5B1LD

The mouse nucleosome structure containing h3t
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'GRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lD00
5F99D 5AV5D 4Z5TB 2HIOD 3X1UC 4J8WD 3AZEB 3UTAB 2CV5D 1ZLAB 1P3KB 4H9NB 3VH6T 3AV1A 4KHAA 1BH8B 5B0YD 3AZGB 3AV1C 4LD9C 1WWSA 5AV6B 1P3LB 1P3PC 3MVDD 4H9SA 3AN2D 4NFTA 4G92B 1HQ3B 4QLCB 3AZJC 3W98C 1P3IA 3AZHA 3X1TA 5GSUB 5G49B 3REJA 4YS3A 3C1BA 4H9QA 3REJC 3C1BC 4XUJA 5AVBC 4H9PB 1P3MA 3REHC 1JFIA 1TZYB 3KWQD 1P3MC 2NQBA 1AOIB 1Q9CA 4Z5TA 3W96A 1P3FB 3LZ0A 1P3KA 1S32B 1ZLAA 4Z5TC 3AZEC 3AV2A 4H9NA 3B6FB 4WU9D 3UTAC 1ZLAC 1P3KC 3B6GD 5DNMB 3AZGA 5GXQB 3W99D 4R8PB 3AZGC 1P3LA 4UUZA 5AV6C 1P3LC 3X1SD 1HQ3A 4QLCA 5CPID 4CAYB 5B40B 4G92C 5GSUA 1HQ3C 4QLCC 1P3GB 4JJNA 3AZFD 2NZDD 4H9PA 1P34B 3REID 5GT0A 3AZIA 4WZSB 3X1VD 1M1AD 1TZYC 3MGSB 1AOIA 3VH6A 3LELB 1AOIC 1S32A 1M18D 5B33D 1P3FC 4XZQB 1S32C 3B6FC 5AV8A 5GXQA 5DNMC 1KX4B 4R8PA 5GXQC 3AZMB 4R8PC 4AWLB 3TU4D 5DNNA 3WAAD 5AY8A 1TAFB 3REKB 5CP6D 3W97D 5B1MB 5B40A 3MGRD 5B40C 1P3GA 5B24B 1P34A 1P3GC 4Z66A 3WKJD 5GT3B 5B2ID 1P34C 3AZLB 4YM6A 2F8NG 3MGSA 5B32B 1ID3D 1BH9B 3LELA 5CPJA 3WA9D 4NE6A 4Z2MH 4HGAB 4KGCD 2AROA 3LELC 3MGPB 1U35B 3NQUB 4XZQA 4J8UB 2PYOA 4J8XB 1P3AB 5C3IB 4XZQC 5BNVB 1KX5B 1M19B 1KX4C 3AV1D 3AZMC 5AVCB 4AWLC 5B1MA 5AV9B 1F66B 3REKC 5B1MC 4ZBJB 1P3ID 4NE5A 5B24C 3X1TD 3A6NB 3AZHD 3REJD 4YS3D 3C1BD 3MGQB 3AZLA 3KXBA 5GT3C 3KUYB 5B0ZB 3AZLC 3V9RB 4XUJD 3RELD 1P3MD 3WTPB 2F8NB 5B32C 3MGPA 1P3BB 4CSRB 3NQUA 3X1UA 4HGAC 3MGPC 2NQBD 1U35C 4J8XA 1P3AA 4J8UC 4Z5TD 5BNVA 1KX5A 3W96D 5JA4B 3LZ0D 4J8XC 1P3AC 1P3KD 5C3IC 1ZLAD 3AV2D 1KX5C 4LD9A 1M19C 3AZGD 5CHLB 5AVCA 4KUDB 1N1JA 1P3PA 5AVCC 5B2JB 1P3LD 5E5AB 1F66A 3AZJA 5AV9C 3W98A 1F66C 1B6WA 1HQ3D 4QLCD 4ZBJC 5GSUD 5F99B 5AVBA 3A6NC 4NE3A 3KUYA 3REHA 2HIOB 4JJND 4H9RB 3V9RA 3MGQC 3MNNB 3WTPA 3KUYC 2F8NA 5B0ZC 2YFWA 5BS7A 5GT0D 3WTPC 3AZID 5B0YB 5BS7C 1P3BC 3KSYA 3AZEA 3AZKB 3UTAA 5JA4A 1BH8A 3AZNB 5AV8D 5GXQD 5B31G 4R8PD 3C1CB 5AV6A 4KUDC 5B2JA 5E5AA 4DRAA 1P3OB 5DNND 5B2JC 5E5AC 2L5AA 5AY8D 5B1LB 5B40D 3UT9B 5G49A 2BYMB 1KU5A 1P3GD 3B0CT 5F99C 5BT1C 5BO0B 3MNNA 1P34D 2F8NK 2HIOC 4Z66D 4WU9B 5B32G 1TZYA 3MNNC 3AYWD 4YM6D 3MGSD 5B0YC 5CPJD 3LELD 3AZKA 1P3FA 2AROD 3B6FA 3AZKC 4XZQD 5DNMA 2PYOD 3AZNA 3AZNC 3C1CA 3UTBD 1KX3B 2YFVB 5B31B 3C1CC 1P3OA 3R45B 1P3OC 4WU8B 5B1LA 3REIB 4CAYA 5B1MD 3X1VB 3UT9A 5B1LC 3UT9C 1H3OB 5BO0A 1M18B 5B33B 5JRGB 3AZLD 3KXBD 4WU9C 2RVQD 3AFAB 3LJAB 3NQJB 2F8NH 3O62B 3MGPD 5FUGB 3X1UD 3WAAB 1EQZB 4J8XD 1P3AD 1KX4A 1KX5D 1HTAA 3MGRB 5CPIC 4ZUXB 3AZMA 1KX3A 4LD9D 2YFVA 4H9OB 5B31A 4X23B 1KX3C 5B31C 3R45A 3WKJB 4WU8A 1TAFA 1P3PD 3REKA 3VH5W 4G91B 4EO5B 4WU8C 1F66D 3REIC 3AZJD 3X1VC 1ID3B 3WA9B 3W98D 5B24A 5GT3A 3LZ1B 5JRGA 3VH5T 5AVBD 1M18C 5B33C 3REHD 3KUYD 5B32A 5JRGC 1BH9A 3AFAA 3WTPD 2F8ND 3LJAA 3NQJA 5KDMB 3O62A 3AFAC 1U35A 4KHAB 5FUGA 3LJAC 4J8UA 3O62C 1EQZA 2FJ7B 3AZED 3WAAC 3UTAD 1EQZC 4ZUXA 1M19A 4H9OA 3MGRC 4ZUXC 4X23A 5CPKB 1P3IB 4X23C 3AZHB 5AV6D 4YS3B 5B2JD 5AV9A 3WKJC 5E5AD 5B2IC 4G91C 4EO5C 4XUJB 3RELB 1ID3C 3WA9C 5BNXB 4J8VB 3A6NA 3LZ1A 2NQBB 3MGQA 2CWEA 5BT1D 5AV5B 3LZ1C 4J8WB 5B0ZA 3W96B 2CV5B 3MNND 2HUEB 3LZ0B 3AV2B 5KDMA 1P3BA 4CSRA 1TZYD 1AOID 2FJ7A 2IO5B 3AZKD 1P3FD 2FJ7C 1S32D 4UUZB 2LY8A 3B6FD 3MVDB 5DNMD 3AZND 3AN2B 5CPKA 4KUDA 4H9SC 3C1CD 5CPKC 1P3IC 3AZHC 3X1TC 3B0CW 1ULYA 4JJNB 4YS3C 1P3OD 3RELA 3VH5A 4XUJC 5B1LD 3B0DB 5BNXA 5GT0B 3KWQB 4J8VA 3RELC 3AZIB 3UT9D 4M6BA 5F99A 4J8VC 5AV5A 2HIOA 4J8WA 4H9RA 2NQBC 2CV5A 5AV5C 4J8WC 1BFMA 3W96C 2CV5C 3LZ0C 2HUEC 3B0BA 3B6GB 5B0YA 3AV2C 5AV8B 3W99B 4E45A 2IO5C 3MVDA 5DNNB 3X1SB 3MVDC 5AY8B 3AN2A 5CPIB 1KX4D 3AN2C 3AZMD 1KX3D 5B31D 5GSUC 3AZFB 2NZDB 4JJNC 4Z66B 4WU8D 3AYWB 3KWQA 3REKD 4YM6B 3B0DC 2BYMA 5GT0C 3KWQC 3AZIC 1M1AB 5CPJB 5B24D 2AROB 2BYKB 4WU9A 5GT3D 3B6GA 5JRGD 2PYOB 3W99A 5B32D 3B6GC 3AFAD 4WV4B 1A7WA 5AV8C 3W99C 3UTBB 3LJAD 3O62D 1U35D 3TU4B 4J8UD 3X1SA 1EQZD 5DNNC 5CPIA 3W97B 5CP6B 3X1SC 5AY8C 4ZUXD 1M19D 2JSSA 3AZFA 2NZDA 4X23D 5AVCD 3WTPE 3AZFC 2NZDC 3REIA 3AYWA 5B2IB 4E44A 3X1VA 5AV9D 4Z66C 4Z2MG 3KXBB 1M1AA 3AYWC 1H3OA 4YM6C 1B67A 1M1AC 3MGSC 4KGCB 5CPJC 2BYKA 4WNNB 1M18A 5B33A 3A6ND 3X1UB 4DRBA 2AROC 3LZ1D 3MGQD 1WWIA 5B0ZD 2PYOC 3UTBA 3AV1B 4LD9B 1P3BD 3TU4A 3UTBC 3WAAA 3TU4C 2FJ7D 1N1JB 1P3PB 3W97A 5CP6A 1R4VA 3MGRA 3W97C 5CP6C 1F1EA 3AZJB 3W98B 5CPKD 4KUDD 3WKJA 3X1TB 5B2IA 3REJB 3C1BB 4H9QB 5AVBB 3REHB 1ID3A 3WA9A 3KXBC 1P3MB 2RVQC 3VH6W 1JFIB 4KGCA 2YFWB 4WNNA 4J8VD 4KGCC
