5B1MA

The mouse nucleosome structure containing h3.1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mA00
5B33A 3LZ0B 3C1CB 1ZLAA 3B6GB 5AV6C 1P3PC 3VH6T 3WTPB 1P3MC 3AFAD 1M1AD 5DNMD 4X23B 4KUDA 5B2IA 3LJAD 3C1CC 5E5AB 3AYWD 5AVCD 3WTPC 2AROA 3W96A 3LELB 5AVBD 4G91C 3X1SA 1P3GB 4Z66C 5JRGB 4ZUXC 3REJC 3MNNA 1H3OB 3LELC 2NQBA 5CPKB 3X1UD 3LZ1A 5B0ZB 4YM6A 4J8WA 2HIOB 5AV9B 4JJNB 4J8UA 5AV5A 4XZQB 5AV6A 3UT9A 1M18B 3WAAB 4CAYA 5FUGB 5CPKC 3MGPA 1P3PD 5AV9C 4JJNC 4WU8B 3LZ0A 1KX3B 3B6GA 1P3MD 3WAAC 4XZQC 5CP6D 5B1LB 3AZND 1TAFB 5B1MB 4X23A 5B2JA 1P3IA 3B6FB 4HGAB 5GT0B 1KX3C 5E5AA 1ID3B 3W98D 3KWQB 3KXBB 3A6NC 2F8NK 3AZMD 4Z66D 5CPID 5B1MC 5CPJD 3B6FC 5F99D 4H9OA 4QLCD 1P3GA 5GT0C 4WNNB 4ZUXD 4Z5TC 5JRGA 3AZGD 5CPKA 5B24B 5B0ZA 2HIOA 3AZJB 3MGRA 5AV9A 1P3FC 1TZYB 1M18A 1P3KD 3RELA 1BH9B 3AZKD 2BYKB 3NQJB 2CV5B 5AV8D 5B24C 4H9QA 4J8VD 1P3BA 4WU8A 1KX4D 1KX3A 3AZIB 1BFMA 4G92B 3REKA 1KX5B 5GXQC 5B1LA 2FJ7D 1P34C 2HUEB 4E44A 3B0BA 2CV5C 5B31C 1TAFA 5B1MA 3B6FA 5DNND 4DRBA 3MGQD 3A6ND 5GSUB 1ID3A 5JA4B 1KX5C 3KWQA 4NE5A 3KXBA 3W97D 1HQ3A 3MVDB 2BYMA 4Z5TD 5B33B 4KGCD 3UTAC 5GT3C 4H9NB 5B32D 4WNNA 4J8XD 5GSUC 3AN2A 4R8PC 5BNVB 1P3FD 4KUDB 5B24A 5B33C 1ZLAC 3AZJA 1P3OA 1TZYA 5AY8D 2PYOA 1F66B 3NQJA 3UTBD 4KUDC 5B2IC 1P34D 3AZLD 3AV2D 1AOID 3AZIA 2AROC 3W96C 5B31D 3MNNB 3AV1D 1F66C 3WA9D 3LZ1B 3AZFD 4YM6B 3X1SC 3AYWB 5C3IB 4J8UB 5BT1D 3UT9B 2NZDA 4CAYB 3MGSA 3MNNC 5GT3D 3WKJA 3LZ1C 4YM6C 4YS3D 1BH8B 3MVDA 5C3IC 4J8UC 5AV5C 3UT9C 4H9NA 4R8PD 4AWLC 3B0DC 4WU9B 5BNVA 3MGPC 1P3LD 5B2JB 3O62B 1P3IB 1S32A 3LZ0C 1EQZD 3B6GC 3C1BA 4LD9D 5B2ID 3V9RB 3X1VD 3AZHB 4XUJB 1F66A 4X23C 5B2JC 3O62C 3REHD 4H9OB 1P3IC 2F8ND 1N1JA 2AROD 5CP6B 3W96D 5E5AC 4UUZB 3TU4B 4H9PA 3X1SD 1M1AA 3KUYD 3X1TD 1P3GC 3MGRB 3AYWA 2NQBD 3REIB 3TU4C 5JRGC 3RELB 4J8WD 1M19D 5AVBA 5CPJB 5AV6D 5B0ZC 4H9QB 2HIOC 2IO5B 1BH8A 4ZBJB 3MGRC 1P3BB 1A7WA 1M18C 3REKB 3RELC 3MGPD 3X1UA 4WU9A 3C1CD 3B6GD 2IO5C 4H9RB 3WTPD 3O62A 1P3BC 4WU8C 3REKC 5B1LC 3V9RA 4J8VB 1HQ3B 5E5AD 3AZHA 2BYMB 4XUJA 1KX4B 2YFWB 5KDMB 4HGAC 5CP6A 3AZEB 4UUZA 3REJD 3LELD 2FJ7B 3TU4A 1ID3C 3AN2B 3KWQC 3AZNA 3KXBC 1P3GD 1HQ3C 3MGQB 5JRGD 1P3OB 5B0YB 3REIA 3AN2C 5CPKD 