5B1LD

The mouse nucleosome structure containing h3t
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
GRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lD00
3X1UB 4ZUXC 3RELC 1P3OA 4QLCA 3W99D 3B6FD 2YFWA 2CV5D 3AZLA 3W99C 3B6FC 3MNND 2CV5C 4EO5C 5AV8A 3O62A 1WWSA 1P3GB 3MNNC 4WU8A 3LELD 5C3IB 1TAFB 1U35D 3KWQD 3AV2D 3B6GB 1R4VA 4KGCB 3LELC 1U35C 3KWQC 1H3OA 5B0ZB 1B67A 2YFVB 3AV2C 4Z5TA 3MGPA 1M1AA 4LD9B 3UTBB 3AN2B 1KX5B 5CP6A 3AZGB 5JRGA 5AV9D 5DNMA 5CPID 3VH5A 4X23D 2F8NB 3X1TB 5AY8A 3B0CW 3W97A 5AV9C 5CPIC 5B31G 3LZ0D 4X23C 4J8VB 2JSSA 4J8UD 5GXQB 2HIOB 3WTPA 3WA9D 3AZIB 5F99A 3VH6W 3C1CB 3REHD 3W98B 3TU4D 1B6WA 3LZ0C 5GSUA 4J8UC 1P34D 1M18B 2NQBA 3WA9C 3REHC 3TU4C 4QLCB 1P34C 1ZLAD 1HTAA 3B0BA 4CSRA 4H9PA 4J8WA 2CWEA 3AZLB 3W96D 1S32D 1P3PD 1ZLAC 5AV8B 3O62B 4H9NA 2IO5B 4WZSB 3AV1B 3W96C 3AZHA 1S32C 1P3PC 1P3KD 4WU8B 3WKJD 3X1VD 4WV4B 1P3KC 5B40D 3KUYA 4UUZA 5AVCA 3WKJC 3X1VC 5JA4A 3MGRA 3REJD 5CHLB 4Z5TB 5B2IA 5B40C 1P3AD 3WAAD 1ID3D 3LZ1B 4DRBA 5CP6B 3REJC 3RELA 4NFTA 5AV5A 3MGSD 3WAAC 3UTAA 1P3AC 1ID3C 5JRGB 4WU9B 1F66A 3A6NB 5FUGA 5G49A 3MGSC 5AY8B 3W99A 2F8NH 3W97B 2AROA 5AVBD 3WTPB 1P3MD 1TAFA 1KX4D 4H9QA 5GSUB 5AVBC 3AFAD 3UT9D 2F8NG 5B1MD 5B1LD 1P3MC 1KX4C 3AZFA 5GT0D 3VH6T 5GT3D 3AYWA 3AFAC 3UT9C 5B1MC 1TZYA 4CSRB 4H9PB 4J8WB 4H9RA 5B1LC 4G91B 3UTBA 1BFMA 3C1BD 5GT0C 5GT3C 3MVDD 5B32B 4M6BA 4H9NB 4Z66D 3AZHB 3C1BC 5BNXA 4R8PD 3MVDC 1WWIA 3X1TA 4Z66C 1AOID 3KUYB 3KXBD 4UUZB 2FJ7A 1ULYA 5AVCB 2HIOA 4HGAC 5B31D 5JA4B 3W98A 1AOIC 5B2IB 4XZQA 3KXBC 1M18A 1P3FA 5CPKB 5B31C 5DNNA 2HUEC 3REHA 3AZED 3RELB 3TU4A 5E5AA 5AV5B 3UTAB 5KDMA 1F66B 2F8NK 5FUGB 1P3BD 2BYMA 5G49B 3AZEC 4XUJD 5BS7C 4JJND 3W99B 3REIA 4YS3A 1P3BC 3AV1A 2AROB 3W96A 4XUJC 4JJNC 1S32A 3MNNB 4H9QB 4DRAA 1F1EA 3AZJD 1M19A 2RVQD 4J8XA 1U35B 3AZFB 3AYWB 3AZJC 4G92C 3AV2B 5B40A 2RVQC 1TZYB 3LZ1A 2PYOD 4H9RB 4E45A 4ZBJB 4KUDA 3REJA 1P3AA 4WU9A 2PYOC 3WAAA 1ID3A 1HQ3A 5B2JD 3A6NA 2NZDA 5BNXB 4KGCD 3MGSA 3AZMA 1BH8A 5B2JC 4KGCC 2FJ7B 4AWLC 4X23B 5AV6D 4XZQB 3LZ0B 1P3FB 5DNNB 3REHB 2F8ND 5AV6C 1BH9B 5E5AB 3X1SA 3TU4B 1P3LD 1KX4A 1P34B 5KDMB 3UT9A 5B33A 5GXQD 2BYMB 3AZID 1P3LC 4E44A 5GT0A 1ZLAB 5B32A 1P3ID 3REIB 4YS3B 3LJAD 5GXQC 5CPJA 3AZIC 3W96B 3C1BA 1S32B 1P3OD 1P3IC 4QLCD 2L5AA 3LJAC 4KHAA 3V9RA 3AZND 1M19B 3R45A 5B0YD 4J8XB 1P3OC 4YM6A 4QLCC 1KX3A 3MGQA 3WKJB 1EQZD 5AV8D 1AOIA 3AZNC 5B40B 5B0YC 3KXBA 5CPKA 4KUDB 5B31A 3AZKD 4ZUXA 1EQZC 3REJB 5AV8C 5BNVA 1P3AB 3WAAB 1ID3B 1HQ3B 2NZDB 3B0DC 3AZKC 4Z2MH 3MGSB 3B6FA 3AZMB 1BH8B 1A7WA 4Z5TD 3MGPD 1M1AD 2CV5A 4WNNA 1P3BA 4Z5TC 3MNNA 3MGPC 4H9SC 1M1AC 3B0CT 5DNMD 5AVBB 5B24D 3LELA 1P3MB 1U35A 5AY8D 3KWQA 1KX4B 3X1SB 3W97D 5DNMC 3AV2A 3AZJA 3UT9B 5B1MB 5B24C 5B33B 5B1LB 5AY8C 5F99D 3W97C 5GT0B 5GSUD 2NQBD 5CPJB 5BO0A 3C1BB 5F99C 5GSUC 2NQBC 5AV9A 4KHAB 5B2JA 3V9RB 3WTPE 5CPIA 4J8WD 4R8PC 3R45B 4X23A 3VH5W 4YM6B 1KX3B 3MGQB 3REKD 4J8WC 1AOIB 3LZ0A 4G91C 3KXBB 4J8UA 3AZHD 5B31B 3WA9A 3NQJA 3REKC 4ZUXB 1BH9A 5BNVB 3AZHC 1P34A 3MGRD 1P3LA 3B6FB 1ZLAA 5B2ID 2CV5B 4WNNB 4EO5B 1P3BB 3X1UD 3MGRC 1P3PA 1KU5A 5B2IC 5AV5D 3UTAD 1P3IA 3X1UC 1F66D 1P3KA 4NE3A 5AV5C 3LELB 3X1VA 3UTAC 3WKJA 3KWQB 4H9OA 1F66C 3AZJB 4G92B 3AZNA 5B0YA 2AROD 1P3GD 1EQZA 2AROC 2PYOB 1P3GC 5BO0B 3B6GD 3AZKA 5C3IC 5B0ZD 3AZFD 3AYWD 4LD9D 5AV9B 5B2JB 5CPIB 3B6GC 1TZYD 3UTBD 3AN2D 4AWLB 5B0ZC 1KX5D 5B32G 3AZFC 3AYWC 3AZGD 3NQUB 4LD9C 1JFIA 1TZYC 4H9SA 3UTBC 3AN2C 4ZBJC 4J8UB 1KX5C 5AVBA 3WA9B 3AZGC 3NQJB 3VH5T 3X1TD 1P3MA 5AV6B 3AFAA 4J8VD 5B1MA 2FJ7D 5B1LA 2HIOD 5B24A 3X1TC 3C1CD 3W98D 5GT3A 1P3LB 4CAYA 4J8VC 4XZQD 2FJ7C 1M18D 1P3FD 2HIOC 2BYKA 5DNND 3C1CC 1P3PB 3W98C 3MVDA 5E5AD 4XZQC 1P3IB 1Q9CA 4Z66A 1P3FC 1M18C 3LJAB 5DNNC 3AZLD 1P3KB 4R8PA 1P3OB 5E5AC 3X1VB 2LY8A 4H9OB 2YFWB 3O62D 3AZLC 4YS3D 3REID 3AZNB 3AV1D 5B0YB 4WU8D 3O62C 3REKA 1EQZB 4YS3C 3REIC 2IO5C 3AV1C 1N1JA 1M19D 4J8XD 3B0DB 3AZKB 4WU8C 3AZEA 5BS7A 1M19C 4J8XC 3LZ1D 4KUDD 4XUJA 5CP6D 4JJNA 1H3OB 4Z2MG 3MGPB 1M1AB 1JFIB 3KSYA 5JRGD 4WU9D 3LZ1C 1HQ3D 3A6ND 4KUDC 3X1UA 2NZDD 5CP6C 4NE6A 5JRGC 3AZMD 4WU9C 1HQ3C 3A6NC 2NZDC 5DNMB 3AFAB 3VH6A 5B24B 3WTPD 3AZMC 5GT3B 4CAYB 5BT1D 2PYOA 3WTPC 2BYKB 1P3GA 5F99B 3MVDB 3X1SD 5BT1C 4Z66B 2NQBB 3B6GA 4KGCA 5B33D 4R8PB 4HGAB 3X1SC 5B0ZA 3NQUA 2YFVA 4LD9A 5B32D 3AN2A 5B33C 5CPJD 1KX5A 3AZGA 2HUEB 5B32C 3REKB 5AV6A 4NE5A 5CPJC 1N1JB 3KUYD 5AVCD 3AZEB 2F8NA 4YM6D 1KX3D 3MGQD 3KUYC 5AVCC 4J8VA 5CPKD 5GXQA 4YM6C 1KX3C 3MGQC 3AZIA 4XUJB 3MGRB 4JJNB 3C1CA 4ZUXD 3RELD 5CPKC 3LJAA