chains in the Genus database with same CATH superfamily
5F99D 5AV5D 4Z5TB 2HIOD 3X1UC 4J8WD 3AZEB 3UTAB 2CV5D 1ZLAB 1P3KB 4H9NB 3VH6T 3AV1A 4KHAA 1BH8B 5B0YD 3AZGB 3AV1C 4LD9C 1WWSA 5AV6B 1P3LB 1P3PC 3MVDD 2F2AC 4DQYB 4H9SA 2Y2KA 3AN2D 4NFTA 4G92B 1HQ3B 4QLCB 3AZJC 3W98C 1P3IA 3AZHA 3X1TA 5GSUB 2Y2PA 5G49B 3REJA 3C1BA 4YS3A 4H9QA 3REJC 3C1BC 2RIQA 4XUJA 4H9PB 5AVBC 1P3MA 2UWXA 3REHC 1JFIA 1TZYB 3KWQD 1P3MC 2NQBA 1AOIB 1Q9CA 4Z5TA 3W96A 1P3FB 3LZ0A 1P3KA 1S32B 1ZLAA 4Z5TC 3AZEC 3AV2A 4H9NA 3B6FB 4WU9D 3UTAC 1ZLAC 1P3KC 3B6GD 5DNMB 3AZGA 3FDDA 5GXQB 3W99D 4R8PB 3AZGC 1P3LA 4UUZA 5AV6C 1P3LC 3X1SD 1HQ3A 4QLCA 5CPID 4CAYB 5B40B 4G92C 5GSUA 1HQ3C 4QLCC 4WJ3C 1P3GB 4JJNA 3AZFD 2NZDD 4H9PA 1P34B 3REID 5GT0A 3AZIA 4WZSB 2Y2QA 3X1VD 2ZY5A 1M1AD 1TZYC 3MGSB 1AOIA 3VH6A 3LELB 1AOIC 1S32A 1M18D 5B33D 1P3FC 4XZQB 1S32C 3B6FC 5AV8A 5GXQA 5DNMC 1KX4B 4R8PA 5GXQC 3AZMB 4R8PC 4AWLB 3TU4D 5DNNA 2ZY4A 3WAAD 5AY8A 1TAFB 3REKB 5CP6D 3W97D 5B1MB 5B40A 3MGRD 5B40C 1P3GA 5B24B 1P34A 1P3GC 4Z66A 3WKJD 5GT3B 5B2ID 1P34C 3AZLB 1Z2CB 4YM6A 2F8NG 3MGSA 5B32B 1ID3D 1BH9B 3LELA 5CPJA 3WA9D 2XD1A 4NE6A 4Z2MH 4HGAB 4KGCD 2AROA 3LELC 3MGPB 2ZY2A 1U35B 3NQUB 4XZQA 3A1KA 4J8UB 2PYOA 4J8XB 1P3AB 5C3IB 4XZQC 5BNVB 1KX5B 1M19B 1KX4C 3AV1D 2JE5A 3AZMC 5AVCB 4AWLC 2ZM5A 5B1MA 5AV9B 1F66B 3REKC 5B1MC 2VQRA 4ZBJB 1W2EA 1P3ID 4NE5A 5B24C 3X1TD 3A6NB 3AZHD 1ZLAD 3REJD 4YS3D 3C1BD 3MGQB 3AZLA 3KXBA 5GT3C 3KUYB 5B0ZB 3AZLC 3V9RB 4XUJD 3RELD 1P3MD 3WTPB 2F8NB 5B32C 3MGPA 1P3BB 4CSRB 3NQUA 3X1UA 4HGAC 3KFUG 3MGPC 2NQBD 1U35C 4J8XA 1P3AA 4J8UC 4Z5TD 5BNVA 1KX5A 3W96D 2DQNC 4UPKA 5JA4B 3LZ0D 4J8XC 5C3IC 1P3AC 2Y2MA 3AV2D 1P3KD 1KX5C 4LD9A 1M19C 3AZGD 5CHLB 5AVCA 4KUDB 1N1JA 1P3PA 5AVCC 2G5HC 5B2JB 1P3LD 5E5AB 1F66A 3AZJA 5AV9C 3W98A 1F66C 1B6WA 1HQ3D 4QLCD 4ZBJC 5GSUD 2Y2IA 5F99B 5AVBA 3A6NC 4NE3A 3KUYA 3REHA 2HIOB 4JJND 4H9RB 3V9RA 2Y2JA 3MGQC 3MNNB 3WTPA 3EPLA 3KUYC 2F8NA 5B0ZC 2YFWA 5BS7A 5GT0D 3WTPC 3AZID 5B0YB 5BS7C 1P3BC 3KSYA 3AZEA 1PZRA 3AZKB 2XD5A 3UTAA 5JA4A 1BH8A 3AZNB 5AV8D 5GXQD 5B31G 4R8PD 2ZY3A 3C1CB 5AV6A 4KUDC 5B2JA 5E5AA 4DRAA 1P3OB 5DNND 3IP4C 2Y2NA 5B2JC 5E5AC 2L5AA 5AY8D 5B1LB 3A1IA 5B40D 3UT9B 5G49A 2BYMB 1KU5A 1P3GD 3B0CT 5F99C 5BT1C 5BO0B 3MNNA 1P34D 2F8NK 2HIOC 4Z66D 4WU9B 5B32G 1TZYA 3MNNC 3AYWD 4YM6D 3MGSD 5B0YC 5CPJD 3LELD 3AZKA 1P3FA 2AROD 3B6FA 3AZKC 4XZQD 5DNMA 2BG1A 2PYOD 3AZNA 3AZNC 3C1CA 3UTBD 1KX3B 2YFVB 5B31B 3C1CC 1P3OA 3R45B 1P3OC 4WU8B 5B1LA 3REIB 4CAYA 5B1MD 3X1VB 3UT9A 5B1LC 3UT9C 1H3OB 5BO0A 1M18B 5B33B 5JRGB 3AZLD 3KXBD 2DF4C 2RVQD 4WU9C 3AFAB 3LJAB 3NQJB 2G5IC 2F8NH 3O62B 3MGPD 5FUGB 3X1UD 3WAAB 1EQZB 4J8XD 1P3AD 1KX4A 1KX5D 1HTAA 3MGRB 5CPIC 4ZUXB 3AZMA 1KX3A 4LD9D 2YFVA 4H9OB 5B31A 4X23B 1KX3C 5B31C 3R45A 3WKJB 4WU8A 1TAFA 1P3PD 3REKA 3VH5W 4G91B 4EO5B 4WU8C 1F66D 3REIC 3AZJD 3X1VC 1ID3B 3WA9B 3W98D 5B24A 5GT3A 3LZ1B 5JRGA 3VH5T 5AVBD 1M18C 2W8SA 5B33C 3REHD 3KUYD 5B32A 5JRGC 1BH9A 3AFAA 3WTPD 2F8ND 3LJAA 3NQJA 5KDMB 3O62A 3AFAC 3EPKA 1U35A 4KHAB 5FUGA 3LJAC 4J8UA 3O62C 1EQZA 2FJ7B 3F6TA 3AZED 3WAAC 3UTAD 1EQZC 4ZUXA 1M19A 4H9OA 3MGRC 4ZUXC 4X23A 5CPKB 1P3IB 4X23C 3AZHB 3EG5B 5AV6D 3EPJA 2Y2HA 4YS3B 5B2JD 5AV9A 3WKJC 5E5AD 5B2IC 4G91C 4EO5C 4XUJB 3RELB 1ID3C 3WA9C 5BNXB 4J8VB 3A6NA 3LZ1A 2NQBB 3MGQA 3H0MC 2CWEA 5BT1D 3H0LC 5AV5B 3LZ1C 4J8WB 5B0ZA 3W96B 2CV5B 3MNND 2HUEB 3LZ0B 3AV2B 5KDMA 1P3BA 4CSRA 1TZYD 1AOID 2FJ7A 2IO5B 3AZKD 3P5JB 1P3FD 2FJ7C 1S32D 4UUZB 2LY8A 3B6FD 3MVDB 5DNMD 3AZND 3EPHA 3AN2B 5CPKA 3H0RC 4KUDA 4H9SC 3C1CD 5CPKC 1P3IC 3AZHC 3X1TC 3B0CW 1ULYA 4JJNB 4YS3C 1P3OD 3RELA 3VH5A 4XUJC 5B1LD 3B0DB 5BNXA 5GT0B 3KWQB 4J8VA 3RELC 3AZIB 3UT9D 4M6BA 5F99A 4J8VC 5AV5A 2HIOA 4J8WA 4H9RA 2NQBC 2CV5A 5AV5C 4J8WC 1BFMA 3W96C 2CV5C 3LZ0C 2HUEC 3B0BA 3B6GB 5B0YA 3AV2C 5AV8B 3W99B 4E45A 2IO5C 3MVDA 5DNNB 2JCHA 2Y2GA 3X1SB 3MVDC 5AY8B 3AN2A 5CPIB 1KX4D 3AN2C 2Y2LA 3AZMD 1KX3D 5B31D 5GSUC 3AZFB 2NZDB 4JJNC 4Z66B 4WU8D 3AYWB 3KWQA 3REKD 4YM6B 3B0DC 2BYMA 5GT0C 3KWQC 3AZIC 1M1AB 5CPJB 5B24D 2AROB 2BYKB 4WU9A 5GT3D 3B6GA 5JRGD 2PYOB 3W99A 5B32D 3B6GC 3AFAD 4WV4B 1A7WA 5AV8C 3W99C 3UTBB 3LJAD 3O62D 1U35D 3TU4B 4J8UD 3X1SA 1EQZD 5DNNC 5CPIA 3W97B 5CP6B 3X1SC 5AY8C 4ZUXD 1M19D 2JSSA 1T3UA 3AZFA 2NZDA 4X23D 5AVCD 3WTPE 3AZFC 2NZDC 3REIA 3AYWA 5B2IB 4E44A 3X1VA 5AV9D 4Z66C 4Z2MG 2J8PA 3KXBB 3AYWC 1M1AA 1H3OA 4YM6C 1B67A 1M1AC 3MGSC 3AL0C 4KGCB 5CPJC 2BYKA 4WNNB 1M18A 5B33A 3A6ND 3X1UB 4DRBA 2AROC 3LZ1D 3MGQD 1WWIA 5B0ZD 2PYOC 2FFFB 3UTBA 3AV1B 4LD9B 1P3BD 3TU4A 3UTBC 3WAAA 3TU4C 2FJ7D 2Y2OA 1N1JB 1P3PB 3W97A 5CP6A 1R4VA 3MGRA 3W97C 5CP6C 1F1EA 3AZJB 3W98B 5CPKD 4KUDD 3WKJA 3X1TB 5B2IA 3REJB 3C1BB 4H9QB 5AVBB 3REHB 1ID3A 3WA9A 3KXBC 1P3MB 2RVQC 3VH6W 1JFIB 4KGCA 2YFWB 4WNNA 4J8VD 4KGCC