4NE6A 3AZMA 5B0ZD 4WZSB 5CPIA 2PYOB 5AV9D 5CPJA 4JJND 1F1EA 3B0CW 5F99A 4QLCA 5B40B 4XZQD 1M18D 1P3AB 3WAAD 3AZJC 1P3OC 5B0YC 1TZYC 1U35B 2PYOC 1KX3D 3VH5A 4CSRA 4H9RA 5B1LD 1P3KA 3AZIC 2NZDB 3MGSB 4G92C 3AZKA 5B1MD 3B6FD 3WKJB 2HUEC 5AV8A 5GT0D 4J8VA 3AZLB 1KX4A 2YFWA 5KDMA 3KWQD 3AZEA 3KXBD 2NZDC 2FJ7A 3MGSC 3R45B 3WKJC 3W99B 2RVQC 5DNNA 3MVDC 3MGQA 1S32B 1WWSA 5B0YA 3C1BB 5G49B 5B24D 3W97A 3W99C 5B40A 1N1JB 1TZYD 1S32C 1P3AA 4J8XA 5GXQD 3AFAB 3C1BC 4H9PB 2CV5D 1M1AB 3VH5W 5DNMB 1U35A 3LJAB 1EQZB 4WV4B 5BNXB 5AVCB 1KX5D 3KSYA 1KU5A 1M1AC 5AVBB 5BS7A 3UTAD 3AYWC 5GSUD 3AZLA 5AVCC 4H9SA 3WA9A 3R45A 5AVBC 3X1UB 3VH5T 5B33D 3AZFA 4Z2MG 1ZLAD 3W99A 1M19B 4KUDD 5G49A 3X1UC 1P3PB 4WU9C 4YS3A 1P3MB 2L5AA 1R4VA 2F8NG 1F66D 3AFAA 3AZNB 5DNMA 1P3LA 3LJAA 3AZHC 4XUJC 1EQZA 5BNXA 2JSSA 5CP6C 3W98B 5AVCA 2YFVB 3MNND 4LD9A 4G91B 3X1VA 3LZ1D 3AZMB 4Z66B 4YM6D 3AZNC 5CPIB 3REHA 5F99B 4J8UD 4QLCB 2F8NA 5AV5D 4ZUXB 3REJB 3UT9D 5BO0B 3W98C 3AZGB 3REIC 3KUYA 1JFIB 2LY8A 3AZMC 5CPIC 3X1TA 4Z2MH 5CPJC 5F99C 4QLCC 3LZ0D 4CSRB 4ZBJC 1P3KB 3AZGC 4WU9D 3AZKB 1M19A 4NE3A 4X23D 5B2JD 3O62D 5AV8B 1B6WA 1P3ID 1P3PA 4EO5B 2F8NH 1P3MA 1P3KC 5CHLB 3AZKC 3AZHD 4XUJD 1WWIA 3C1CA 1B67A 5AV8C 4J8VC 5DNNB 3WTPA 4EO5C 3A6NB 3TU4D 1KX4C 3AZEC 3W98A 2YFVA 2FJ7C 3W97B 4Z66A 2HIOD 4KGCB 4Z5TB 3MGRD 5DNNC 3MGQC 5B32B 3REID 4ZUXA 3REJA 5BO0A 3LELA 4J8XB 3RELD 3AZGA 1P3FB 4KHAB 1JFIA 3W97C 4KGCC 1P3BD 5B40C 4WU8D 5B32C 1P3AC 1H3OA 4J8XC 3REKD 5AY8B 4JJNA 3UTBB 1U35C 4XZQA 3WAAA 2CWEA 3B0CT 5GXQB 1P34B 1AOIB 3AV2B 1ID3D 5FUGA 5B31B 3AV1B 5AY8C 5B32G 1HQ3D 3WA9B 3UTBC 3AZFB 5BS7C 3AZED 4DRAA 4E45A 3AZLC 1ULYA 4H9SC 3VH6A 3A6NA 3AN2D 3AV2C 1AOIC 3AV1C 3UTAB 5GT3B 3WA9C 5GT0A 3AZFC 4YS3B 3AZJD 4Z5TA 4KGCA 3WTPE 5BT1C 1P3OD 5B0YD 4R8PB 3NQUB 5B32A 2PYOD 1ZLAB 5B40D 1P3FA 4KHAA 1P3LB 4YS3C 5B31G 1P3AD 3AZID 4LD9B 1U35D 5B2IB 1HTAA 3AFAC 3X1VB 5AY8A 5DNMC 1P3LC 1Q9CA 3REHB 3LJAC 3UTBA 2F8NB 2AROB 3W96B 1EQZC 2NZDD 5GXQA 1BH9A 3MGSD 3AV2A 2BYKA 1P34A 1AOIA 4LD9C 2CV5A 3X1SB 5B31A 3KUYB 3WKJD 3X1VC 3AV1A 2RVQD 4NFTA 3X1TB 3MVDD 3REHC 3VH6W 1KX5A 2NQBB 4J8WB 3KUYC 3W99D 3UTAA 5GT3A 5AV5B 3X1TC 5AV6B 4AWLB 1S32D 5GSUA 3B0DB 5JA4A 2NQBC 3C1BD 4R8PA 3NQUA 4M6BA 4J8WC 3MGPB 1M19C