chains in the Genus database with same CATH superfamily
3X1UB 4ZUXC 2ZM5A 3RELC 1P3OA 4QLCA 3W99D 3B6FD 2YFWA 2CV5D 3AZLA 3A1IA 3W99C 3B6FC 3MNND 4WJ3C 2CV5C 4EO5C 5AV8A 3O62A 1WWSA 2ZY4A 1P3GB 3MNNC 4WU8A 3LELD 5C3IB 1TAFB 1U35D 3KWQD 3AV2D 3B6GB 1R4VA 4KGCB 3LELC 1U35C 3KWQC 1H3OA 5B0ZB 1B67A 2YFVB 3AV2C 4Z5TA 3MGPA 1M1AA 4LD9B 2Y2IA 3UTBB 3AN2B 1KX5B 5CP6A 3AZGB 3IP4C 5JRGA 2JE5A 5AV9D 5DNMA 5CPID 3VH5A 4X23D 2F8NB 3X1TB 5AY8A 3B0CW 3W97A 5AV9C 5CPIC 2RIQA 5B31G 3LZ0D 4X23C 4J8VB 2JSSA 4J8UD 5GXQB 2HIOB 3WTPA 3WA9D 3AZIB 5F99A 3VH6W 3C1CB 3REHD 3W98B 3TU4D 1B6WA 2F2AC 3LZ0C 5GSUA 4J8UC 1P34D 1M18B 2NQBA 3WA9C 3REHC 3TU4C 4QLCB 1P34C 1ZLAD 1HTAA 3B0BA 4CSRA 4H9PA 4J8WA 2CWEA 3AZLB 3W96D 1S32D 1P3PD 1ZLAC 5AV8B 3O62B 4H9NA 2IO5B 4WZSB 3AV1B 3W96C 3AZHA 2Y2KA 1S32C 1P3PC 1P3KD 4WU8B 3WKJD 3X1VD 4WV4B 2DQNC 1P3KC 5B40D 3KUYA 4UUZA 5AVCA 3H0MC 3WKJC 3X1VC 5JA4A 3MGRA 3REJD 5CHLB 4Z5TB 5B2IA 5B40C 1P3AD 3WAAD 1ID3D 3LZ1B 4DRBA 5CP6B 3REJC 3RELA 4NFTA 5AV5A 3MGSD 3WAAC 3UTAA 1P3AC 1ID3C 2Y2GA 5JRGB 4WU9B 1F66A 3A6NB 5FUGA 2Y2LA 5G49A 3MGSC 5AY8B 3W99A 2F8NH 3W97B 2AROA 5AVBD 3WTPB 2Y2PA 1P3MD 1TAFA 1KX4D 4H9QA 5GSUB 5AVBC 3AFAD 3UT9D 2F8NG 5B1MD 4DQYB 5B1LD 1P3MC 1KX4C 3AZFA 5GT0D 3VH6T 5GT3D 3AYWA 3AFAC 3UT9C 5B1MC 1TZYA 4CSRB 4H9PB 4J8WB 4H9RA 5B1LC 1PZRA 4G91B 3UTBA 3C1BD 5GT0C 5GT3C 3MVDD 5B32B 4M6BA 4H9NB 4Z66D 3AZHB 3C1BC 5BNXA 4R8PD 3MVDC 1WWIA 3X1TA 4Z66C 1AOID 3KUYB 3KXBD 4UUZB 2FJ7A 1ULYA 5AVCB 2HIOA 4HGAC 5B31D 5JA4B 3W98A 1AOIC 5B2IB 2ZY3A 4XZQA 3KXBC 1M18A 1P3FA 5CPKB 5B31C 5DNNA 2HUEC 3REHA 2Y2OA 3AZED 3RELB 3TU4A 5E5AA 5AV5B 3UTAB 5KDMA 1F66B 2F8NK 5FUGB 1P3BD 2BYMA 5G49B 3AZEC 4XUJD 5BS7C 4JJND 3W99B 3REIA 4YS3A 1P3BC 3AV1A 2AROB 3W96A 4XUJC 4JJNC 1S32A 3MNNB 4H9QB 4DRAA 1F1EA 3AZJD 1M19A 2RVQD 4J8XA 1U35B 3AZFB 3AYWB 3AZJC 4G92C 3AV2B 5B40A 2RVQC 1TZYB 3LZ1A 2PYOD 4H9RB 4E45A 4ZBJB 4KUDA 3REJA 1P3AA 4WU9A 2PYOC 3EG5B 3WAAA 1ID3A 1HQ3A 5B2JD 3A6NA 2NZDA 5BNXB 4KGCD 3MGSA 3AZMA 1BH8A 5B2JC 4KGCC 2FJ7B 4AWLC 4X23B 2Y2JA 3A1KA 3FDDA 2Y2NA 5AV6D 4XZQB 3LZ0B 1P3FB 5DNNB 3REHB 2F8ND 5AV6C 1BH9B 5E5AB 3X1SA 3TU4B 1P3LD 1KX4A 1P34B 5KDMB 2Y2HA 3UT9A 5B33A 5GXQD 2BYMB 5CPKC 4UPKA 3AZID 1P3LC 4E44A 5GT0A 1ZLAB 5B32A 1P3ID 3REIB 4YS3B 3LJAD 5GXQC 5CPJA 3AZIC 3H0LC 3C1BA 1S32B 3W96B 1P3OD 1P3IC 4QLCD 2L5AA 3LJAC 4KHAA 3V9RA 2DF4C 3AZND 1M19B 3R45A 5B0YD 4J8XB 1P3OC 4QLCC 4YM6A 1KX3A 3MGQA 3WKJB 1EQZD 5AV8D 1AOIA 3AZNC 5B40B 5B0YC 3KXBA 5CPKA 2G5IC 4KUDB 5B31A 3AZKD 4ZUXA 1EQZC 3REJB 5AV8C 5BNVA 1P3AB 3WAAB 1ID3B 1HQ3B 2NZDB 3B0DC 3AZKC 4Z2MH 3MGSB 3B6FA 3AZMB 1BH8B 1A7WA 4Z5TD 3MGPD 1M1AD 2CV5A 4WNNA 1P3BA 4Z5TC 3MNNA 3MGPC 4H9SC 1M1AC 3B0CT 2G5HC 5DNMD 5AVBB 5B24D 3LELA 1P3MB 1U35A 5AY8D 3KWQA 1KX4B 3X1SB 3W97D 5DNMC 3AV2A 3AZJA 3UT9B 5B1MB 5B24C 5B33B 5B1LB 5AY8C 5F99D 3W97C 5GT0B 5GSUD 2NQBD 5CPJB 5BO0A 3C1BB 5F99C 5GSUC 2NQBC 5AV9A 4KHAB 5B2JA 3V9RB 3WTPE 5CPIA 4J8WD 4R8PC 3R45B 4X23A 3VH5W 4YM6B 1KX3B 3MGQB 3REKD 4J8WC 1AOIB 3LZ0A 4G91C 3KXBB 4J8UA 3AZHD 5B31B 2XD1A 3WA9A 3NQJA 3REKC 4ZUXB 1BH9A 5BNVB 3AZHC 1P34A 1T3UA 1W2EA 3MGRD 1P3LA 3B6FB 1ZLAA 5B2ID 2CV5B 4WNNB 4EO5B 2ZY5A 1P3BB 1Z2CB 3X1UD 3MGRC 1P3PA 1KU5A 5B2IC 5AV5D 3UTAD 1P3IA 3X1UC 1F66D 1P3KA 3P5JB 4NE3A 5AV5C 3LELB 3X1VA 3UTAC 3WKJA 3KWQB 4H9OA 1F66C 3AZJB 4G92B 3AZNA 5B0YA 2AROD 1P3GD 1EQZA 2AROC 2PYOB 1P3GC 2BG1A 5BO0B 3B6GD 3AZKA 5C3IC 5B0ZD 3AZFD 3AYWD 4LD9D 5AV9B 2VQRA 5B2JB 5CPIB 3B6GC 1TZYD 2Y2MA 3UTBD 3AN2D 4AWLB 5B0ZC 1KX5D 5B32G 3AZFC 3AYWC 3AZGD 3NQUB 4LD9C 1JFIA 1TZYC 4H9SA 3UTBC 3AN2C 4ZBJC 4J8UB 1KX5C 5AVBA 3WA9B 3AZGC 3NQJB 3VH5T 3X1TD 1P3MA 5AV6B 3AFAA 4J8VD 5B1MA 2FJ7D 2W8SA 2HIOD 5B1LA 5B24A 3X1TC 3C1CD 3W98D 5GT3A 1P3LB 4CAYA 4J8VC 4XZQD 2FJ7C 3KFUG 1M18D 1P3FD 2HIOC 2BYKA 5DNND 3C1CC 1P3PB 3W98C 3AL0C 3MVDA 5E5AD 4XZQC 1P3IB 1Q9CA 4Z66A 1P3FC 1M18C 3LJAB 5DNNC 3AZLD 1P3KB 4R8PA 1P3OB 5E5AC 3H0RC 3EPJA 3X1VB 2LY8A 4H9OB 2YFWB 3O62D 3AZLC 2Y2QA 4YS3D 3REID 3AZNB 3AV1D 5B0YB 3EPHA 2J8PA 2ZY2A 3EPLA 4WU8D 3O62C 3REKA 1EQZB 4YS3C 3REIC 2IO5C 3AV1C 1N1JA 2FFFB 1M19D 4J8XD 3B0DB 3AZKB 4WU8C 3AZEA 5BS7A 2XD5A 1M19C 4J8XC 3LZ1D 4KUDD 4XUJA 5CP6D 4JJNA 1H3OB 4Z2MG 3MGPB 1M1AB 1JFIB 3KSYA 5JRGD 4WU9D 3LZ1C 1HQ3D 3A6ND 4KUDC 3X1UA 2NZDD 5CP6C 4NE6A 5JRGC 3AZMD 4WU9C 1HQ3C 3A6NC 2NZDC 5DNMB 3AFAB 3VH6A 5B24B 3WTPD 3AZMC 5GT3B 4CAYB 5BT1D 2PYOA 3WTPC 2BYKB 1P3GA 5F99B 3MVDB 3F6TA 3X1SD 5BT1C 4Z66B 2NQBB 3B6GA 4KGCA 5B33D 4R8PB 4HGAB 3X1SC 5B0ZA 3NQUA 2YFVA 4LD9A 5B32D 3AN2A 5B33C 5CPJD 3EPKA 1KX5A 3AZGA 2HUEB 5B32C 3REKB 5AV6A 4NE5A 5CPJC 1N1JB 3KUYD 5AVCD 3AZEB 2F8NA 4YM6D 1KX3D 3MGQD 1BFMA 2JCHA 3KUYC 5AVCC 4J8VA 5CPKD 5GXQA 4YM6C 1KX3C 3MGQC 3AZIA 4XUJB 3MGRB 4JJNB 3C1CA 4ZUXD 3RELD 2UWXA 3LJAA