chains in the Genus database with same CATH topology
5F99D 5AV5D 4Z5TB 2HIOD 3X1UC 4J8WD 3AZEB 3UTAB 2CV5D 1ZLAB 1P3KB 4H9NB 3VH6T 3AV1A 4KHAA 1BH8B 5B0YD 3AZGB 3AV1C 4LD9C 1WWSA 5AV6B 1P3LB 1P3PC 3MVDD 2F2AC 4DQYB 4H9SA 2Y2KA 3AN2D 4NFTA 4G92B 1HQ3B 4QLCB 3AZJC 3W98C 1P3IA 3AZHA 3X1TA 5GSUB 2Y2PA 5G49B 3REJA 3C1BA 4YS3A 4H9QA 3REJC 3C1BC 2RIQA 4XUJA 4H9PB 5AVBC 1P3MA 2UWXA 3REHC 1JFIA 1TZYB 3KWQD 1P3MC 2NQBA 1AOIB 1Q9CA 4Z5TA 3W96A 1P3FB 3LZ0A 1P3KA 1S32B 1ZLAA 4Z5TC 3AZEC 3AV2A 4H9NA 3B6FB 4WU9D 3UTAC 1ZLAC 1P3KC 3B6GD 5DNMB 3AZGA 3FDDA 5GXQB 3W99D 4R8PB 3AZGC 1P3LA 4UUZA 5AV6C 1P3LC 3X1SD 1HQ3A 4QLCA 5CPID 4CAYB 5B40B 4G92C 5GSUA 1HQ3C 4QLCC 4WJ3C 1P3GB 4JJNA 3AZFD 2NZDD 4H9PA 1P34B 3REID 5GT0A 3AZIA 4WZSB 2Y2QA 3X1VD 2ZY5A 1M1AD 1TZYC 3MGSB 1AOIA 3VH6A 3LELB 1AOIC 1S32A 1M18D 5B33D 1P3FC 4XZQB 1S32C 3B6FC 5AV8A 5GXQA 5DNMC 1KX4B 4R8PA 5GXQC 3AZMB 4R8PC 4AWLB 3TU4D 5DNNA 2ZY4A 3WAAD 5AY8A 1TAFB 3REKB 5CP6D 3W97D 5B1MB 5B40A 3MGRD 5B40C 1P3GA 5B24B 1P34A 1P3GC 4Z66A 3WKJD 5GT3B 5B2ID 1P34C 3AZLB 1Z2CB 4YM6A 2F8NG 3MGSA 5B32B 1ID3D 1BH9B 3LELA 5CPJA 3WA9D 2XD1A 4NE6A 4Z2MH 4HGAB 4KGCD 2AROA 3LELC 3MGPB 2ZY2A 1U35B 3NQUB 4XZQA 3A1KA 4J8UB 2PYOA 4J8XB 1P3AB 5C3IB 4XZQC 5BNVB 1KX5B 1M19B 1KX4C 3AV1D 2JE5A 3AZMC 5AVCB 4AWLC 2ZM5A 5B1MA 5AV9B 1F66B 3REKC 5B1MC 2VQRA 4ZBJB 1W2EA 1P3ID 4NE5A 5B24C 3X1TD 3A6NB 3AZHD 1ZLAD 3REJD 4YS3D 3C1BD 3MGQB 3AZLA 3KXBA 5GT3C 3KUYB 5B0ZB 3AZLC 3V9RB 4XUJD 3RELD 1P3MD 3WTPB 2F8NB 5B32C 3MGPA 1P3BB 4CSRB 3NQUA 3X1UA 4HGAC 3KFUG 3MGPC 2NQBD 1U35C 4J8XA 1P3AA 4J8UC 4Z5TD 5BNVA 1KX5A 3W96D 2DQNC 4UPKA 5JA4B 3LZ0D 4J8XC 5C3IC 1P3AC 2Y2MA 3AV2D 1P3KD 1KX5C 4LD9A 1M19C 3AZGD 5CHLB 5AVCA 4KUDB 1N1JA 1P3PA 5AVCC 2G5HC 5B2JB 1P3LD 5E5AB 1F66A 3AZJA 5AV9C 3W98A 1F66C 1B6WA 1HQ3D 4QLCD 4ZBJC 5GSUD 2Y2IA 5F99B 5AVBA 3A6NC 4NE3A 3KUYA 3REHA 2HIOB 4JJND 4H9RB 3V9RA 2Y2JA 3MGQC 3MNNB 3WTPA 3EPLA 3KUYC 2F8NA 5B0ZC 2YFWA 5BS7A 5GT0D 3WTPC 3AZID 5B0YB 5BS7C 1P3BC 3KSYA 3AZEA 1PZRA 3AZKB 2XD5A 3UTAA 5JA4A 1BH8A 3AZNB 5AV8D 5GXQD 5B31G 4R8PD 2ZY3A 3C1CB 5AV6A 4KUDC 5B2JA 5E5AA 4DRAA 1P3OB 5DNND 3IP4C 2Y2NA 5B2JC 5E5AC 2L5AA 5AY8D 5B1LB 3A1IA 5B40D 3UT9B 5G49A 2BYMB 1KU5A 1P3GD 3B0CT 5F99C 5BT1C 5BO0B 3MNNA 1P34D 2F8NK 2HIOC 4Z66D 4WU9B 5B32G 1TZYA 3MNNC 3AYWD 4YM6D 3MGSD 5B0YC 5CPJD 3LELD 3AZKA 1P3FA 2AROD 3B6FA 3AZKC 4XZQD 5DNMA 2BG1A 2PYOD 3AZNA 3AZNC 3C1CA 3UTBD 1KX3B 2YFVB 5B31B 3C1CC 1P3OA 3R45B 1P3OC 4WU8B 5B1LA 3REIB 4CAYA 5B1MD 3X1VB 3UT9A 5B1LC 3UT9C 1H3OB 5BO0A 1M18B 5B33B 5JRGB 3AZLD 3KXBD 2DF4C 2RVQD 4WU9C 3AFAB 3LJAB 3NQJB 2G5IC 2F8NH 3O62B 3MGPD 5FUGB 3X1UD 3WAAB 1EQZB 4J8XD 1P3AD 1KX4A 1KX5D 1HTAA 3MGRB 5CPIC 4ZUXB 3AZMA 1KX3A 4LD9D 2YFVA 4H9OB 5B31A 4X23B 1KX3C 5B31C 3R45A 3WKJB 4WU8A 1TAFA 1P3PD 3REKA 3VH5W 4G91B 4EO5B 4WU8C 1F66D 3REIC 3AZJD 3X1VC 1ID3B 3WA9B 3W98D 5B24A 5GT3A 3LZ1B 5JRGA 3VH5T 5AVBD 1M18C 2W8SA 5B33C 3REHD 3KUYD 5B32A 5JRGC 1BH9A 3AFAA 3WTPD 2F8ND 3LJAA 3NQJA 5KDMB 3O62A 3AFAC 3EPKA 1U35A 4KHAB 5FUGA 3LJAC 4J8UA 3O62C 1EQZA 2FJ7B 3F6TA 3AZED 3WAAC 3UTAD 1EQZC 4ZUXA 1M19A 4H9OA 3MGRC 4ZUXC 4X23A 5CPKB 1P3IB 4X23C 3AZHB 3EG5B 5AV6D 3EPJA 2Y2HA 4YS3B 5B2JD 5AV9A 3WKJC 5E5AD 5B2IC 4G91C 4EO5C 4XUJB 3RELB 1ID3C 3WA9C 5BNXB 4J8VB 3A6NA 3LZ1A 2NQBB 3MGQA 3H0MC 2CWEA 5BT1D 3H0LC 5AV5B 3LZ1C 4J8WB 5B0ZA 3W96B 2CV5B 3MNND 2HUEB 3LZ0B 3AV2B 5KDMA 1P3BA 4CSRA 1TZYD 1AOID 2FJ7A 2IO5B 3AZKD 3P5JB 1P3FD 2FJ7C 1S32D 4UUZB 2LY8A 3B6FD 3MVDB 5DNMD 3AZND 3EPHA 3AN2B 5CPKA 3H0RC 4KUDA 4H9SC 3C1CD 5CPKC 1P3IC 3AZHC 3X1TC 3B0CW 1ULYA 4JJNB 4YS3C 1P3OD 3RELA 3VH5A 4XUJC 5B1LD 3B0DB 5BNXA 5GT0B 3KWQB 4J8VA 3RELC 3AZIB 3UT9D 4M6BA 5F99A 4J8VC 5AV5A 2HIOA 4J8WA 4H9RA 2NQBC 2CV5A 5AV5C 4J8WC 1BFMA 3W96C 2CV5C 3LZ0C 2HUEC 3B0BA 3B6GB 5B0YA 3AV2C 5AV8B 