chains in the Genus database with same CATH superfamily
5B33A 3LZ0B 3C1CB 1ZLAA 3B6GB 5AV6C 1P3PC 2J8PA 3VH6T 3WTPB 3H0RC 3EPHA 1P3MC 3AFAD 1M1AD 5DNMD 4X23B 4KUDA 5B2IA 3LJAD 3C1CC 5E5AB 3AYWD 5AVCD 3WTPC 2AROA 3W96A 2VQRA 3LELB 5AVBD 4G91C 3X1SA 1P3GB 4Z66C 5JRGB 4ZUXC 3REJC 3MNNA 1H3OB 3LELC 2NQBA 5CPKB 3X1UD 3LZ1A 5B0ZB 4YM6A 4J8WA 2HIOB 5AV9B 4JJNB 4J8UA 5AV5A 4XZQB 5AV6A 3UT9A 1M18B 3WAAB 4CAYA 2FFFB 5FUGB 5CPKC 3MGPA 1P3PD 5AV9C 4JJNC 4WU8B 3LZ0A 1KX3B 3B6GA 1P3MD 3WAAC 4XZQC 5CP6D 5B1LB 3AZND 1TAFB 5B1MB 4X23A 5B2JA 1P3IA 3B6FB 4HGAB 5GT0B 1KX3C 5E5AA 1ID3B 3W98D 3KWQB 3KXBB 3A6NC 2F8NK 3AZMD 4Z66D 5CPID 5B1MC 5CPJD 3B6FC 5F99D 4H9OA 4QLCD 1P3GA 5GT0C 4WNNB 4ZUXD 1T3UA 4Z5TC 5JRGA 3AZGD 5CPKA 5B24B 5B0ZA 2HIOA 3AZJB 3MGRA 5AV9A 1P3FC 3EPLA 4WJ3C 1TZYB 1M18A 1P3KD 3RELA 1BH9B 3AZKD 2BYKB 3NQJB 2CV5B 5AV8D 5B24C 4H9QA 4J8VD 1P3BA 4WU8A 1KX4D 1KX3A 3AZIB 1BFMA 4G92B 3REKA 1KX5B 5GXQC 5B1LA 2FJ7D 1P34C 2HUEB 4E44A 3B0BA 2CV5C 5B31C 1TAFA 5B1MA 3B6FA 5DNND 4DRBA 3MGQD 3A6ND 5GSUB 2XD1A 1ID3A 5JA4B 1KX5C 3EG5B 3KWQA 4NE5A 3KXBA 3W97D 1HQ3A 3H0LC 3MVDB 2BYMA 4Z5TD 5B33B 4KGCD 3UTAC 5GT3C 3KFUG 4H9NB 5B32D 4WNNA 4J8XD 5GSUC 3AN2A 2Y2IA 4R8PC 5BNVB 1P3FD 4KUDB 5B24A 5B33C 1ZLAC 3AZJA 1P3OA 3F6TA 1TZYA 5AY8D 2PYOA 1F66B 3NQJA 3UTBD 4KUDC 5B2IC 2Y2KA 3EPKA 1P34D 3AZLD 3AV2D 1AOID 3AZIA 3AL0C 2AROC 3W96C 5B31D 3MNNB 3AV1D 1F66C 3WA9D 3LZ1B 3AZFD 4YM6B 3X1SC 3AYWB 5C3IB 4J8UB 2JE5A 5BT1D 3UT9B 2NZDA 4CAYB 3MGSA 3MNNC 2W8SA 5GT3D 3WKJA 3LZ1C 4YM6C 4YS3D 1BH8B 3MVDA 5C3IC 4J8UC 5AV5C 2Y2PA 4H9NA 4R8PD 4AWLC 2Y2HA 3UT9C 3P5JB 3B0DC 4WU9B 5BNVA 3MGPC 1P3LD 5B2JB 3O62B 1P3IB 2ZY5A 1S32A 3LZ0C 1EQZD 3B6GC 3C1BA 4LD9D 5B2ID 3V9RB 3X1VD 3AZHB 4XUJB 1F66A 4X23C 5B2JC 3O62C 3REHD 4H9OB 1P3IC 2F8ND 1N1JA 2AROD 5CP6B 3W96D 5E5AC 4UUZB 3TU4B 4H9PA 3X1SD 1M1AA 3KUYD 3X1TD 1P3GC 3MGRB 3AYWA 2NQBD 3REIB 3TU4C 5JRGC 2JCHA 3RELB 4J8WD 1M19D 5AVBA 5CPJB 3EPJA 5AV6D 5B0ZC 4H9QB 2HIOC 2IO5B 1BH8A 4ZBJB 3MGRC 1P3BB 1A7WA 1M18C 3REKB 3RELC 3MGPD 3X1UA 4WU9A 3C1CD 3B6GD 2IO5C 4H9RB 3WTPD 3O62A 1P3BC 4WU8C 3REKC 5B1LC 3V9RA 4J8VB 1HQ3B 5E5AD 3AZHA 2BYMB 4XUJA 1KX4B 2YFWB 5KDMB 