chains in the Genus database with same CATH topology
3X1UB 4ZUXC 2ZM5A 3RELC 1P3OA 4QLCA 3W99D 3B6FD 2YFWA 2CV5D 3AZLA 3A1IA 3W99C 3B6FC 3MNND 4WJ3C 2CV5C 4EO5C 5AV8A 3O62A 1WWSA 2ZY4A 1P3GB 3MNNC 4WU8A 3LELD 5C3IB 1TAFB 1U35D 3KWQD 3AV2D 3B6GB 1R4VA 4KGCB 3LELC 1U35C 3KWQC 1H3OA 5B0ZB 1B67A 2YFVB 3AV2C 4Z5TA 3MGPA 1M1AA 4LD9B 2Y2IA 3UTBB 3AN2B 1KX5B 5CP6A 3AZGB 3IP4C 5JRGA 2JE5A 5AV9D 5DNMA 5CPID 3VH5A 4X23D 2F8NB 3X1TB 5AY8A 3B0CW 3W97A 5AV9C 5CPIC 2RIQA 5B31G 3LZ0D 4X23C 4J8VB 2JSSA 4J8UD 5GXQB 2HIOB 3WTPA 3WA9D 3AZIB 5F99A 3VH6W 3C1CB 3REHD 3W98B 3TU4D 1B6WA 2F2AC 3LZ0C 5GSUA 4J8UC 1P34D 1M18B 2NQBA 3WA9C 3REHC 3TU4C 4QLCB 1P34C 1ZLAD 1HTAA 3B0BA 4CSRA 4H9PA 4J8WA 2CWEA 3AZLB 3W96D 1S32D 1P3PD 1ZLAC 5AV8B 3O62B 4H9NA 2IO5B 4WZSB 3AV1B 3W96C 3AZHA 2Y2KA 1S32C 1P3PC 1P3KD 4WU8B 3WKJD 3X1VD 4WV4B 2DQNC 1P3KC 5B40D 3KUYA 4UUZA 5AVCA 3H0MC 3WKJC 3X1VC 5JA4A 3MGRA 3REJD 5CHLB 4Z5TB 5B2IA 5B40C 1P3AD 3WAAD 1ID3D 3LZ1B 4DRBA 5CP6B 3REJC 3RELA 4NFTA 5AV5A 3MGSD 3WAAC 3UTAA 1P3AC 1ID3C 2Y2GA 5JRGB 4WU9B 1F66A 3A6NB 5FUGA 2Y2LA 5G49A 3MGSC 5AY8B 3W99A 2F8NH 3W97B 2AROA 5AVBD 3WTPB 2Y2PA 1P3MD 1TAFA 1KX4D 4H9QA 5GSUB 5AVBC 3AFAD 3UT9D 2F8NG 5B1MD 4DQYB 5B1LD 1P3MC 1KX4C 3AZFA 5GT0D 3VH6T 5GT3D 3AYWA 3AFAC 3UT9C 5B1MC 1TZYA 4CSRB 4H9PB 4J8WB 4H9RA 5B1LC 1PZRA 4G91B 3UTBA 3C1BD 5GT0C 5GT3C 3MVDD 5B32B 4M6BA 4H9NB 4Z66D 3AZHB 3C1BC 5BNXA 4R8PD 3MVDC 1WWIA 3X1TA 4Z66C 1AOID 3KUYB 3KXBD 4UUZB 2FJ7A 1ULYA 5AVCB 2HIOA 4HGAC 5B31D 5JA4B 3W98A 1AOIC 5B2IB 2ZY3A 4XZQA 3KXBC 1M18A 1P3FA 5CPKB 5B31C 5DNNA 2HUEC 3REHA 2Y2OA 3AZED 3RELB 3TU4A 5E5AA 5AV5B 3UTAB 5KDMA 1F66B 2F8NK 5FUGB 1P3BD 2BYMA 5G49B 3AZEC 4XUJD 5BS7C 4JJND 3W99B 3REIA 4YS3A 1P3BC 3AV1A 2AROB 3W96A 4XUJC 4JJNC 1S32A 3MNNB 4H9QB 4DRAA 1F1EA 3AZJD 1M19A 2RVQD 4J8XA 1U35B 3AZFB 3AYWB 3AZJC 4G92C 3AV2B 5B40A 2RVQC 1TZYB 3LZ1A 2PYOD 4H9RB 4E45A 4ZBJB 4KUDA 3REJA 1P3AA 4WU9A 2PYOC 3EG5B 3WAAA 1ID3A 1HQ3A 5B2JD 3A6NA 2NZDA 5BNXB 4KGCD 3MGSA 3AZMA 1BH8A 5B2JC 4KGCC 2FJ7B 4AWLC 4X23B 2Y2JA 3A1KA 3FDDA 2Y2NA 5AV6D 4XZQB 3LZ0B 1P3FB 5DNNB 3REHB 2F8ND 5AV6C 1BH9B 5E5AB 3X1SA 3TU4B 1P3LD 1KX4A 1P34B 5KDMB 2Y2HA 3UT9A 5B33A 5GXQD 2BYMB 5CPKC 4UPKA 3AZID 1P3LC 4E44A 5GT0A 1ZLAB 5B32A 1P3ID 3REIB 4YS3B 3LJAD 5GXQC 5CPJA 3AZIC 3H0LC 3C1BA 1S32B 3W96B 1P3OD 1P3IC 4QLCD 2L5AA 3LJAC 4KHAA 3V9RA 2DF4C 3AZND 1M19B 3R45A 5B0YD 4J8XB 1P3OC 4QLCC 4YM6A 1KX3A 3MGQA 3WKJB 1EQZD 5AV8D 1AOIA 3AZNC 5B40B 5B0YC 3KXBA 5CPKA 2G5IC 4KUDB 5B31A 3AZKD 4ZUXA 1EQZC 3REJB 5AV8C 5BNVA 1P3AB 3WAAB 1ID3B 1HQ3B 2NZDB 3B0DC 3AZKC 4Z2MH 3MGSB 3B6FA 3AZMB 1BH8B 1A7WA 4Z5TD 3MGPD 1M1AD 2CV5A 4WNNA 1P3BA 4Z5TC 3MNNA 3MGPC 4H9SC 1M1AC 3B0CT 2G5HC 5DNMD 5AVBB 5B24D 3LELA 1P3MB 1U35A 5AY8D 3KWQA 1KX4B 3X1SB 3W97D 5DNMC 3AV2A 3AZJA 3UT9B 5B1MB 5B24C 5B33B 5B1LB 5AY8C 5F99D 3W97C 5GT0B 5GSUD 2NQBD 5CPJB 5BO0A 3C1BB 5F99C 5GSUC 2NQBC 5AV9A 4KHAB 5B2JA 3V9RB 3WTPE 5CPIA 4J8WD 4R8PC 3R45B 4X23A 3VH5W 4YM6B 1KX3B 3MGQB 3REKD 4J8WC 1AOIB 3LZ0A 4G91C 3KXBB 4J8UA 3AZHD 5B31B 2XD1A 3WA9A 3NQJA 3REKC 4ZUXB 1BH9A 5BNVB 3AZHC 1P34A 1T3UA 1W2EA 3MGRD 1P3LA 3B6FB 1ZLAA 5B2ID 2CV5B 4WNNB 4EO5B 2ZY5A 1P3BB 1Z2CB 3X1UD 3MGRC 1P3PA 1KU5A 5B2IC 5AV5D 3UTAD 1P3IA 3X1UC 1F66D 1P3KA 3P5JB 4NE3A 5AV5C 3LELB 3X1VA 3UTAC 3WKJA 3KWQB 4H9OA 1F66C 3AZJB 4G92B 3AZNA 5B0YA 2AROD 1P3GD 1EQZA 2AROC 2PYOB 1P3GC 2BG1A 5BO0B 3B6GD 3AZKA 5C3IC 5B0ZD 3AZFD 3AYWD 4LD9D 5AV9B 2VQRA 5B2JB 5CPIB 3B6GC 1TZYD 2Y2MA 3UTBD 3AN2D 4AWLB 5B0ZC 1KX5D 5B32G 3AZFC 3AYWC 3AZGD 3NQUB 4LD9C 1JFIA 1TZYC 4H9SA 3UTBC 3AN2C 4ZBJC 4J8UB 1KX5C 5AVBA 3WA9B 3AZGC 3NQJB 3VH5T 3X1TD 1P3MA 5AV6B 3AFAA 4J8VD 5B1MA 2FJ7D 2W8SA 2HIOD 5B1LA 5B24A 3X1TC 3C1CD 3W98D 5GT3A 1P3LB 4CAYA 4J8VC 4XZQD 2FJ7C 3KFUG 1M18D 1P3FD 2HIOC 2BYKA 5DNND 3C1CC 