3W99B 4E45A 2IO5C 3MVDA 5DNNB 2JCHA 2Y2GA 3X1SB 3MVDC 5AY8B 3AN2A 5CPIB 1KX4D 3AN2C 2Y2LA 3AZMD 1KX3D 5B31D 5GSUC 3AZFB 2NZDB 4JJNC 4Z66B 4WU8D 3AYWB 3KWQA 3REKD 4YM6B 3B0DC 2BYMA 5GT0C 3KWQC 3AZIC 1M1AB 5CPJB 5B24D 2AROB 2BYKB 4WU9A 5GT3D 3B6GA 5JRGD 2PYOB 3W99A 5B32D 3B6GC 3AFAD 4WV4B 1A7WA 5AV8C 3W99C 3UTBB 3LJAD 3O62D 1U35D 3TU4B 4J8UD 3X1SA 1EQZD 5DNNC 5CPIA 3W97B 5CP6B 3X1SC 5AY8C 4ZUXD 1M19D 2JSSA 1T3UA 3AZFA 2NZDA 4X23D 5AVCD 3WTPE 3AZFC 2NZDC 3REIA 3AYWA 5B2IB 4E44A 3X1VA 5AV9D 4Z66C 4Z2MG 2J8PA 3KXBB 3AYWC 1M1AA 1H3OA 4YM6C 1B67A 1M1AC 3MGSC 3AL0C 4KGCB 5CPJC 2BYKA 4WNNB 1M18A 5B33A 3A6ND 3X1UB 4DRBA 2AROC 3LZ1D 3MGQD 1WWIA 5B0ZD 2PYOC 2FFFB 3UTBA 3AV1B 4LD9B 1P3BD 3TU4A 3UTBC 3WAAA 3TU4C 2FJ7D 2Y2OA 1N1JB 1P3PB 3W97A 5CP6A 1R4VA 3MGRA 3W97C 5CP6C 1F1EA 3AZJB 3W98B 5CPKD 4KUDD 3WKJA 3X1TB 5B2IA 3REJB 3C1BB 4H9QB 5AVBB 3REHB 1ID3A 3WA9A 3KXBC 1P3MB 2RVQC 3VH6W 1JFIB 4KGCA 2YFWB 4WNNA 4J8VD 4KGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 D;  5AV5 D;  4Z5T B;  2HIO D;  3X1U C;  4J8W D;  3AZE B;  3UTA B;  2CV5 D;  1ZLA B;  1P3K B;  4H9N B;  3VH6 T;  3AV1 A;  4KHA A;  1BH8 B;  5B0Y D;  3AZG B;  3AV1 C;  4LD9 C;  1WWS A;  5AV6 B;  1P3L B;  1P3P C;  3MVD D;  4H9S A;  3AN2 D;  4NFT A;  4G92 B;  1HQ3 B;  4QLC B;  3AZJ C;  3W98 C;  1P3I A;  3AZH A;  3X1T A;  5GSU B;  5G49 B;  3REJ A;  4YS3 A;  3C1B A;  4H9Q A;  3REJ C;  3C1B C;  4XUJ A;  5AVB C;  4H9P B;  1P3M A;  3REH C;  1JFI A;  1TZY B;  3KWQ D;  1P3M C;  2NQB A;  1AOI B;  1Q9C A;  4Z5T A;  3W96 A;  1P3F B;  3LZ0 A;  1P3K A;  1S32 B;  1ZLA A;  4Z5T C;  3AZE C;  3AV2 A;  4H9N A;  3B6F B;  4WU9 D;  3UTA C;  1ZLA C;  1P3K C;  3B6G D;  5DNM B;  3AZG A;  5GXQ B;  3W99 D;  4R8P B;  3AZG C;  1P3L A;  4UUZ A;  5AV6 C;  1P3L C;  3X1S D;  1HQ3 A;  4QLC A;  5CPI D;  4CAY B;  5B40 B;  4G92 C;  5GSU A;  1HQ3 C;  4QLC C;  1P3G B;  4JJN A;  3AZF D;  2NZD D;  4H9P A;  1P34 B;  3REI D;  5GT0 A;  3AZI A;  4WZS B;  3X1V D;  1M1A D;  1TZY C;  3MGS B;  1AOI A;  3VH6 A;  3LEL B;  1AOI C;  1S32 A;  1M18 D;  5B33 D;  1P3F C;  4XZQ B;  1S32 C;  3B6F C;  5AV8 A;  5GXQ A;  5DNM C;  1KX4 B;  4R8P A;  5GXQ C;  3AZM B;  4R8P C;  4AWL B;  3TU4 D;  5DNN A;  3WAA D;  5AY8 A;  1TAF B;  3REK B;  5CP6 D;  3W97 D;  5B1M B;  5B40 A;  3MGR D;  5B40 C;  1P3G A;  5B24 B;  1P34 A;  1P3G C;  4Z66 A;  3WKJ D;  5GT3 B;  5B2I D;  1P34 C;  3AZL B;  4YM6 A;  2F8N G;  3MGS A;  5B32 B;  1ID3 D;  1BH9 B;  3LEL A;  5CPJ A;  3WA9 D;  4NE6 A;  4Z2M H;  4HGA B;  4KGC D;  2ARO A;  3LEL C;  3MGP B;  1U35 B;  3NQU B;  4XZQ A;  4J8U B;  2PYO A;  4J8X B;  1P3A B;  5C3I B;  4XZQ C;  5BNV B;  1KX5 B;  1M19 B;  1KX4 C;  3AV1 D;  3AZM C;  5AVC B;  4AWL C;  5B1M A;  5AV9 B;  1F66 B;  3REK C;  5B1M C;  4ZBJ B;  1P3I D;  4NE5 A;  5B24 C;  3X1T D;  3A6N B;  3AZH D;  3REJ D;  4YS3 D;  3C1B D;  3MGQ B;  3AZL A;  3KXB A;  5GT3 C;  3KUY B;  5B0Z B;  3AZL C;  3V9R B;  4XUJ D;  3REL D;  1P3M D;  3WTP B;  2F8N B;  5B32 C;  3MGP A;  1P3B B;  4CSR B;  3NQU A;  3X1U A;  4HGA C;  3MGP C;  2NQB D;  1U35 C;  4J8X A;  1P3A A;  4J8U C;  4Z5T D;  5BNV A;  1KX5 A;  3W96 D;  5JA4 B;  3LZ0 D;  4J8X C;  1P3A C;  1P3K D;  5C3I C;  1ZLA D;  3AV2 D;  1KX5 C;  4LD9 A;  1M19 C;  3AZG D;  5CHL B;  5AVC A;  4KUD B;  1N1J A;  1P3P A;  5AVC C;  5B2J B;  1P3L D;  5E5A B;  1F66 A;  3AZJ A;  5AV9 C;  3W98 A;  1F66 C;  1B6W A;  1HQ3 D;  4QLC D;  4ZBJ C;  5GSU D;  5F99 B;  5AVB A;  3A6N C;  4NE3 A;  3KUY A;  3REH A;  2HIO B;  4JJN D;  4H9R B;  3V9R A;  3MGQ C;  3MNN B;  3WTP A;  3KUY C;  2F8N A;  5B0Z C;  2YFW A;  5BS7 A;  5GT0 D;  3WTP C;  3AZI D;  5B0Y B;  5BS7 C;  1P3B C;  3KSY A;  3AZE A;  3AZK B;  3UTA A;  5JA4 A;  1BH8 A;  3AZN B;  5AV8 D;  5GXQ D;  5B31 G;  4R8P D;  3C1C B;  5AV6 A;  4KUD C;  5B2J A;  5E5A A;  4DRA A;  1P3O B;  5DNN D;  5B2J C;  5E5A C;  2L5A A;  5AY8 D;  5B1L B;  5B40 D;  3UT9 B;  5G49 A;  2BYM B;  1KU5 A;  1P3G D;  3B0C T;  5F99 C;  5BT1 C;  5BO0 B;  3MNN A;  1P34 D;  2F8N K;  2HIO C;  4Z66 D;  4WU9 B;  5B32 G;  1TZY A;  3MNN C;  3AYW D;  4YM6 D;  3MGS D;  5B0Y C;  5CPJ D;  3LEL D;  3AZK A;  1P3F A;  2ARO D;  3B6F A;  3AZK C;  4XZQ D;  5DNM A;  2PYO D;  3AZN A;  3AZN C;  3C1C A;  3UTB D;  1KX3 B;  2YFV B;  5B31 B;  3C1C C;  1P3O A;  3R45 B;  1P3O C;  4WU8 B;  5B1L A;  3REI B;  4CAY A;  5B1M D;  3X1V B;  3UT9 A;  