4HGAC 5CP6A 3AZEB 4UUZA 3REJD 3LELD 2FJ7B 2Y2JA 3TU4A 3AN2B 1ID3C 3KWQC 3AZNA 3KXBC 1P3GD 1HQ3C 3MGQB 5JRGD 1P3OB 5B0YB 3REIA 3AN2C 5CPKD 4NE6A 3AZMA 5B0ZD 4WZSB 5CPIA 2PYOB 5AV9D 5CPJA 4JJND 1F1EA 3B0CW 5F99A 4QLCA 5B40B 4XZQD 1M18D 1P3AB 3WAAD 3AZJC 1P3OC 5B0YC 1TZYC 1U35B 2PYOC 1KX3D 3VH5A 4CSRA 4H9RA 5B1LD 1P3KA 2Y2LA 3AZIC 2NZDB 3MGSB 4G92C 3AZKA 5B1MD 3B6FD 2XD5A 3WKJB 2HUEC 5AV8A 5GT0D 4J8VA 3AZLB 1KX4A 2YFWA 5KDMA 3KWQD 3AZEA 3KXBD 2NZDC 2FJ7A 3MGSC 3R45B 3WKJC 3W99B 2RVQC 2ZY4A 5DNNA 3IP4C 3MVDC 3MGQA 1S32B 1WWSA 5B0YA 2F2AC 3C1BB 5G49B 5B24D 3W97A 3A1KA 3W99C 5B40A 1N1JB 1TZYD 1S32C 1P3AA 4J8XA 5GXQD 3AFAB 3C1BC 4H9PB 2CV5D 1M1AB 3VH5W 5DNMB 1U35A 3LJAB 3H0MC 1EQZB 4WV4B 5BNXB 5AVCB 1KX5D 3KSYA 1KU5A 1M1AC 5AVBB 2Y2NA 4UPKA 5BS7A 3UTAD 3AYWC 5GSUD 3AZLA 5AVCC 4H9SA 4DQYB 3WA9A 3R45A 5AVBC 3X1UB 3VH5T 5B33D 3AZFA 4Z2MG 1ZLAD 3W99A 1M19B 4KUDD 5G49A 3X1UC 1P3PB 4WU9C 4YS3A 2G5IC 1P3MB 2L5AA 1R4VA 2F8NG 1F66D 3AFAA 3AZNB 5DNMA 1P3LA 3LJAA 3AZHC 4XUJC 1EQZA 5BNXA 2JSSA 5CP6C 3W98B 2DF4C 5AVCA 2YFVB 3MNND 4LD9A 4G91B 3X1VA 3LZ1D 3AZMB 4Z66B 4YM6D 3AZNC 5CPIB 3REHA 5F99B 4J8UD 4QLCB 2F8NA 5AV5D 4ZUXB 3REJB 3UT9D 5BO0B 3W98C 2Y2OA 3AZGB 3REIC 3KUYA 1JFIB 2LY8A 3AZMC 5CPIC 3X1TA 4Z2MH 5CPJC 5F99C 4QLCC 3LZ0D 4CSRB 4ZBJC 1P3KB 3AZGC 4WU9D 3AZKB 1M19A 4NE3A 4X23D 5B2JD 3O62D 5AV8B 1B6WA 1P3ID 1P3PA 4EO5B 2F8NH 1P3MA 1P3KC 2DQNC 5CHLB 3AZKC 3AZHD 4XUJD 1WWIA 3C1CA 1B67A 5AV8C 4J8VC 5DNNB 2RIQA 3WTPA 4EO5C 3A6NB 3TU4D 1KX4C 3AZEC 3W98A 2YFVA 2FJ7C 3W97B 4Z66A 2HIOD 4KGCB 4Z5TB 3MGRD 5DNNC 3MGQC 5B32B 3REID 4ZUXA 3REJA 5BO0A 3LELA 4J8XB 3RELD 3AZGA 1P3FB 4KHAB 1JFIA 3W97C 4KGCC 1P3BD 5B40C 4WU8D 5B32C 1P3AC 1H3OA 4J8XC 3REKD 5AY8B 4JJNA 3UTBB 1U35C 4XZQA 3FDDA 3WAAA 2CWEA 3B0CT 5GXQB 1P34B 1AOIB 3AV2B 1ID3D 5FUGA 1PZRA 5B31B 3AV1B 5AY8C 2Y2MA 5B32G 1HQ3D 3WA9B 3UTBC 3AZFB 5BS7C 3AZED 4DRAA 4E45A 3AZLC 1ULYA 4H9SC 3VH6A 3A6NA 3AN2D 3AV2C 1AOIC 3AV1C 2ZM5A 2G5HC 3UTAB 5GT3B 3WA9C 5GT0A 3AZFC 4YS3B 3AZJD 4Z5TA 4KGCA 3WTPE 5BT1C 1P3OD 5B0YD 4R8PB 3NQUB 5B32A 2UWXA 1Z2CB 2PYOD 2BG1A 1ZLAB 5B40D 1P3FA 4KHAA 1P3LB 4YS3C 5B31G 1P3AD 2Y2QA 3AZID 4LD9B 1U35D 5B2IB 1HTAA 2Y2GA 3AFAC 3X1VB 5AY8A 5DNMC 