1P3PB 3W98C 3AL0C 3MVDA 5E5AD 4XZQC 1P3IB 1Q9CA 4Z66A 1P3FC 1M18C 3LJAB 5DNNC 3AZLD 1P3KB 4R8PA 1P3OB 5E5AC 3H0RC 3EPJA 3X1VB 2LY8A 4H9OB 2YFWB 3O62D 3AZLC 2Y2QA 4YS3D 3REID 3AZNB 3AV1D 5B0YB 3EPHA 2J8PA 2ZY2A 3EPLA 4WU8D 3O62C 3REKA 1EQZB 4YS3C 3REIC 2IO5C 3AV1C 1N1JA 2FFFB 1M19D 4J8XD 3B0DB 3AZKB 4WU8C 3AZEA 5BS7A 2XD5A 1M19C 4J8XC 3LZ1D 4KUDD 4XUJA 5CP6D 4JJNA 1H3OB 4Z2MG 3MGPB 1M1AB 1JFIB 3KSYA 5JRGD 4WU9D 3LZ1C 1HQ3D 3A6ND 4KUDC 3X1UA 2NZDD 5CP6C 4NE6A 5JRGC 3AZMD 4WU9C 1HQ3C 3A6NC 2NZDC 5DNMB 3AFAB 3VH6A 5B24B 3WTPD 3AZMC 5GT3B 4CAYB 5BT1D 2PYOA 3WTPC 2BYKB 1P3GA 5F99B 3MVDB 3F6TA 3X1SD 5BT1C 4Z66B 2NQBB 3B6GA 4KGCA 5B33D 4R8PB 4HGAB 3X1SC 5B0ZA 3NQUA 2YFVA 4LD9A 5B32D 3AN2A 5B33C 5CPJD 3EPKA 1KX5A 3AZGA 2HUEB 5B32C 3REKB 5AV6A 4NE5A 5CPJC 1N1JB 3KUYD 5AVCD 3AZEB 2F8NA 4YM6D 1KX3D 3MGQD 1BFMA 2JCHA 3KUYC 5AVCC 4J8VA 5CPKD 5GXQA 4YM6C 1KX3C 3MGQC 3AZIA 4XUJB 3MGRB 4JJNB 3C1CA 4ZUXD 3RELD 2UWXA 3LJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U B;  4ZUX C;  3REL C;  1P3O A;  4QLC A;  3W99 D;  3B6F D;  2YFW A;  2CV5 D;  3AZL A;  3W99 C;  3B6F C;  3MNN D;  2CV5 C;  4EO5 C;  5AV8 A;  3O62 A;  1WWS A;  1P3G B;  3MNN C;  4WU8 A;  3LEL D;  5C3I B;  1TAF B;  1U35 D;  3KWQ D;  3AV2 D;  3B6G B;  1R4V A;  4KGC B;  3LEL C;  1U35 C;  3KWQ C;  1H3O A;  5B0Z B;  1B67 A;  2YFV B;  3AV2 C;  4Z5T A;  3MGP A;  1M1A A;  4LD9 B;  3UTB B;  3AN2 B;  1KX5 B;  5CP6 A;  3AZG B;  5JRG A;  5AV9 D;  5DNM A;  5CPI D;  3VH5 A;  4X23 D;  2F8N B;  3X1T B;  5AY8 A;  3B0C W;  3W97 A;  5AV9 C;  5CPI C;  5B31 G;  3LZ0 D;  4X23 C;  4J8V B;  2JSS A;  4J8U D;  5GXQ B;  2HIO B;  3WTP A;  3WA9 D;  3AZI B;  5F99 A;  3VH6 W;  3C1C B;  3REH D;  3W98 B;  3TU4 D;  1B6W A;  3LZ0 C;  5GSU A;  4J8U C;  1P34 D;  1M18 B;  2NQB A;  3WA9 C;  3REH C;  3TU4 C;  4QLC B;  1P34 C;  1ZLA D;  1HTA A;  3B0B A;  4CSR A;  4H9P A;  4J8W A;  2CWE A;  3AZL B;  3W96 D;  1S32 D;  1P3P D;  1ZLA C;  5AV8 B;  3O62 B;  4H9N A;  2IO5 B;  4WZS B;  3AV1 B;  3W96 C;  3AZH A;  1S32 C;  1P3P C;  1P3K D;  4WU8 B;  3WKJ D;  3X1V D;  4WV4 B;  1P3K C;  5B40 D;  3KUY A;  4UUZ A;  5AVC A;  3WKJ C;  3X1V C;  5JA4 A;  3MGR A;  3REJ D;  5CHL B;  4Z5T B;  5B2I A;  5B40 C;  1P3A D;  3WAA D;  1ID3 D;  3LZ1 B;  4DRB A;  5CP6 B;  3REJ C;  3REL A;  4NFT A;  5AV5 A;  3MGS D;  3WAA C;  3UTA A;  1P3A C;  1ID3 C;  5JRG B;  4WU9 B;  1F66 A;  3A6N B;  5FUG A;  5G49 A;  3MGS C;  5AY8 B;  3W99 A;  2F8N H;  3W97 B;  2ARO A;  5AVB D;  3WTP B;  1P3M D;  1TAF A;  1KX4 D;  4H9Q A;  5GSU B;  5AVB C;  3AFA D;  3UT9 D;  2F8N G;  5B1M D;  5B1L D;  1P3M C;  1KX4 C;  3AZF A;  5GT0 D;  3VH6 T;  5GT3 D;  3AYW A;  3AFA C;  3UT9 C;  5B1M C;  1TZY A;  4CSR B;  4H9P B;  4J8W B;  4H9R A;  5B1L C;  4G91 B;  3UTB A;  1BFM A;  3C1B D;  5GT0 C;  5GT3 C;  3MVD D;  5B32 B;  4M6B A;  4H9N B;  4Z66 D;  3AZH B;  3C1B C;  5BNX A;  4R8P D;  3MVD C;  1WWI A;  3X1T A;  4Z66 C;  1AOI D;  3KUY B;  3KXB D;  4UUZ B;  2FJ7 A;  1ULY A;  5AVC B;  2HIO A;  4HGA C;  5B31 D;  5JA4 B;  3W98 A;  1AOI C;  5B2I B;  4XZQ A;  3KXB C;  1M18 A;  1P3F A;  5CPK B;  5B31 C;  5DNN A;  2HUE C;  3REH A;  3AZE D;  3REL B;  3TU4 A;  5E5A A;  5AV5 B;  3UTA B;  5KDM A;  1F66 B;  2F8N K;  5FUG B;  1P3B D;  2BYM A;  5G49 B;  3AZE C;  4XUJ D;  5BS7 C;  4JJN D;  3W99 B;  3REI A;  4YS3 A;  1P3B C;  3AV1 A;  2ARO B;  3W96 A;  4XUJ C;  4JJN C;  1S32 A;  3MNN B;  4H9Q B;  4DRA A;  1F1E A;  3AZJ D;  1M19 A;  2RVQ D;  4J8X A;  1U35 B;  3AZF B;  3AYW B;  3AZJ C;  4G92 C;  3AV2 B;  5B40 A;  2RVQ C;  1TZY B;  3LZ1 A;  2PYO D;  4H9R B;  4E45 A;  4ZBJ B;  4KUD A;  3REJ A;  1P3A A;  4WU9 A;  2PYO C;  3WAA A;  1ID3 A;  1HQ3 A;  5B2J D;  3A6N A;  2NZD A;  5BNX B;  4KGC D;  3MGS A;  3AZM A;  1BH8 A;  5B2J C;  4KGC C;  2FJ7 B;  4AWL C;  4X23 B;  5AV6 D;  4XZQ B;  3LZ0 B;  1P3F B;  5DNN B;  3REH B;  2F8N D;  5AV6 C;  1BH9 B;  5E5A B;  3X1S A;  3TU4 B;  1P3L D;  1KX4 A;  1P34 B;  5KDM B;  3UT9 A;  5B33 A;  5GXQ D;  2BYM B;  3AZI D;  1P3L C;  4E44 A;  5GT0 A;  1ZLA B;  5B32 A;  1P3I D;  3REI B;  4YS3 B;  3LJA D;  5GXQ C;  5CPJ A;  3AZI C;  3W96 B;  3C1B A;  1S32 B;  1P3O D;  1P3I C;  4QLC D;  2L5A A;  3LJA C;  4KHA A;  3V9R A;  3AZN D;  1M19 B;  3R45 A;  5B0Y D;  4J8X B;  1P3O C;  4YM6 A;  4QLC C;  1KX3 A;  3MGQ A;  3WKJ B;  1EQZ D;  5AV8 D;  1AOI A;  3AZN C;  5B40 