5B1L C;  3UT9 C;  1H3O B;  5BO0 A;  1M18 B;  5B33 B;  5JRG B;  3AZL D;  3KXB D;  4WU9 C;  2RVQ D;  3AFA B;  3LJA B;  3NQJ B;  2F8N H;  3O62 B;  3MGP D;  5FUG B;  3X1U D;  3WAA B;  1EQZ B;  4J8X D;  1P3A D;  1KX4 A;  1KX5 D;  1HTA A;  3MGR B;  5CPI C;  4ZUX B;  3AZM A;  1KX3 A;  4LD9 D;  2YFV A;  4H9O B;  5B31 A;  4X23 B;  1KX3 C;  5B31 C;  3R45 A;  3WKJ B;  4WU8 A;  1TAF A;  1P3P D;  3REK A;  3VH5 W;  4G91 B;  4EO5 B;  4WU8 C;  1F66 D;  3REI C;  3AZJ D;  3X1V C;  1ID3 B;  3WA9 B;  3W98 D;  5B24 A;  5GT3 A;  3LZ1 B;  5JRG A;  3VH5 T;  5AVB D;  1M18 C;  5B33 C;  3REH D;  3KUY D;  5B32 A;  5JRG C;  1BH9 A;  3AFA A;  3WTP D;  2F8N D;  3LJA A;  3NQJ A;  5KDM B;  3O62 A;  3AFA C;  1U35 A;  4KHA B;  5FUG A;  3LJA C;  4J8U A;  3O62 C;  1EQZ A;  2FJ7 B;  3AZE D;  3WAA C;  3UTA D;  1EQZ C;  4ZUX A;  1M19 A;  4H9O A;  3MGR C;  4ZUX C;  4X23 A;  5CPK B;  1P3I B;  4X23 C;  3AZH B;  5AV6 D;  4YS3 B;  5B2J D;  5AV9 A;  3WKJ C;  5E5A D;  5B2I C;  4G91 C;  4EO5 C;  4XUJ B;  3REL B;  1ID3 C;  3WA9 C;  5BNX B;  4J8V B;  3A6N A;  3LZ1 A;  2NQB B;  3MGQ A;  2CWE A;  5BT1 D;  5AV5 B;  3LZ1 C;  4J8W B;  5B0Z A;  3W96 B;  2CV5 B;  3MNN D;  2HUE B;  3LZ0 B;  3AV2 B;  5KDM A;  1P3B A;  4CSR A;  1TZY D;  1AOI D;  2FJ7 A;  2IO5 B;  3AZK D;  1P3F D;  2FJ7 C;  1S32 D;  4UUZ B;  2LY8 A;  3B6F D;  3MVD B;  5DNM D;  3AZN D;  3AN2 B;  5CPK A;  4KUD A;  4H9S C;  3C1C D;  5CPK C;  1P3I C;  3AZH C;  3X1T C;  3B0C W;  1ULY A;  4JJN B;  4YS3 C;  1P3O D;  3REL A;  3VH5 A;  4XUJ C;  5B1L D;  3B0D B;  5BNX A;  5GT0 B;  3KWQ B;  4J8V A;  3REL C;  3AZI B;  3UT9 D;  4M6B A;  5F99 A;  4J8V C;  5AV5 A;  2HIO A;  4J8W A;  4H9R A;  2NQB C;  2CV5 A;  5AV5 C;  4J8W C;  1BFM A;  3W96 C;  2CV5 C;  3LZ0 C;  2HUE C;  3B0B A;  3B6G B;  5B0Y A;  3AV2 C;  5AV8 B;  3W99 B;  4E45 A;  2IO5 C;  3MVD A;  5DNN B;  3X1S B;  3MVD C;  5AY8 B;  3AN2 A;  5CPI B;  1KX4 D;  3AN2 C;  3AZM D;  1KX3 D;  5B31 D;  5GSU C;  3AZF B;  2NZD B;  4JJN C;  4Z66 B;  4WU8 D;  3AYW B;  3KWQ A;  3REK D;  4YM6 B;  3B0D C;  2BYM A;  5GT0 C;  3KWQ C;  3AZI C;  1M1A B;  5CPJ B;  5B24 D;  2ARO B;  2BYK B;  4WU9 A;  5GT3 D;  3B6G A;  5JRG D;  2PYO B;  3W99 A;  5B32 D;  3B6G C;  3AFA D;  4WV4 B;  1A7W A;  5AV8 C;  3W99 C;  3UTB B;  3LJA D;  3O62 D;  1U35 D;  3TU4 B;  4J8U D;  3X1S A;  1EQZ D;  5DNN C;  5CPI A;  3W97 B;  5CP6 B;  3X1S C;  5AY8 C;  4ZUX D;  1M19 D;  2JSS A;  3AZF A;  2NZD A;  4X23 D;  5AVC D;  3WTP E;  3AZF C;  2NZD C;  3REI A;  3AYW A;  5B2I B;  4E44 A;  3X1V A;  5AV9 D;  4Z66 C;  4Z2M G;  3KXB B;  1M1A A;  3AYW C;  1H3O A;  4YM6 C;  1B67 A;  1M1A C;  3MGS C;  4KGC B;  5CPJ C;  2BYK A;  4WNN B;  1M18 A;  5B33 A;  3A6N D;  3X1U B;  4DRB A;  2ARO C;  3LZ1 D;  3MGQ D;  1WWI A;  5B0Z D;  2PYO C;  3UTB A;  3AV1 B;  4LD9 B;  1P3B D;  3TU4 A;  3UTB C;  3WAA A;  3TU4 C;  2FJ7 D;  1N1J B;  1P3P B;  3W97 A;  5CP6 A;  1R4V A;  3MGR A;  3W97 C;  5CP6 C;  1F1E A;  3AZJ B;  3W98 B;  5CPK D;  4KUD D;  3WKJ A;  3X1T B;  5B2I A;  3REJ B;  3C1B B;  4H9Q B;  5AVB B;  3REH B;  1ID3 A;  3WA9 A;  3KXB C;  1P3M B;  2RVQ C;  3VH6 W;  1JFI B;  4KGC A;  2YFW B;  4WNN A;  4J8V D;  4KGC C; 
#chains in the Genus database with same CATH topology
 5F99 D;  5AV5 D;  4Z5T B;  2HIO D;  3X1U C;  4J8W D;  3AZE B;  3UTA B;  2CV5 D;  1ZLA B;  1P3K B;  4H9N B;  3VH6 T;  3AV1 A;  4KHA A;  1BH8 B;  5B0Y D;  3AZG B;  3AV1 C;  4LD9 C;  1WWS A;  5AV6 B;  1P3L B;  1P3P C;  3MVD D;  2F2A C;  4DQY B;  4H9S A;  2Y2K A;  3AN2 D;  4NFT A;  4G92 B;  1HQ3 B;  4QLC B;  3AZJ C;  3W98 C;  1P3I A;  3AZH A;  3X1T A;  5GSU B;  2Y2P A;  5G49 B;  3REJ A;  3C1B A;  4YS3 A;  4H9Q A;  3REJ C;  3C1B C;  2RIQ A;  4XUJ A;  4H9P B;  5AVB C;  1P3M A;  2UWX A;  3REH C;  1JFI A;  1TZY B;  3KWQ D;  1P3M C;  2NQB A;  1AOI B;  1Q9C A;  4Z5T A;  3W96 A;  1P3F B;  3LZ0 A;  1P3K A;  1S32 B;  1ZLA A;  4Z5T C;  3AZE C;  3AV2 A;  4H9N A;  3B6F B;  4WU9 D;  3UTA C;  1ZLA C;  1P3K C;  3B6G D;  5DNM B;  3AZG A;  3FDD A;  5GXQ B;  3W99 D;  4R8P B;  3AZG C;  1P3L A;  4UUZ A;  5AV6 C;  1P3L C;  3X1S D;  1HQ3 A;  4QLC A;  5CPI D;  4CAY B;  5B40 B;  4G92 C;  5GSU A;  1HQ3 C;  4QLC C;  4WJ3 C;  1P3G B;  4JJN A;  3AZF D;  2NZD D;  4H9P A;  1P34 B;  3REI D;  5GT0 A;  3AZI A;  4WZS B;  2Y2Q A;  3X1V D;  2ZY5 A;  1M1A D;  1TZY C;  3MGS B;  1AOI A;  3VH6 A;  3LEL