1P3LC 1Q9CA 3REHB 3LJAC 3UTBA 2F8NB 2AROB 3W96B 1EQZC 2NZDD 5GXQA 1BH9A 3MGSD 3AV2A 2BYKA 1P34A 1AOIA 4LD9C 1W2EA 2CV5A 5B31A 3X1SB 3KUYB 3WKJD 3X1VC 3AV1A 2RVQD 4NFTA 3X1TB 3MVDD 3REHC 3VH6W 1KX5A 2ZY3A 2NQBB 4J8WB 3KUYC 3W99D 3UTAA 5GT3A 5AV5B 3X1TC 5AV6B 4AWLB 1S32D 5GSUA 3B0DB 5JA4A 2NQBC 3C1BD 4R8PA 3NQUA 3A1IA 4M6BA 4J8WC 3MGPB 1M19C 2ZY2A
chains in the Genus database with same CATH topology
5B33A 3LZ0B 3C1CB 1ZLAA 3B6GB 5AV6C 1P3PC 2J8PA 3VH6T 3WTPB 3H0RC 3EPHA 1P3MC 3AFAD 1M1AD 5DNMD 4X23B 4KUDA 5B2IA 3LJAD 3C1CC 5E5AB 3AYWD 5AVCD 3WTPC 2AROA 3W96A 2VQRA 3LELB 5AVBD 4G91C 3X1SA 1P3GB 4Z66C 5JRGB 4ZUXC 3REJC 3MNNA 1H3OB 3LELC 2NQBA 5CPKB 3X1UD 3LZ1A 5B0ZB 4YM6A 4J8WA 2HIOB 5AV9B 4JJNB 4J8UA 5AV5A 4XZQB 5AV6A 3UT9A 1M18B 3WAAB 4CAYA 2FFFB 5FUGB 5CPKC 3MGPA 1P3PD 5AV9C 4JJNC 4WU8B 3LZ0A 1KX3B 3B6GA 1P3MD 3WAAC 4XZQC 5CP6D 5B1LB 3AZND 1TAFB 5B1MB 4X23A 5B2JA 1P3IA 3B6FB 4HGAB 5GT0B 1KX3C 5E5AA 1ID3B 3W98D 3KWQB 3KXBB 3A6NC 2F8NK 3AZMD 4Z66D 5CPID 5B1MC 5CPJD 3B6FC 5F99D 4H9OA 4QLCD 1P3GA 5GT0C 4WNNB 4ZUXD 1T3UA 4Z5TC 5JRGA 3AZGD 5CPKA 5B24B 5B0ZA 2HIOA 3AZJB 3MGRA 5AV9A 1P3FC 3EPLA 4WJ3C 1TZYB 1M18A 1P3KD 3RELA 1BH9B 3AZKD 2BYKB 3NQJB 2CV5B 5AV8D 5B24C 4H9QA 4J8VD 1P3BA 4WU8A 1KX4D 1KX3A 3AZIB 1BFMA 4G92B 3REKA 1KX5B 5GXQC 5B1LA 2FJ7D 1P34C 2HUEB 4E44A 3B0BA 2CV5C 5B31C 1TAFA 5B1MA 3B6FA 5DNND 4DRBA 3MGQD 3A6ND 5GSUB 2XD1A 1ID3A 5JA4B 1KX5C 3EG5B 3KWQA 4NE5A 3KXBA 3W97D 1HQ3A 3H0LC 3MVDB 2BYMA 4Z5TD 5B33B 4KGCD 3UTAC 5GT3C 3KFUG 4H9NB 5B32D 4WNNA 4J8XD 5GSUC 3AN2A 2Y2IA 4R8PC 5BNVB 1P3FD 4KUDB 5B24A 5B33C 1ZLAC 3AZJA 1P3OA 3F6TA 1TZYA 5AY8D 2PYOA 1F66B 3NQJA 3UTBD 4KUDC 5B2IC 2Y2KA 3EPKA 1P34D 3AZLD 3AV2D 1AOID 3AZIA 3AL0C 2AROC 3W96C 5B31D 3MNNB 3AV1D 1F66C 3WA9D 3LZ1B 3AZFD 4YM6B 3X1SC 3AYWB 5C3IB 4J8UB 2JE5A 5BT1D 3UT9B 2NZDA 4CAYB 3MGSA 3MNNC 2W8SA 5GT3D 3WKJA 3LZ1C 4YM6C 4YS3D 1BH8B 3MVDA 5C3IC 4J8UC 5AV5C 2Y2PA 4H9NA 4R8PD 4AWLC 2Y2HA 3UT9C 3P5JB 3B0DC 4WU9B 5BNVA 3MGPC 1P3LD 5B2JB 3O62B 1P3IB 2ZY5A 1S32A 3LZ0C 1EQZD 3B6GC 3C1BA 4LD9D 5B2ID 3V9RB 3X1VD 3AZHB 4XUJB 1F66A 4X23C 5B2JC 3O62C 3REHD 4H9OB 1P3IC 2F8ND 1N1JA 2AROD 5CP6B 3W96D 5E5AC 4UUZB 3TU4B 4H9PA 3X1SD 1M1AA 3KUYD 