B;  5B0Y C;  3KXB A;  5CPK A;  4KUD B;  5B31 A;  3AZK D;  4ZUX A;  1EQZ C;  3REJ B;  5AV8 C;  5BNV A;  1P3A B;  3WAA B;  1ID3 B;  1HQ3 B;  2NZD B;  3B0D C;  3AZK C;  4Z2M H;  3MGS B;  3B6F A;  3AZM B;  1BH8 B;  1A7W A;  4Z5T D;  3MGP D;  1M1A D;  2CV5 A;  4WNN A;  1P3B A;  4Z5T C;  3MNN A;  3MGP C;  4H9S C;  1M1A C;  3B0C T;  5DNM D;  5AVB B;  5B24 D;  3LEL A;  1P3M B;  1U35 A;  5AY8 D;  3KWQ A;  1KX4 B;  3X1S B;  3W97 D;  5DNM C;  3AV2 A;  3AZJ A;  3UT9 B;  5B1M B;  5B24 C;  5B33 B;  5B1L B;  5AY8 C;  5F99 D;  3W97 C;  5GT0 B;  5GSU D;  2NQB D;  5CPJ B;  5BO0 A;  3C1B B;  5F99 C;  5GSU C;  2NQB C;  5AV9 A;  4KHA B;  5B2J A;  3V9R B;  3WTP E;  5CPI A;  4J8W D;  4R8P C;  3R45 B;  4X23 A;  3VH5 W;  4YM6 B;  1KX3 B;  3MGQ B;  3REK D;  4J8W C;  1AOI B;  3LZ0 A;  4G91 C;  3KXB B;  4J8U A;  3AZH D;  5B31 B;  3WA9 A;  3NQJ A;  3REK C;  4ZUX B;  1BH9 A;  5BNV B;  3AZH C;  1P34 A;  3MGR D;  1P3L A;  3B6F B;  1ZLA A;  5B2I D;  2CV5 B;  4WNN B;  4EO5 B;  1P3B B;  3X1U D;  3MGR C;  1P3P A;  1KU5 A;  5B2I C;  5AV5 D;  3UTA D;  1P3I A;  3X1U C;  1F66 D;  1P3K A;  4NE3 A;  5AV5 C;  3LEL B;  3X1V A;  3UTA C;  3WKJ A;  3KWQ B;  4H9O A;  1F66 C;  3AZJ B;  4G92 B;  3AZN A;  5B0Y A;  2ARO D;  1P3G D;  1EQZ A;  2ARO C;  2PYO B;  1P3G C;  5BO0 B;  3B6G D;  3AZK A;  5C3I C;  5B0Z D;  3AZF D;  3AYW D;  4LD9 D;  5AV9 B;  5B2J B;  5CPI B;  3B6G C;  1TZY D;  3UTB D;  3AN2 D;  4AWL B;  5B0Z C;  1KX5 D;  5B32 G;  3AZF C;  3AYW C;  3AZG D;  3NQU B;  4LD9 C;  1JFI A;  1TZY C;  4H9S A;  3UTB C;  3AN2 C;  4ZBJ C;  4J8U B;  1KX5 C;  5AVB A;  3WA9 B;  3AZG C;  3NQJ B;  3VH5 T;  3X1T D;  1P3M A;  5AV6 B;  3AFA A;  4J8V D;  5B1M A;  2FJ7 D;  5B1L A;  2HIO D;  5B24 A;  3X1T C;  3C1C D;  3W98 D;  5GT3 A;  1P3L B;  4CAY A;  4J8V C;  4XZQ D;  2FJ7 C;  1M18 D;  1P3F D;  2HIO C;  2BYK A;  5DNN D;  3C1C C;  1P3P B;  3W98 C;  3MVD A;  5E5A D;  4XZQ C;  1P3I B;  1Q9C A;  4Z66 A;  1P3F C;  1M18 C;  3LJA B;  5DNN C;  3AZL D;  1P3K B;  4R8P A;  1P3O B;  5E5A C;  3X1V B;  2LY8 A;  4H9O B;  2YFW B;  3O62 D;  3AZL C;  4YS3 D;  3REI D;  3AZN B;  3AV1 D;  5B0Y B;  4WU8 D;  3O62 C;  3REK A;  1EQZ B;  4YS3 C;  3REI C;  2IO5 C;  3AV1 C;  1N1J A;  1M19 D;  4J8X D;  3B0D B;  3AZK B;  4WU8 C;  3AZE A;  5BS7 A;  1M19 C;  4J8X C;  3LZ1 D;  4KUD D;  4XUJ A;  5CP6 D;  4JJN A;  1H3O B;  4Z2M G;  3MGP B;  1M1A B;  1JFI B;  3KSY A;  5JRG D;  4WU9 D;  3LZ1 C;  1HQ3 D;  3A6N D;  4KUD C;  3X1U A;  2NZD D;  5CP6 C;  4NE6 A;  5JRG C;  3AZM D;  4WU9 C;  1HQ3 C;  3A6N C;  2NZD C;  5DNM B;  3AFA B;  3VH6 A;  5B24 B;  3WTP D;  3AZM C;  5GT3 B;  4CAY B;  5BT1 D;  2PYO A;  3WTP C;  2BYK B;  1P3G A;  5F99 B;  3MVD B;  3X1S D;  5BT1 C;  4Z66 B;  2NQB B;  3B6G A;  4KGC A;  5B33 D;  4R8P B;  4HGA B;  3X1S C;  5B0Z A;  3NQU A;  2YFV A;  4LD9 A;  5B32 D;  3AN2 A;  5B33 C;  5CPJ D;  1KX5 A;  3AZG A;  2HUE B;  5B32 C;  3REK B;  5AV6 A;  4NE5 A;  5CPJ C;  1N1J B;  3KUY D;  5AVC D;  3AZE B;  2F8N A;  4YM6 D;  1KX3 D;  3MGQ D;  3KUY C;  5AVC C;  4J8V A;  5CPK D;  5GXQ A;  4YM6 C;  1KX3 C;  3MGQ C;  3AZI A;  4XUJ B;  3MGR B;  4JJN B;  3C1C A;  4ZUX D;  3REL D;  5CPK C;  3LJA A; 
#chains in the Genus database with same CATH topology
 3X1U B;  4ZUX C;  2ZM5 A;  3REL C;  1P3O A;  4QLC A;  3W99 D;  3B6F D;  2YFW A;  2CV5 D;  3AZL A;  3A1I A;  3W99 C;  3B6F C;  3MNN D;  4WJ3 C;  2CV5 C;  4EO5 C;  5AV8 A;  3O62 A;  1WWS A;  2ZY4 A;  1P3G B;  3MNN C;  4WU8 A;  3LEL D;  5C3I B;  1TAF B;  1U35 D;  3KWQ D;  3AV2 D;  3B6G B;  1R4V A;  4KGC B;  3LEL C;  1U35 C;  3KWQ C;  1H3O A;  5B0Z B;  1B67 A;  2YFV B;  3AV2 C;  4Z5T A;  3MGP A;  1M1A A;  4LD9 B;  2Y2I A;  3UTB B;  3AN2 B;  1KX5 B;  5CP6 A;  3AZG B;  3IP4 C;  5JRG A;  2JE5 A;  5AV9 D;  5DNM A;  5CPI D;  3VH5 A;  4X23 D;  2F8N B;  3X1T B;  5AY8 A;  3B0C W;  3W97 A;  5AV9 C;  5CPI C;  2RIQ A;  5B31 G;  3LZ0 D;  4X23 C;  4J8V B;  2JSS A;  4J8U D;  5GXQ B;  2HIO B;  3WTP A;  3WA9 D;  3AZI B;  5F99 A;  3VH6 W;  3C1C B;  3REH D;  3W98 B;  3TU4 D;  1B6W A;  2F2A C;  3LZ0 C;  5GSU A;  4J8U C;  1P34 D;  1M18 B;  2NQB A;  3WA9 C;  3REH C;  3TU4 C;  4QLC B;  1P34 C;  1ZLA D;  1HTA A;  3B0B A;  4CSR A;  4H9P A;  4J8W A;  2CWE A;  3AZL B;  3W96 D;  1S32 D;  1P3P D;  1ZLA C;  5AV8 B;  3O62 B;  4H9N A;  2IO5 B;  4WZS B;  3AV1 B;  3W96 C;  3AZH A;  2Y2K A;  1S32 