B;  1AOI C;  1S32 A;  1M18 D;  5B33 D;  1P3F C;  4XZQ B;  1S32 C;  3B6F C;  5AV8 A;  5GXQ A;  5DNM C;  1KX4 B;  4R8P A;  5GXQ C;  3AZM B;  4R8P C;  4AWL B;  3TU4 D;  5DNN A;  2ZY4 A;  3WAA D;  5AY8 A;  1TAF B;  3REK B;  5CP6 D;  3W97 D;  5B1M B;  5B40 A;  3MGR D;  5B40 C;  1P3G A;  5B24 B;  1P34 A;  1P3G C;  4Z66 A;  3WKJ D;  5GT3 B;  5B2I D;  1P34 C;  3AZL B;  1Z2C B;  4YM6 A;  2F8N G;  3MGS A;  5B32 B;  1ID3 D;  1BH9 B;  3LEL A;  5CPJ A;  3WA9 D;  2XD1 A;  4NE6 A;  4Z2M H;  4HGA B;  4KGC D;  2ARO A;  3LEL C;  3MGP B;  2ZY2 A;  1U35 B;  3NQU B;  4XZQ A;  3A1K A;  4J8U B;  2PYO A;  4J8X B;  1P3A B;  5C3I B;  4XZQ C;  5BNV B;  1KX5 B;  1M19 B;  1KX4 C;  3AV1 D;  2JE5 A;  3AZM C;  5AVC B;  4AWL C;  2ZM5 A;  5B1M A;  5AV9 B;  1F66 B;  3REK C;  5B1M C;  2VQR A;  4ZBJ B;  1W2E A;  1P3I D;  4NE5 A;  5B24 C;  3X1T D;  3A6N B;  3AZH D;  1ZLA D;  3REJ D;  4YS3 D;  3C1B D;  3MGQ B;  3AZL A;  3KXB A;  5GT3 C;  3KUY B;  5B0Z B;  3AZL C;  3V9R B;  4XUJ D;  3REL D;  1P3M D;  3WTP B;  2F8N B;  5B32 C;  3MGP A;  1P3B B;  4CSR B;  3NQU A;  3X1U A;  4HGA C;  3KFU G;  3MGP C;  2NQB D;  1U35 C;  4J8X A;  1P3A A;  4J8U C;  4Z5T D;  5BNV A;  1KX5 A;  3W96 D;  2DQN C;  4UPK A;  5JA4 B;  3LZ0 D;  4J8X C;  5C3I C;  1P3A C;  2Y2M A;  3AV2 D;  1P3K D;  1KX5 C;  4LD9 A;  1M19 C;  3AZG D;  5CHL B;  5AVC A;  4KUD B;  1N1J A;  1P3P A;  5AVC C;  2G5H C;  5B2J B;  1P3L D;  5E5A B;  1F66 A;  3AZJ A;  5AV9 C;  3W98 A;  1F66 C;  1B6W A;  1HQ3 D;  4QLC D;  4ZBJ C;  5GSU D;  2Y2I A;  5F99 B;  5AVB A;  3A6N C;  4NE3 A;  3KUY A;  3REH A;  2HIO B;  4JJN D;  4H9R B;  3V9R A;  2Y2J A;  3MGQ C;  3MNN B;  3WTP A;  3EPL A;  3KUY C;  2F8N A;  5B0Z C;  2YFW A;  5BS7 A;  5GT0 D;  3WTP C;  3AZI D;  5B0Y B;  5BS7 C;  1P3B C;  3KSY A;  3AZE A;  1PZR A;  3AZK B;  2XD5 A;  3UTA A;  5JA4 A;  1BH8 A;  3AZN B;  5AV8 D;  5GXQ D;  5B31 G;  4R8P D;  2ZY3 A;  3C1C B;  5AV6 A;  4KUD C;  5B2J A;  5E5A A;  4DRA A;  1P3O B;  5DNN D;  3IP4 C;  2Y2N A;  5B2J C;  5E5A C;  2L5A A;  5AY8 D;  5B1L B;  3A1I A;  5B40 D;  3UT9 B;  5G49 A;  2BYM B;  1KU5 A;  1P3G D;  3B0C T;  5F99 C;  5BT1 C;  5BO0 B;  3MNN A;  1P34 D;  2F8N K;  2HIO C;  4Z66 D;  4WU9 B;  5B32 G;  1TZY A;  3MNN C;  3AYW D;  4YM6 D;  3MGS D;  5B0Y C;  5CPJ D;  3LEL D;  3AZK A;  1P3F A;  2ARO D;  3B6F A;  3AZK C;  4XZQ D;  5DNM A;  2BG1 A;  2PYO D;  3AZN A;  3AZN C;  3C1C A;  3UTB D;  1KX3 B;  2YFV B;  5B31 B;  3C1C C;  1P3O A;  3R45 B;  1P3O C;  4WU8 B;  5B1L A;  3REI B;  4CAY A;  5B1M D;  3X1V B;  3UT9 A;  5B1L C;  3UT9 C;  1H3O B;  5BO0 A;  1M18 B;  5B33 B;  5JRG B;  3AZL D;  3KXB D;  2DF4 C;  2RVQ D;  4WU9 C;  3AFA B;  3LJA B;  3NQJ B;  2G5I C;  2F8N H;  3O62 B;  3MGP D;  5FUG B;  3X1U D;  3WAA B;  1EQZ B;  4J8X D;  1P3A D;  1KX4 A;  1KX5 D;  1HTA A;  3MGR B;  5CPI C;  4ZUX B;  3AZM A;  1KX3 A;  4LD9 D;  2YFV A;  4H9O B;  5B31 A;  4X23 B;  1KX3 C;  5B31 C;  3R45 A;  3WKJ B;  4WU8 A;  1TAF A;  1P3P D;  3REK A;  3VH5 W;  4G91 B;  4EO5 B;  4WU8 C;  1F66 D;  3REI C;  3AZJ D;  3X1V C;  1ID3 B;  3WA9 B;  3W98 D;  5B24 A;  5GT3 A;  3LZ1 B;  5JRG A;  3VH5 T;  5AVB D;  1M18 C;  2W8S A;  5B33 C;  3REH D;  3KUY D;  5B32 A;  5JRG C;  1BH9 A;  3AFA A;  3WTP D;  2F8N D;  3LJA A;  3NQJ A;  5KDM B;  3O62 A;  3AFA C;  3EPK A;  1U35 A;  4KHA B;  5FUG A;  3LJA C;  4J8U A;  3O62 C;  1EQZ A;  2FJ7 B;  3F6T A;  3AZE D;  3WAA C;  3UTA D;  1EQZ C;  4ZUX A;  1M19 A;  4H9O A;  3MGR C;  4ZUX C;  4X23 A;  5CPK B;  1P3I B;  4X23 C;  3AZH B;  3EG5 B;  5AV6 D;  3EPJ A;  2Y2H A;  4YS3 B;  5B2J D;  5AV9 A;  3WKJ C;  5E5A D;  5B2I C;  4G91 C;  4EO5 C;  4XUJ B;  3REL B;  1ID3 C;  3WA9 C;  5BNX B;  4J8V B;  3A6N A;  3LZ1 A;  2NQB B;  3MGQ A;  3H0M C;  2CWE A;  5BT1 D;  3H0L C;  5AV5 B;  3LZ1 C;  4J8W B;  5B0Z A;  3W96 B;  2CV5 B;  3MNN D;  2HUE B;  3LZ0 B;  3AV2 B;  5KDM A;  1P3B A;  4CSR A;  1TZY D;  1AOI D;  2FJ7 A;  2IO5 B;  3AZK D;  3P5J B;  1P3F D;  2FJ7 C;  1S32 D;  4UUZ B;  2LY8 A;  3B6F D;  3MVD B;  5DNM D;  3AZN D;  3EPH A;  3AN2 B;  5CPK A;  3H0R C;  4KUD A;  4H9S C;  3C1C D;  5CPK C;  1P3I C;  3AZH C;  3X1T C;  3B0C W;  1ULY A;  4JJN B;  4YS3 C;  1P3O D;  3REL A;  3VH5 A;  4XUJ C;  5B1L D;  3B0D B;  5BNX A;  5GT0 B;  3KWQ B;  4J8V A;  3REL C;  3AZI B;  3UT9 D;  4M6B A;  5F99 A;  4J8V C;  5AV5 A;  2HIO A;  4J8W A;  4H9R A;  2NQB