3X1TD 1P3GC 3MGRB 3AYWA 2NQBD 3REIB 3TU4C 5JRGC 2JCHA 3RELB 4J8WD 1M19D 5AVBA 5CPJB 3EPJA 5AV6D 5B0ZC 4H9QB 2HIOC 2IO5B 1BH8A 4ZBJB 3MGRC 1P3BB 1A7WA 1M18C 3REKB 3RELC 3MGPD 3X1UA 4WU9A 3C1CD 3B6GD 2IO5C 4H9RB 3WTPD 3O62A 1P3BC 4WU8C 3REKC 5B1LC 3V9RA 4J8VB 1HQ3B 5E5AD 3AZHA 2BYMB 4XUJA 1KX4B 2YFWB 5KDMB 4HGAC 5CP6A 3AZEB 4UUZA 3REJD 3LELD 2FJ7B 2Y2JA 3TU4A 3AN2B 1ID3C 3KWQC 3AZNA 3KXBC 1P3GD 1HQ3C 3MGQB 5JRGD 1P3OB 5B0YB 3REIA 3AN2C 5CPKD 4NE6A 3AZMA 5B0ZD 4WZSB 5CPIA 2PYOB 5AV9D 5CPJA 4JJND 1F1EA 3B0CW 5F99A 4QLCA 5B40B 4XZQD 1M18D 1P3AB 3WAAD 3AZJC 1P3OC 5B0YC 1TZYC 1U35B 2PYOC 1KX3D 3VH5A 4CSRA 4H9RA 5B1LD 1P3KA 2Y2LA 3AZIC 2NZDB 3MGSB 4G92C 3AZKA 5B1MD 3B6FD 2XD5A 3WKJB 2HUEC 5AV8A 5GT0D 4J8VA 3AZLB 1KX4A 2YFWA 5KDMA 3KWQD 3AZEA 3KXBD 2NZDC 2FJ7A 3MGSC 3R45B 3WKJC 3W99B 2RVQC 2ZY4A 5DNNA 3IP4C 3MVDC 3MGQA 1S32B 1WWSA 5B0YA 2F2AC 3C1BB 5G49B 5B24D 3W97A 3A1KA 3W99C 5B40A 1N1JB 1TZYD 1S32C 1P3AA 4J8XA 5GXQD 3AFAB 3C1BC 4H9PB 2CV5D 1M1AB 3VH5W 5DNMB 1U35A 3LJAB 3H0MC 1EQZB 4WV4B 5BNXB 5AVCB 1KX5D 3KSYA 1KU5A 1M1AC 5AVBB 2Y2NA 4UPKA 5BS7A 3UTAD 3AYWC 5GSUD 3AZLA 5AVCC 4H9SA 4DQYB 3WA9A 3R45A 5AVBC 3X1UB 3VH5T 5B33D 3AZFA 4Z2MG 1ZLAD 3W99A 1M19B 4KUDD 5G49A 3X1UC 1P3PB 4WU9C 4YS3A 2G5IC 1P3MB 2L5AA 1R4VA 2F8NG 1F66D 3AFAA 3AZNB 5DNMA 1P3LA 3LJAA 3AZHC 4XUJC 1EQZA 5BNXA 2JSSA 5CP6C 3W98B 2DF4C 5AVCA 2YFVB 3MNND 4LD9A 4G91B 3X1VA 3LZ1D 3AZMB 4Z66B 4YM6D 3AZNC 5CPIB 3REHA 5F99B 4J8UD 4QLCB 2F8NA 5AV5D 4ZUXB 3REJB 3UT9D 5BO0B 3W98C 2Y2OA 3AZGB 3REIC 3KUYA 1JFIB 2LY8A 3AZMC 5CPIC 3X1TA 4Z2MH 5CPJC 5F99C 4QLCC 3LZ0D 4CSRB 4ZBJC 1P3KB 3AZGC 4WU9D 3AZKB 1M19A 4NE3A 4X23D 5B2JD 3O62D 5AV8B 1B6WA 1P3ID 1P3PA 4EO5B 2F8NH 1P3MA 1P3KC 2DQNC 5CHLB 3AZKC 3AZHD 4XUJD 1WWIA 3C1CA 1B67A 5AV8C 4J8VC 5DNNB 2RIQA 3WTPA 4EO5C 3A6NB 3TU4D 1KX4C 3AZEC 3W98A 2YFVA 2FJ7C 3W97B 4Z66A 2HIOD 4KGCB 4Z5TB 3MGRD 5DNNC 3MGQC 5B32B 3REID 4ZUXA 3REJA 5BO0A 3LELA 4J8XB 3RELD 3AZGA 1P3FB 4KHAB 1JFIA 3W97C 4KGCC 1P3BD 5B40C 4WU8D 5B32C 1P3AC 1H3OA 4J8XC 3REKD 5AY8B 4JJNA 3UTBB 1U35C 4XZQA 3FDDA 3WAAA 2CWEA 3B0CT 5GXQB 1P34B 1AOIB 3AV2B 1ID3D 5FUGA 1PZRA 5B31B 3AV1B 5AY8C 2Y2MA 5B32G 1HQ3D 3WA9B 3UTBC 3AZFB 5BS7C 3AZED 4DRAA 