C;  1P3P C;  1P3K D;  4WU8 B;  3WKJ D;  3X1V D;  4WV4 B;  2DQN C;  1P3K C;  5B40 D;  3KUY A;  4UUZ A;  5AVC A;  3H0M C;  3WKJ C;  3X1V C;  5JA4 A;  3MGR A;  3REJ D;  5CHL B;  4Z5T B;  5B2I A;  5B40 C;  1P3A D;  3WAA D;  1ID3 D;  3LZ1 B;  4DRB A;  5CP6 B;  3REJ C;  3REL A;  4NFT A;  5AV5 A;  3MGS D;  3WAA C;  3UTA A;  1P3A C;  1ID3 C;  2Y2G A;  5JRG B;  4WU9 B;  1F66 A;  3A6N B;  5FUG A;  2Y2L A;  5G49 A;  3MGS C;  5AY8 B;  3W99 A;  2F8N H;  3W97 B;  2ARO A;  5AVB D;  3WTP B;  2Y2P A;  1P3M D;  1TAF A;  1KX4 D;  4H9Q A;  5GSU B;  5AVB C;  3AFA D;  3UT9 D;  2F8N G;  5B1M D;  4DQY B;  5B1L D;  1P3M C;  1KX4 C;  3AZF A;  5GT0 D;  3VH6 T;  5GT3 D;  3AYW A;  3AFA C;  3UT9 C;  5B1M C;  1TZY A;  4CSR B;  4H9P B;  4J8W B;  4H9R A;  5B1L C;  1PZR A;  4G91 B;  3UTB A;  3C1B D;  5GT0 C;  5GT3 C;  3MVD D;  5B32 B;  4M6B A;  4H9N B;  4Z66 D;  3AZH B;  3C1B C;  5BNX A;  4R8P D;  3MVD C;  1WWI A;  3X1T A;  4Z66 C;  1AOI D;  3KUY B;  3KXB D;  4UUZ B;  2FJ7 A;  1ULY A;  5AVC B;  2HIO A;  4HGA C;  5B31 D;  5JA4 B;  3W98 A;  1AOI C;  5B2I B;  2ZY3 A;  4XZQ A;  3KXB C;  1M18 A;  1P3F A;  5CPK B;  5B31 C;  5DNN A;  2HUE C;  3REH A;  2Y2O A;  3AZE D;  3REL B;  3TU4 A;  5E5A A;  5AV5 B;  3UTA B;  5KDM A;  1F66 B;  2F8N K;  5FUG B;  1P3B D;  2BYM A;  5G49 B;  3AZE C;  4XUJ D;  5BS7 C;  4JJN D;  3W99 B;  3REI A;  4YS3 A;  1P3B C;  3AV1 A;  2ARO B;  3W96 A;  4XUJ C;  4JJN C;  1S32 A;  3MNN B;  4H9Q B;  4DRA A;  1F1E A;  3AZJ D;  1M19 A;  2RVQ D;  4J8X A;  1U35 B;  3AZF B;  3AYW B;  3AZJ C;  4G92 C;  3AV2 B;  5B40 A;  2RVQ C;  1TZY B;  3LZ1 A;  2PYO D;  4H9R B;  4E45 A;  4ZBJ B;  4KUD A;  3REJ A;  1P3A A;  4WU9 A;  2PYO C;  3EG5 B;  3WAA A;  1ID3 A;  1HQ3 A;  5B2J D;  3A6N A;  2NZD A;  5BNX B;  4KGC D;  3MGS A;  3AZM A;  1BH8 A;  5B2J C;  4KGC C;  2FJ7 B;  4AWL C;  4X23 B;  2Y2J A;  3A1K A;  3FDD A;  2Y2N A;  5AV6 D;  4XZQ B;  3LZ0 B;  1P3F B;  5DNN B;  3REH B;  2F8N D;  5AV6 C;  1BH9 B;  5E5A B;  3X1S A;  3TU4 B;  1P3L D;  1KX4 A;  1P34 B;  5KDM B;  2Y2H A;  3UT9 A;  5B33 A;  5GXQ D;  2BYM B;  5CPK C;  4UPK A;  3AZI D;  1P3L C;  4E44 A;  5GT0 A;  1ZLA B;  5B32 A;  1P3I D;  3REI B;  4YS3 B;  3LJA D;  5GXQ C;  5CPJ A;  3AZI C;  3H0L C;  3C1B A;  1S32 B;  3W96 B;  1P3O D;  1P3I C;  4QLC D;  2L5A A;  3LJA C;  4KHA A;  3V9R A;  2DF4 C;  3AZN D;  1M19 B;  3R45 A;  5B0Y D;  4J8X B;  1P3O C;  4QLC C;  4YM6 A;  1KX3 A;  3MGQ A;  3WKJ B;  1EQZ D;  5AV8 D;  1AOI A;  3AZN C;  5B40 B;  5B0Y C;  3KXB A;  5CPK A;  2G5I C;  4KUD B;  5B31 A;  3AZK D;  4ZUX A;  1EQZ C;  3REJ B;  5AV8 C;  5BNV A;  1P3A B;  3WAA B;  1ID3 B;  1HQ3 B;  2NZD B;  3B0D C;  3AZK C;  4Z2M H;  3MGS B;  3B6F A;  3AZM B;  1BH8 B;  1A7W A;  4Z5T D;  3MGP D;  1M1A D;  2CV5 A;  4WNN A;  1P3B A;  4Z5T C;  3MNN A;  3MGP C;  4H9S C;  1M1A C;  3B0C T;  2G5H C;  5DNM D;  5AVB B;  5B24 D;  3LEL A;  1P3M B;  1U35 A;  5AY8 D;  3KWQ A;  1KX4 B;  3X1S B;  3W97 D;  5DNM C;  3AV2 A;  3AZJ A;  3UT9 B;  5B1M B;  5B24 C;  5B33 B;  5B1L B;  5AY8 C;  5F99 D;  3W97 C;  5GT0 B;  5GSU D;  2NQB D;  5CPJ B;  5BO0 A;  3C1B B;  5F99 C;  5GSU C;  2NQB C;  5AV9 A;  4KHA B;  5B2J A;  3V9R B;  3WTP E;  5CPI A;  4J8W D;  4R8P C;  3R45 B;  4X23 A;  3VH5 W;  4YM6 B;  1KX3 B;  3MGQ B;  3REK D;  4J8W C;  1AOI B;  3LZ0 A;  4G91 C;  3KXB B;  4J8U A;  3AZH D;  5B31 B;  2XD1 A;  3WA9 A;  3NQJ A;  3REK C;  4ZUX B;  1BH9 A;  5BNV B;  3AZH C;  1P34 A;  1T3U A;  1W2E A;  3MGR D;  1P3L A;  3B6F B;  1ZLA A;  5B2I D;  2CV5 B;  4WNN B;  4EO5 B;  2ZY5 A;  1P3B B;  1Z2C B;  3X1U D;  3MGR C;  1P3P A;  1KU5 A;  5B2I C;  5AV5 D;  3UTA D;  1P3I A;  3X1U C;  1F66 D;  1P3K A;  3P5J B;  4NE3 A;  5AV5 C;  3LEL B;  3X1V A;  3UTA C;  3WKJ A;  3KWQ B;  4H9O A;  1F66 C;  3AZJ B;  4G92 B;  3AZN A;  5B0Y A;  2ARO D;  1P3G D;  1EQZ A;  2ARO C;  2PYO B;  1P3G C;  2BG1 A;  5BO0 B;  3B6G D;  3AZK A;  5C3I C;  5B0Z D;  3AZF D;  3AYW D;  4LD9 D;  5AV9 B;  2VQR A;  5B2J B;  5CPI B;  3B6G C;  1TZY D;  2Y2M A;  3UTB D;  3AN2 D;  4AWL B;  5B0Z C;  1KX5 D;  5B32 G;  3AZF C;  3AYW C;  3AZG D;  3NQU B;  4LD9 C;  1JFI A;  1TZY C;  4H9S A;  3UTB C;  3AN2 C;  4ZBJ C;  4J8U B;  1KX5 C;  5AVB A;  3WA9 B;  3AZG C;  3NQJ B;  3VH5 T;  3X1T D;  1P3M A;  5AV6 B;  3AFA A;  4J8V D;  5B1M A;  2FJ7 D;  2W8S A;  2HIO D;  5B1L A;  5B24 A;  3X1T C;  3C1C D;  3W98 