C;  2CV5 A;  5AV5 C;  4J8W C;  1BFM A;  3W96 C;  2CV5 C;  3LZ0 C;  2HUE C;  3B0B A;  3B6G B;  5B0Y A;  3AV2 C;  5AV8 B;  3W99 B;  4E45 A;  2IO5 C;  3MVD A;  5DNN B;  2JCH A;  2Y2G A;  3X1S B;  3MVD C;  5AY8 B;  3AN2 A;  5CPI B;  1KX4 D;  3AN2 C;  2Y2L A;  3AZM D;  1KX3 D;  5B31 D;  5GSU C;  3AZF B;  2NZD B;  4JJN C;  4Z66 B;  4WU8 D;  3AYW B;  3KWQ A;  3REK D;  4YM6 B;  3B0D C;  2BYM A;  5GT0 C;  3KWQ C;  3AZI C;  1M1A B;  5CPJ B;  5B24 D;  2ARO B;  2BYK B;  4WU9 A;  5GT3 D;  3B6G A;  5JRG D;  2PYO B;  3W99 A;  5B32 D;  3B6G C;  3AFA D;  4WV4 B;  1A7W A;  5AV8 C;  3W99 C;  3UTB B;  3LJA D;  3O62 D;  1U35 D;  3TU4 B;  4J8U D;  3X1S A;  1EQZ D;  5DNN C;  5CPI A;  3W97 B;  5CP6 B;  3X1S C;  5AY8 C;  4ZUX D;  1M19 D;  2JSS A;  1T3U A;  3AZF A;  2NZD A;  4X23 D;  5AVC D;  3WTP E;  3AZF C;  2NZD C;  3REI A;  3AYW A;  5B2I B;  4E44 A;  3X1V A;  5AV9 D;  4Z66 C;  4Z2M G;  2J8P A;  3KXB B;  3AYW C;  1M1A A;  1H3O A;  4YM6 C;  1B67 A;  1M1A C;  3MGS C;  3AL0 C;  4KGC B;  5CPJ C;  2BYK A;  4WNN B;  1M18 A;  5B33 A;  3A6N D;  3X1U B;  4DRB A;  2ARO C;  3LZ1 D;  3MGQ D;  1WWI A;  5B0Z D;  2PYO C;  2FFF B;  3UTB A;  3AV1 B;  4LD9 B;  1P3B D;  3TU4 A;  3UTB C;  3WAA A;  3TU4 C;  2FJ7 D;  2Y2O A;  1N1J B;  1P3P B;  3W97 A;  5CP6 A;  1R4V A;  3MGR A;  3W97 C;  5CP6 C;  1F1E A;  3AZJ B;  3W98 B;  5CPK D;  4KUD D;  3WKJ A;  3X1T B;  5B2I A;  3REJ B;  3C1B B;  4H9Q B;  5AVB B;  3REH B;  1ID3 A;  3WA9 A;  3KXB C;  1P3M B;  2RVQ C;  3VH6 W;  1JFI B;  4KGC A;  2YFW B;  4WNN A;  4J8V D;  4KGC C; 
#chains in the Genus database with same CATH homology
 5F99 D;  5AV5 D;  4Z5T B;  2HIO D;  3X1U C;  4J8W D;  3AZE B;  3UTA B;  2CV5 D;  1ZLA B;  1P3K B;  4H9N B;  3VH6 T;  3AV1 A;  4KHA A;  1BH8 B;  5B0Y D;  3AZG B;  3AV1 C;  4LD9 C;  1WWS A;  5AV6 B;  1P3L B;  1P3P C;  3MVD D;  2F2A C;  4DQY B;  4H9S A;  2Y2K A;  3AN2 D;  4NFT A;  4G92 B;  1HQ3 B;  4QLC B;  3AZJ C;  3W98 C;  1P3I A;  3AZH A;  3X1T A;  5GSU B;  2Y2P A;  5G49 B;  3REJ A;  3C1B A;  4YS3 A;  4H9Q A;  3REJ C;  3C1B C;  2RIQ A;  4XUJ A;  4H9P B;  5AVB C;  1P3M A;  2UWX A;  3REH C;  1JFI A;  1TZY B;  3KWQ D;  1P3M C;  2NQB A;  1AOI B;  1Q9C A;  4Z5T A;  3W96 A;  1P3F B;  3LZ0 A;  1P3K A;  1S32 B;  1ZLA A;  4Z5T C;  3AZE C;  3AV2 A;  4H9N A;  3B6F B;  4WU9 D;  3UTA C;  1ZLA C;  1P3K C;  3B6G D;  5DNM B;  3AZG A;  3FDD A;  5GXQ B;  3W99 D;  4R8P B;  3AZG C;  1P3L A;  4UUZ A;  5AV6 C;  1P3L C;  3X1S D;  1HQ3 A;  4QLC A;  5CPI D;  4CAY B;  5B40 B;  4G92 C;  5GSU A;  1HQ3 C;  4QLC C;  4WJ3 C;  1P3G B;  4JJN A;  3AZF D;  2NZD D;  4H9P A;  1P34 B;  3REI D;  5GT0 A;  3AZI A;  4WZS B;  2Y2Q A;  3X1V D;  2ZY5 A;  1M1A D;  1TZY C;  3MGS B;  1AOI A;  3VH6 A;  3LEL B;  1AOI C;  1S32 A;  1M18 D;  5B33 D;  1P3F C;  4XZQ B;  1S32 C;  3B6F C;  5AV8 A;  5GXQ A;  5DNM C;  1KX4 B;  4R8P A;  5GXQ C;  3AZM B;  4R8P C;  4AWL B;  3TU4 D;  5DNN A;  2ZY4 A;  3WAA D;  5AY8 A;  1TAF B;  3REK B;  5CP6 D;  3W97 D;  5B1M B;  5B40 A;  3MGR D;  5B40 C;  1P3G A;  5B24 B;  1P34 A;  1P3G C;  4Z66 A;  3WKJ D;  5GT3 B;  5B2I D;  1P34 C;  3AZL B;  1Z2C B;  4YM6 A;  2F8N G;  3MGS A;  5B32 B;  1ID3 D;  1BH9 B;  3LEL A;  5CPJ A;  3WA9 D;  2XD1 A;  4NE6 A;  4Z2M H;  4HGA B;  4KGC D;  2ARO A;  3LEL C;  3MGP B;  2ZY2 A;  1U35 B;  3NQU B;  4XZQ A;  3A1K A;  4J8U B;  2PYO A;  4J8X B;  1P3A B;  5C3I B;  4XZQ C;  5BNV B;  1KX5 B;  1M19 B;  1KX4 C;  3AV1 D;  2JE5 A;  3AZM C;  5AVC B;  4AWL C;  2ZM5 A;  5B1M A;  5AV9 B;  1F66 B;  3REK C;  5B1M C;  2VQR A;  4ZBJ B;  1W2E A;  1P3I D;  4NE5 A;  5B24 C;  3X1T D;  3A6N B;  3AZH D;  1ZLA D;  3REJ D;  4YS3 D;  3C1B D;  3MGQ B;  3AZL A;  3KXB A;  5GT3 C;  3KUY B;  5B0Z B;  3AZL C;  3V9R B;  4XUJ D;  3REL D;  1P3M D;  3WTP B;  2F8N B;  5B32 C;  3MGP A;  1P3B B;  4CSR B;  3NQU A;  3X1U A;  4HGA C;  3KFU G;  3MGP C;  2NQB D;  1U35 C;  4J8X A;  1P3A A;  4J8U C;  4Z5T D;  5BNV A;  1KX5 A;  3W96 D;  2DQN C;  4UPK A;  5JA4 B;  3LZ0 D;  4J8X C;  5C3I C;  1P3A C;  2Y2M A;  3AV2 D;  1P3K D;  1KX5 C;  4LD9 A;  1M19 C;  3AZG D;  5CHL B;  5AVC A;  4KUD B;  1N1J A;  1P3P A;  5AVC C;  2G5H C;  5B2J B;  1P3L D;  5E5A B;  1F66 A;  3AZJ A;  5AV9 C;  3W98 A;  1F66 C;  1B6W A;  1HQ3 D;  4QLC D;  4ZBJ C;  5GSU D;  2Y2I A;  5F99 B;  5AVB A;  3A6N C;  4NE3 A;  3KUY A;  3REH A;  2HIO B;  4JJN D;  4H9R