4E45A 3AZLC 1ULYA 4H9SC 3VH6A 3A6NA 3AN2D 3AV2C 1AOIC 3AV1C 2ZM5A 2G5HC 3UTAB 5GT3B 3WA9C 5GT0A 3AZFC 4YS3B 3AZJD 4Z5TA 4KGCA 3WTPE 5BT1C 1P3OD 5B0YD 4R8PB 3NQUB 5B32A 2UWXA 1Z2CB 2PYOD 2BG1A 1ZLAB 5B40D 1P3FA 4KHAA 1P3LB 4YS3C 5B31G 1P3AD 2Y2QA 3AZID 4LD9B 1U35D 5B2IB 1HTAA 2Y2GA 3AFAC 3X1VB 5AY8A 5DNMC 1P3LC 1Q9CA 3REHB 3LJAC 3UTBA 2F8NB 2AROB 3W96B 1EQZC 2NZDD 5GXQA 1BH9A 3MGSD 3AV2A 2BYKA 1P34A 1AOIA 4LD9C 1W2EA 2CV5A 5B31A 3X1SB 3KUYB 3WKJD 3X1VC 3AV1A 2RVQD 4NFTA 3X1TB 3MVDD 3REHC 3VH6W 1KX5A 2ZY3A 2NQBB 4J8WB 3KUYC 3W99D 3UTAA 5GT3A 5AV5B 3X1TC 5AV6B 4AWLB 1S32D 5GSUA 3B0DB 5JA4A 2NQBC 3C1BD 4R8PA 3NQUA 3A1IA 4M6BA 4J8WC 3MGPB 1M19C 2ZY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 A;  3LZ0 B;  3C1C B;  1ZLA A;  3B6G B;  5AV6 C;  1P3P C;  3VH6 T;  3WTP B;  1P3M C;  3AFA D;  1M1A D;  5DNM D;  4X23 B;  4KUD A;  5B2I A;  3LJA D;  3C1C C;  5E5A B;  3AYW D;  5AVC D;  3WTP C;  2ARO A;  3W96 A;  3LEL B;  5AVB D;  4G91 C;  3X1S A;  1P3G B;  4Z66 C;  5JRG B;  4ZUX C;  3REJ C;  3MNN A;  1H3O B;  3LEL C;  2NQB A;  5CPK B;  3X1U D;  3LZ1 A;  5B0Z B;  4YM6 A;  4J8W A;  2HIO B;  5AV9 B;  4JJN B;  4J8U A;  5AV5 A;  4XZQ B;  5AV6 A;  3UT9 A;  1M18 B;  3WAA B;  4CAY A;  5FUG B;  5CPK C;  3MGP A;  1P3P D;  5AV9 C;  4JJN C;  4WU8 B;  3LZ0 A;  1KX3 B;  3B6G A;  1P3M D;  3WAA C;  4XZQ C;  5CP6 D;  5B1L B;  3AZN D;  1TAF B;  5B1M B;  4X23 A;  5B2J A;  1P3I A;  3B6F B;  4HGA B;  5GT0 B;  1KX3 C;  5E5A A;  1ID3 B;  3W98 D;  3KWQ B;  3KXB B;  3A6N C;  2F8N K;  3AZM D;  4Z66 D;  5CPI D;  5B1M C;  5CPJ D;  3B6F C;  5F99 D;  4H9O A;  4QLC D;  1P3G A;  5GT0 C;  4WNN B;  4ZUX D;  4Z5T C;  5JRG A;  3AZG D;  5CPK A;  5B24 B;  5B0Z A;  2HIO A;  3AZJ B;  3MGR A;  5AV9 A;  1P3F C;  1TZY B;  1M18 A;  1P3K D;  3REL A;  1BH9 B;  3AZK D;  2BYK B;  3NQJ B;  2CV5 B;  5AV8 D;  5B24 C;  4H9Q A;  4J8V D;  1P3B A;  4WU8 A;  1KX4 D;  1KX3 A;  3AZI B;  1BFM A;  4G92 B;  3REK A;  1KX5 B;  5GXQ C;  5B1L A;  2FJ7 D;  1P34 C;  2HUE B;  4E44 A;  3B0B A;  2CV5 C;  5B31 C;  1TAF A;  5B1M A;  3B6F A;  5DNN D;  4DRB A;  3MGQ D;  3A6N D;  5GSU B;  1ID3 A;  5JA4 B;  1KX5 C;  3KWQ A;  4NE5 A;  3KXB A;  3W97 D;  1HQ3 A;  3MVD B;  