D;  5GT3 A;  1P3L B;  4CAY A;  4J8V C;  4XZQ D;  2FJ7 C;  3KFU G;  1M18 D;  1P3F D;  2HIO C;  2BYK A;  5DNN D;  3C1C C;  1P3P B;  3W98 C;  3AL0 C;  3MVD A;  5E5A D;  4XZQ C;  1P3I B;  1Q9C A;  4Z66 A;  1P3F C;  1M18 C;  3LJA B;  5DNN C;  3AZL D;  1P3K B;  4R8P A;  1P3O B;  5E5A C;  3H0R C;  3EPJ A;  3X1V B;  2LY8 A;  4H9O B;  2YFW B;  3O62 D;  3AZL C;  2Y2Q A;  4YS3 D;  3REI D;  3AZN B;  3AV1 D;  5B0Y B;  3EPH A;  2J8P A;  2ZY2 A;  3EPL A;  4WU8 D;  3O62 C;  3REK A;  1EQZ B;  4YS3 C;  3REI C;  2IO5 C;  3AV1 C;  1N1J A;  2FFF B;  1M19 D;  4J8X D;  3B0D B;  3AZK B;  4WU8 C;  3AZE A;  5BS7 A;  2XD5 A;  1M19 C;  4J8X C;  3LZ1 D;  4KUD D;  4XUJ A;  5CP6 D;  4JJN A;  1H3O B;  4Z2M G;  3MGP B;  1M1A B;  1JFI B;  3KSY A;  5JRG D;  4WU9 D;  3LZ1 C;  1HQ3 D;  3A6N D;  4KUD C;  3X1U A;  2NZD D;  5CP6 C;  4NE6 A;  5JRG C;  3AZM D;  4WU9 C;  1HQ3 C;  3A6N C;  2NZD C;  5DNM B;  3AFA B;  3VH6 A;  5B24 B;  3WTP D;  3AZM C;  5GT3 B;  4CAY B;  5BT1 D;  2PYO A;  3WTP C;  2BYK B;  1P3G A;  5F99 B;  3MVD B;  3F6T A;  3X1S D;  5BT1 C;  4Z66 B;  2NQB B;  3B6G A;  4KGC A;  5B33 D;  4R8P B;  4HGA B;  3X1S C;  5B0Z A;  3NQU A;  2YFV A;  4LD9 A;  5B32 D;  3AN2 A;  5B33 C;  5CPJ D;  3EPK A;  1KX5 A;  3AZG A;  2HUE B;  5B32 C;  3REK B;  5AV6 A;  4NE5 A;  5CPJ C;  1N1J B;  3KUY D;  5AVC D;  3AZE B;  2F8N A;  4YM6 D;  1KX3 D;  3MGQ D;  1BFM A;  2JCH A;  3KUY C;  5AVC C;  4J8V A;  5CPK D;  5GXQ A;  4YM6 C;  1KX3 C;  3MGQ C;  3AZI A;  4XUJ B;  3MGR B;  4JJN B;  3C1C A;  4ZUX D;  3REL D;  2UWX A;  3LJA A; 
#chains in the Genus database with same CATH homology
 3X1U B;  4ZUX C;  2ZM5 A;  3REL C;  1P3O A;  4QLC A;  3W99 D;  3B6F D;  2YFW A;  2CV5 D;  3AZL A;  3A1I A;  3W99 C;  3B6F C;  3MNN D;  4WJ3 C;  2CV5 C;  4EO5 C;  5AV8 A;  3O62 A;  1WWS A;  2ZY4 A;  1P3G B;  3MNN C;  4WU8 A;  3LEL D;  5C3I B;  1TAF B;  1U35 D;  3KWQ D;  3AV2 D;  3B6G B;  1R4V A;  4KGC B;  3LEL C;  1U35 C;  3KWQ C;  1H3O A;  5B0Z B;  1B67 A;  2YFV B;  3AV2 C;  4Z5T A;  3MGP A;  1M1A A;  4LD9 B;  2Y2I A;  3UTB B;  3AN2 B;  1KX5 B;  5CP6 A;  3AZG B;  3IP4 C;  5JRG A;  2JE5 A;  5AV9 D;  5DNM A;  5CPI D;  3VH5 A;  4X23 D;  2F8N B;  3X1T B;  5AY8 A;  3B0C W;  3W97 A;  5AV9 C;  5CPI C;  2RIQ A;  5B31 G;  3LZ0 D;  4X23 C;  4J8V B;  2JSS A;  4J8U D;  5GXQ B;  2HIO B;  3WTP A;  3WA9 D;  3AZI B;  5F99 A;  3VH6 W;  3C1C B;  3REH D;  3W98 B;  3TU4 D;  1B6W A;  2F2A C;  3LZ0 C;  5GSU A;  4J8U C;  1P34 D;  1M18 B;  2NQB A;  3WA9 C;  3REH C;  3TU4 C;  4QLC B;  1P34 C;  1ZLA D;  1HTA A;  3B0B A;  4CSR A;  4H9P A;  4J8W A;  2CWE A;  3AZL B;  3W96 D;  1S32 D;  1P3P D;  1ZLA C;  5AV8 B;  3O62 B;  4H9N A;  2IO5 B;  4WZS B;  3AV1 B;  3W96 C;  3AZH A;  2Y2K A;  1S32 C;  1P3P C;  1P3K D;  4WU8 B;  3WKJ D;  3X1V D;  4WV4 B;  2DQN C;  1P3K C;  5B40 D;  3KUY A;  4UUZ A;  5AVC A;  3H0M C;  3WKJ C;  3X1V C;  5JA4 A;  3MGR A;  3REJ D;  5CHL B;  4Z5T B;  5B2I A;  5B40 C;  1P3A D;  3WAA D;  1ID3 D;  3LZ1 B;  4DRB A;  5CP6 B;  3REJ C;  3REL A;  4NFT A;  5AV5 A;  3MGS D;  3WAA C;  3UTA A;  1P3A C;  1ID3 C;  2Y2G A;  5JRG B;  4WU9 B;  1F66 A;  3A6N B;  5FUG A;  2Y2L A;  5G49 A;  3MGS C;  5AY8 B;  3W99 A;  2F8N H;  3W97 B;  2ARO A;  5AVB D;  3WTP B;  2Y2P A;  1P3M D;  1TAF A;  1KX4 D;  4H9Q A;  5GSU B;  5AVB C;  3AFA D;  3UT9 D;  2F8N G;  5B1M D;  4DQY B;  5B1L D;  1P3M C;  1KX4 C;  3AZF A;  5GT0 D;  3VH6 T;  5GT3 D;  3AYW A;  3AFA C;  3UT9 C;  5B1M C;  1TZY A;  4CSR B;  4H9P B;  4J8W B;  4H9R A;  5B1L C;  1PZR A;  4G91 B;  3UTB A;  3C1B D;  5GT0 C;  5GT3 C;  3MVD D;  5B32 B;  4M6B A;  4H9N B;  4Z66 D;  3AZH B;  3C1B C;  5BNX A;  4R8P D;  3MVD C;  1WWI A;  3X1T A;  4Z66 C;  1AOI D;  3KUY B;  3KXB D;  4UUZ B;  2FJ7 A;  1ULY A;  5AVC B;  2HIO A;  4HGA C;  5B31 D;  5JA4 B;  3W98 A;  1AOI C;  5B2I B;  2ZY3 A;  4XZQ A;  3KXB C;  1M18 A;  1P3F A;  5CPK B;  5B31 C;  5DNN A;  2HUE C;  3REH A;  2Y2O A;  3AZE D;  3REL B;  3TU4 A;  5E5A A;  5AV5 B;  3UTA B;  5KDM A;  1F66 B;  2F8N K;  5FUG B;  1P3B D;  2BYM A;  5G49 B;  3AZE C;  4XUJ D;  5BS7 C;  4JJN D;  3W99 B;  3REI A;  4YS3 A;  1P3B C;  3AV1 A;  2ARO B;  3W96 A;  4XUJ C;  4JJN C;  1S32 A;  3MNN B;  4H9Q B;  4DRA A;  1F1E A;  3AZJ D;  1M19 A;  2RVQ D;  4J8X A;  1U35 B;  3AZF B;  3AYW B;  3AZJ C;  4G92 C;  3AV2 B;  5B40 A;  2RVQ C;  1TZY B;  3LZ1 A;  2PYO