B;  3V9R A;  2Y2J A;  3MGQ C;  3MNN B;  3WTP A;  3EPL A;  3KUY C;  2F8N A;  5B0Z C;  2YFW A;  5BS7 A;  5GT0 D;  3WTP C;  3AZI D;  5B0Y B;  5BS7 C;  1P3B C;  3KSY A;  3AZE A;  1PZR A;  3AZK B;  2XD5 A;  3UTA A;  5JA4 A;  1BH8 A;  3AZN B;  5AV8 D;  5GXQ D;  5B31 G;  4R8P D;  2ZY3 A;  3C1C B;  5AV6 A;  4KUD C;  5B2J A;  5E5A A;  4DRA A;  1P3O B;  5DNN D;  3IP4 C;  2Y2N A;  5B2J C;  5E5A C;  2L5A A;  5AY8 D;  5B1L B;  3A1I A;  5B40 D;  3UT9 B;  5G49 A;  2BYM B;  1KU5 A;  1P3G D;  3B0C T;  5F99 C;  5BT1 C;  5BO0 B;  3MNN A;  1P34 D;  2F8N K;  2HIO C;  4Z66 D;  4WU9 B;  5B32 G;  1TZY A;  3MNN C;  3AYW D;  4YM6 D;  3MGS D;  5B0Y C;  5CPJ D;  3LEL D;  3AZK A;  1P3F A;  2ARO D;  3B6F A;  3AZK C;  4XZQ D;  5DNM A;  2BG1 A;  2PYO D;  3AZN A;  3AZN C;  3C1C A;  3UTB D;  1KX3 B;  2YFV B;  5B31 B;  3C1C C;  1P3O A;  3R45 B;  1P3O C;  4WU8 B;  5B1L A;  3REI B;  4CAY A;  5B1M D;  3X1V B;  3UT9 A;  5B1L C;  3UT9 C;  1H3O B;  5BO0 A;  1M18 B;  5B33 B;  5JRG B;  3AZL D;  3KXB D;  2DF4 C;  2RVQ D;  4WU9 C;  3AFA B;  3LJA B;  3NQJ B;  2G5I C;  2F8N H;  3O62 B;  3MGP D;  5FUG B;  3X1U D;  3WAA B;  1EQZ B;  4J8X D;  1P3A D;  1KX4 A;  1KX5 D;  1HTA A;  3MGR B;  5CPI C;  4ZUX B;  3AZM A;  1KX3 A;  4LD9 D;  2YFV A;  4H9O B;  5B31 A;  4X23 B;  1KX3 C;  5B31 C;  3R45 A;  3WKJ B;  4WU8 A;  1TAF A;  1P3P D;  3REK A;  3VH5 W;  4G91 B;  4EO5 B;  4WU8 C;  1F66 D;  3REI C;  3AZJ D;  3X1V C;  1ID3 B;  3WA9 B;  3W98 D;  5B24 A;  5GT3 A;  3LZ1 B;  5JRG A;  3VH5 T;  5AVB D;  1M18 C;  2W8S A;  5B33 C;  3REH D;  3KUY D;  5B32 A;  5JRG C;  1BH9 A;  3AFA A;  3WTP D;  2F8N D;  3LJA A;  3NQJ A;  5KDM B;  3O62 A;  3AFA C;  3EPK A;  1U35 A;  4KHA B;  5FUG A;  3LJA C;  4J8U A;  3O62 C;  1EQZ A;  2FJ7 B;  3F6T A;  3AZE D;  3WAA C;  3UTA D;  1EQZ C;  4ZUX A;  1M19 A;  4H9O A;  3MGR C;  4ZUX C;  4X23 A;  5CPK B;  1P3I B;  4X23 C;  3AZH B;  3EG5 B;  5AV6 D;  3EPJ A;  2Y2H A;  4YS3 B;  5B2J D;  5AV9 A;  3WKJ C;  5E5A D;  5B2I C;  4G91 C;  4EO5 C;  4XUJ B;  3REL B;  1ID3 C;  3WA9 C;  5BNX B;  4J8V B;  3A6N A;  3LZ1 A;  2NQB B;  3MGQ A;  3H0M C;  2CWE A;  5BT1 D;  3H0L C;  5AV5 B;  3LZ1 C;  4J8W B;  5B0Z A;  3W96 B;  2CV5 B;  3MNN D;  2HUE B;  3LZ0 B;  3AV2 B;  5KDM A;  1P3B A;  4CSR A;  1TZY D;  1AOI D;  2FJ7 A;  2IO5 B;  3AZK D;  3P5J B;  1P3F D;  2FJ7 C;  1S32 D;  4UUZ B;  2LY8 A;  3B6F D;  3MVD B;  5DNM D;  3AZN D;  3EPH A;  3AN2 B;  5CPK A;  3H0R C;  4KUD A;  4H9S C;  3C1C D;  5CPK C;  1P3I C;  3AZH C;  3X1T C;  3B0C W;  1ULY A;  4JJN B;  4YS3 C;  1P3O D;  3REL A;  3VH5 A;  4XUJ C;  5B1L D;  3B0D B;  5BNX A;  5GT0 B;  3KWQ B;  4J8V A;  3REL C;  3AZI B;  3UT9 D;  4M6B A;  5F99 A;  4J8V C;  5AV5 A;  2HIO A;  4J8W A;  4H9R A;  2NQB C;  2CV5 A;  5AV5 C;  4J8W C;  1BFM A;  3W96 C;  2CV5 C;  3LZ0 C;  2HUE C;  3B0B A;  3B6G B;  5B0Y A;  3AV2 C;  5AV8 B;  3W99 B;  4E45 A;  2IO5 C;  3MVD A;  5DNN B;  2JCH A;  2Y2G A;  3X1S B;  3MVD C;  5AY8 B;  3AN2 A;  5CPI B;  1KX4 D;  3AN2 C;  2Y2L A;  3AZM D;  1KX3 D;  5B31 D;  5GSU C;  3AZF B;  2NZD B;  4JJN C;  4Z66 B;  4WU8 D;  3AYW B;  3KWQ A;  3REK D;  4YM6 B;  3B0D C;  2BYM A;  5GT0 C;  3KWQ C;  3AZI C;  1M1A B;  5CPJ B;  5B24 D;  2ARO B;  2BYK B;  4WU9 A;  5GT3 D;  3B6G A;  5JRG D;  2PYO B;  3W99 A;  5B32 D;  3B6G C;  3AFA D;  4WV4 B;  1A7W A;  5AV8 C;  3W99 C;  3UTB B;  3LJA D;  3O62 D;  1U35 D;  3TU4 B;  4J8U D;  3X1S A;  1EQZ D;  5DNN C;  5CPI A;  3W97 B;  5CP6 B;  3X1S C;  5AY8 C;  4ZUX D;  1M19 D;  2JSS A;  1T3U A;  3AZF A;  2NZD A;  4X23 D;  5AVC D;  3WTP E;  3AZF C;  2NZD C;  3REI A;  3AYW A;  5B2I B;  4E44 A;  3X1V A;  5AV9 D;  4Z66 C;  4Z2M G;  2J8P A;  3KXB B;  3AYW C;  1M1A A;  1H3O A;  4YM6 C;  1B67 A;  1M1A C;  3MGS C;  3AL0 C;  4KGC B;  5CPJ C;  2BYK A;  4WNN B;  1M18 A;  5B33 A;  3A6N D;  3X1U B;  4DRB A;  2ARO C;  3LZ1 D;  3MGQ D;  1WWI A;  5B0Z D;  2PYO C;  2FFF B;  3UTB A;  3AV1 B;  4LD9 B;  1P3B D;  3TU4 A;  3UTB C;  3WAA A;  3TU4 C;  2FJ7 D;  2Y2O A;  1N1J B;  1P3P B;  3W97 A;  5CP6 A;  1R4V A;  3MGR A;  3W97 C;  5CP6 C;  1F1E A;  3AZJ B;  3W98 B;  5CPK D;  4KUD D;  3WKJ A;  3X1T B;  5B2I A;  3REJ B;  3C1B B;  4H9Q B;  5AVB B;  3REH B;  1ID3 A;  3WA9 A;  3KXB C;  1P3M B;  2RVQ C;  3VH6 W;  1JFI B;  4KGC A;  2YFW B;  4WNN A;  4J8V D;  4KGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...