;  5DNM C;  5CPJ A;  2XD5 A;  1ID3 C;  2BYK A;  3LZ1 B;  5B31 G;  2CV5 B;  5CP6 D;  3EPJ A;  1M19 D;  4WV4 B;  3AZG B;  4YS3 D;  4WU8 C;  1P34 C;  5AVC A;  3W97 B;  4Z5T B;  5B2J D;  2BYM A;  4LD9 B;  5CPK B;  5AVB A;  3X1V A;  3AZH C;  3REK A;  3A6N C;  1P3K C;  3IP4 C;  3VH5 A;  4XZQ A;  2FJ7 C;  5CPJ B;  4KGC D;  4QLC C;  1U35 C;  2F2A C;  2BYK B;  4WJ3 C;  2F8N D;  1T3U A;  1M18 A;  1HQ3 C;  4NFT A;  3AZN D;  3UTB C;  5AVC B;  3AV1 C;  4J8V C;  2F8N H;  2BYM B;  3X1S D;  2L5A A;  4J8W A;  5AVB B;  3KWQ A;  3X1V B;  2Y2J A;  3W96 C;  5AY8 C;  1P3A B;  4H9R A;  4XZQ B;  4WU9 D;  5B33 D;  3UTA D;  5B40 A;  2NQB D;  5BNX A;  3TU4 C;  1M18 B;  4R8P A;  5AV6 D;  5B24 D;  1P3M A;  3MGP A;  2ZY3 A;  3X1T A;  4J8W B;  2HIO D;  1KX4 D;  3LJA D;  4H9R B;  3REK C;  3AV2 A;  5AV5 D;  3WAA B;  5BNX B;  1P3O A;  5CHL B;  2IO5 B;  3AL0 C;  4CAY A;  5GT0 A;  3W98 A;  4EO5 C;  1S32 B;  4R8P B;  1P3M B;  1P3I C;  1M18 C;  3WKJ C;  3LZ1 D;  2NZD A;  4KHA A;  3MGP B;  2CV5 D;  5F99 A;  3WTP C;  5GT3 C;  3REH A;  5B1L B;  3KWQ C;  3MVD D;  5AV9 C;  2JE5 A;  4G92 C;  3AV2 B;  3W99 B;  3MNN A;  5B40 C;  4X23 B;  1P3O B;  1AOI A;  1TZY C;  2Y2M A;  2Y2O A;  3W98 B;  1ZLA D;  1P3G A;  2NZD B;  4R8P C;  4KHA B;  4KUD D;  3EPH A;  5F99 B;  3MGP C;  3X1T C;  5BT1 D;  1P3F A;  5GXQ A;  3KUY C;  2F8N K;  4Z66 C;  1JFI A;  4DRA A;  3AZK D;  1EQZ C;  1AOI B;  3B6G A;  3MGQ D;  1A7W A;  5JRG A;  4JJN A;  3UT9 B;  1P3A D;  5GT0 C;  1P3G B;  3AN2 A;  5B1M A;  4DQY B;  2Y2Q A;  3AZI C;  3FDD A;  4E44 A;  2NZD C;  5CPI A;  5B32 C;  3REI A;  3REH C;  5GXQ B;  1JFI B;  3AZM C;  2PYO C;  3B6G B;  3MNN C;  1P3P C;  5JRG B;  4JJN B;  3AZJ B;  3UTB B;  3AN2 B;  3H0L C;  5B1M B;  2F8N G;  3LZ0 C;  3KXB C;  1P3B B;  3WAA D;  5DNM A;  3REI B;  1F66 D;  4M6B A;  1M1A D;  5BNV A;  1S32 D;  1P3F C;  5GXQ C;  3B6F D;  5B2I C;  2ARO C;  4ZUX D;  4XUJ B;  5B1L D;  3R45 B;  3WA9 D;  4YM6 B;  3W99 D;  5G49 A;  3AN2 C;  4H9N A;  3AZH A;  1Q9C A;  4X23 D;  5DNM B;  2FJ7 A;  5CPI C;  1KX3 A;  3REI C;  1WWI A;  2YFW A;  3H0R C;  2CWE A;  1F1E A;  3KSY A;  4WU8 B;  1P34 B;  5CP6 C;  5E5A D;  3UTB A;  4YS3 C;  5BS7 C;  2UWX A;  2YFV A;  5B2J C;  3AZH B;  2HUE B;  1P3K B;  5AY8 A;  2FJ7 B;  3H0M C;  3UT9 D;  4QLC B;  1U35 B;  2YFW B;  3X1U D;  3O62 D;  3AYW D;  3AZL A;  1KX5 D;  4Z2M H;  5AV5 A;  4KGC C;  4J8X A;  1WWS A;  3REL A;  3TU4 A;  1HQ3 B;  3C1C D;  1B6W A;  4J8V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...