D;  4H9R B;  4E45 A;  4ZBJ B;  4KUD A;  3REJ A;  1P3A A;  4WU9 A;  2PYO C;  3EG5 B;  3WAA A;  1ID3 A;  1HQ3 A;  5B2J D;  3A6N A;  2NZD A;  5BNX B;  4KGC D;  3MGS A;  3AZM A;  1BH8 A;  5B2J C;  4KGC C;  2FJ7 B;  4AWL C;  4X23 B;  2Y2J A;  3A1K A;  3FDD A;  2Y2N A;  5AV6 D;  4XZQ B;  3LZ0 B;  1P3F B;  5DNN B;  3REH B;  2F8N D;  5AV6 C;  1BH9 B;  5E5A B;  3X1S A;  3TU4 B;  1P3L D;  1KX4 A;  1P34 B;  5KDM B;  2Y2H A;  3UT9 A;  5B33 A;  5GXQ D;  2BYM B;  5CPK C;  4UPK A;  3AZI D;  1P3L C;  4E44 A;  5GT0 A;  1ZLA B;  5B32 A;  1P3I D;  3REI B;  4YS3 B;  3LJA D;  5GXQ C;  5CPJ A;  3AZI C;  3H0L C;  3C1B A;  1S32 B;  3W96 B;  1P3O D;  1P3I C;  4QLC D;  2L5A A;  3LJA C;  4KHA A;  3V9R A;  2DF4 C;  3AZN D;  1M19 B;  3R45 A;  5B0Y D;  4J8X B;  1P3O C;  4QLC C;  4YM6 A;  1KX3 A;  3MGQ A;  3WKJ B;  1EQZ D;  5AV8 D;  1AOI A;  3AZN C;  5B40 B;  5B0Y C;  3KXB A;  5CPK A;  2G5I C;  4KUD B;  5B31 A;  3AZK D;  4ZUX A;  1EQZ C;  3REJ B;  5AV8 C;  5BNV A;  1P3A B;  3WAA B;  1ID3 B;  1HQ3 B;  2NZD B;  3B0D C;  3AZK C;  4Z2M H;  3MGS B;  3B6F A;  3AZM B;  1BH8 B;  1A7W A;  4Z5T D;  3MGP D;  1M1A D;  2CV5 A;  4WNN A;  1P3B A;  4Z5T C;  3MNN A;  3MGP C;  4H9S C;  1M1A C;  3B0C T;  2G5H C;  5DNM D;  5AVB B;  5B24 D;  3LEL A;  1P3M B;  1U35 A;  5AY8 D;  3KWQ A;  1KX4 B;  3X1S B;  3W97 D;  5DNM C;  3AV2 A;  3AZJ A;  3UT9 B;  5B1M B;  5B24 C;  5B33 B;  5B1L B;  5AY8 C;  5F99 D;  3W97 C;  5GT0 B;  5GSU D;  2NQB D;  5CPJ B;  5BO0 A;  3C1B B;  5F99 C;  5GSU C;  2NQB C;  5AV9 A;  4KHA B;  5B2J A;  3V9R B;  3WTP E;  5CPI A;  4J8W D;  4R8P C;  3R45 B;  4X23 A;  3VH5 W;  4YM6 B;  1KX3 B;  3MGQ B;  3REK D;  4J8W C;  1AOI B;  3LZ0 A;  4G91 C;  3KXB B;  4J8U A;  3AZH D;  5B31 B;  2XD1 A;  3WA9 A;  3NQJ A;  3REK C;  4ZUX B;  1BH9 A;  5BNV B;  3AZH C;  1P34 A;  1T3U A;  1W2E A;  3MGR D;  1P3L A;  3B6F B;  1ZLA A;  5B2I D;  2CV5 B;  4WNN B;  4EO5 B;  2ZY5 A;  1P3B B;  1Z2C B;  3X1U D;  3MGR C;  1P3P A;  1KU5 A;  5B2I C;  5AV5 D;  3UTA D;  1P3I A;  3X1U C;  1F66 D;  1P3K A;  3P5J B;  4NE3 A;  5AV5 C;  3LEL B;  3X1V A;  3UTA C;  3WKJ A;  3KWQ B;  4H9O A;  1F66 C;  3AZJ B;  4G92 B;  3AZN A;  5B0Y A;  2ARO D;  1P3G D;  1EQZ A;  2ARO C;  2PYO B;  1P3G C;  2BG1 A;  5BO0 B;  3B6G D;  3AZK A;  5C3I C;  5B0Z D;  3AZF D;  3AYW D;  4LD9 D;  5AV9 B;  2VQR A;  5B2J B;  5CPI B;  3B6G C;  1TZY D;  2Y2M A;  3UTB D;  3AN2 D;  4AWL B;  5B0Z C;  1KX5 D;  5B32 G;  3AZF C;  3AYW C;  3AZG D;  3NQU B;  4LD9 C;  1JFI A;  1TZY C;  4H9S A;  3UTB C;  3AN2 C;  4ZBJ C;  4J8U B;  1KX5 C;  5AVB A;  3WA9 B;  3AZG C;  3NQJ B;  3VH5 T;  3X1T D;  1P3M A;  5AV6 B;  3AFA A;  4J8V D;  5B1M A;  2FJ7 D;  2W8S A;  2HIO D;  5B1L A;  5B24 A;  3X1T C;  3C1C D;  3W98 D;  5GT3 A;  1P3L B;  4CAY A;  4J8V C;  4XZQ D;  2FJ7 C;  3KFU G;  1M18 D;  1P3F D;  2HIO C;  2BYK A;  5DNN D;  3C1C C;  1P3P B;  3W98 C;  3AL0 C;  3MVD A;  5E5A D;  4XZQ C;  1P3I B;  1Q9C A;  4Z66 A;  1P3F C;  1M18 C;  3LJA B;  5DNN C;  3AZL D;  1P3K B;  4R8P A;  1P3O B;  5E5A C;  3H0R C;  3EPJ A;  3X1V B;  2LY8 A;  4H9O B;  2YFW B;  3O62 D;  3AZL C;  2Y2Q A;  4YS3 D;  3REI D;  3AZN B;  3AV1 D;  5B0Y B;  3EPH A;  2J8P A;  2ZY2 A;  3EPL A;  4WU8 D;  3O62 C;  3REK A;  1EQZ B;  4YS3 C;  3REI C;  2IO5 C;  3AV1 C;  1N1J A;  2FFF B;  1M19 D;  4J8X D;  3B0D B;  3AZK B;  4WU8 C;  3AZE A;  5BS7 A;  2XD5 A;  1M19 C;  4J8X C;  3LZ1 D;  4KUD D;  4XUJ A;  5CP6 D;  4JJN A;  1H3O B;  4Z2M G;  3MGP B;  1M1A B;  1JFI B;  3KSY A;  5JRG D;  4WU9 D;  3LZ1 C;  1HQ3 D;  3A6N D;  4KUD C;  3X1U A;  2NZD D;  5CP6 C;  4NE6 A;  5JRG C;  3AZM D;  4WU9 C;  1HQ3 C;  3A6N C;  2NZD C;  5DNM B;  3AFA B;  3VH6 A;  5B24 B;  3WTP D;  3AZM C;  5GT3 B;  4CAY B;  5BT1 D;  2PYO A;  3WTP C;  2BYK B;  1P3G A;  5F99 B;  3MVD B;  3F6T A;  3X1S D;  5BT1 C;  4Z66 B;  2NQB B;  3B6G A;  4KGC A;  5B33 D;  4R8P B;  4HGA B;  3X1S C;  5B0Z A;  3NQU A;  2YFV A;  4LD9 A;  5B32 D;  3AN2 A;  5B33 C;  5CPJ D;  3EPK A;  1KX5 A;  3AZG A;  2HUE B;  5B32 C;  3REK B;  5AV6 A;  4NE5 A;  5CPJ C;  1N1J B;  3KUY D;  5AVC D;  3AZE B;  2F8N A;  4YM6 D;  1KX3 D;  3MGQ D;  1BFM A;  2JCH A;  3KUY C;  5AVC C;  4J8V A;  5CPK D;  5GXQ A;  4YM6 C;  1KX3 C;  3MGQ C;  3AZI A;  4XUJ B;  3MGR B;  4JJN B;  3C1C A;  4ZUX D;  3REL D;  2UWX A;  3LJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...