2BYM A;  4Z5T D;  5B33 B;  4KGC D;  3UTA C;  5GT3 C;  4H9N B;  5B32 D;  4WNN A;  4J8X D;  5GSU C;  3AN2 A;  4R8P C;  5BNV B;  1P3F D;  4KUD B;  5B24 A;  5B33 C;  1ZLA C;  3AZJ A;  1P3O A;  1TZY A;  5AY8 D;  2PYO A;  1F66 B;  3NQJ A;  3UTB D;  4KUD C;  5B2I C;  1P34 D;  3AZL D;  3AV2 D;  1AOI D;  3AZI A;  2ARO C;  3W96 C;  5B31 D;  3MNN B;  3AV1 D;  1F66 C;  3WA9 D;  3LZ1 B;  3AZF D;  4YM6 B;  3X1S C;  3AYW B;  5C3I B;  4J8U B;  5BT1 D;  3UT9 B;  2NZD A;  4CAY B;  3MGS A;  3MNN C;  5GT3 D;  3WKJ A;  3LZ1 C;  4YM6 C;  4YS3 D;  1BH8 B;  3MVD A;  5C3I C;  4J8U C;  5AV5 C;  3UT9 C;  4H9N A;  4R8P D;  4AWL C;  3B0D C;  4WU9 B;  5BNV A;  3MGP C;  1P3L D;  5B2J B;  3O62 B;  1P3I B;  1S32 A;  3LZ0 C;  1EQZ D;  3B6G C;  3C1B A;  4LD9 D;  5B2I D;  3V9R B;  3X1V D;  3AZH B;  4XUJ B;  1F66 A;  4X23 C;  5B2J C;  3O62 C;  3REH D;  4H9O B;  1P3I C;  2F8N D;  1N1J A;  2ARO D;  5CP6 B;  3W96 D;  5E5A C;  4UUZ B;  3TU4 B;  4H9P A;  3X1S D;  1M1A A;  3KUY D;  3X1T D;  1P3G C;  3MGR B;  3AYW A;  2NQB D;  3REI B;  3TU4 C;  5JRG C;  3REL B;  4J8W D;  1M19 D;  5AVB A;  5CPJ B;  5AV6 D;  5B0Z C;  4H9Q B;  2HIO C;  2IO5 B;  1BH8 A;  4ZBJ B;  3MGR C;  1P3B B;  1A7W A;  1M18 C;  3REK B;  3REL C;  3MGP D;  3X1U A;  4WU9 A;  3C1C D;  3B6G D;  2IO5 C;  4H9R B;  3WTP D;  3O62 A;  1P3B C;  4WU8 C;  3REK C;  5B1L C;  3V9R A;  4J8V B;  1HQ3 B;  5E5A D;  3AZH A;  2BYM B;  4XUJ A;  1KX4 B;  2YFW B;  5KDM B;  4HGA C;  5CP6 A;  3AZE B;  4UUZ A;  3REJ D;  3LEL D;  2FJ7 B;  3TU4 A;  1ID3 C;  3AN2 B;  3KWQ C;  3AZN A;  3KXB C;  1P3G D;  1HQ3 C;  3MGQ B;  5JRG D;  1P3O B;  5B0Y B;  3REI A;  3AN2 C;  5CPK D;  4NE6 A;  3AZM A;  5B0Z D;  4WZS B;  5CPI A;  2PYO B;  5AV9 D;  5CPJ A;  4JJN D;  1F1E A;  3B0C W;  5F99 A;  4QLC A;  5B40 B;  4XZQ D;  1M18 D;  1P3A B;  3WAA D;  3AZJ C;  1P3O C;  5B0Y C;  1TZY C;  1U35 B;  2PYO C;  1KX3 D;  3VH5 A;  4CSR A;  4H9R A;  5B1L D;  1P3K A;  3AZI C;  2NZD B;  3MGS B;  4G92 C;  3AZK A;  5B1M D;  3B6F D;  3WKJ B;  2HUE C;  5AV8 A;  5GT0 D;  4J8V A;  3AZL B;  1KX4 A;  2YFW A;  5KDM A;  3KWQ D;  3AZE A;  3KXB D;  2NZD C;  2FJ7 A;  3MGS C;  3R45 B;  3WKJ C;  3W99 B;  2RVQ C;  5DNN A;  3MVD C;  3MGQ A;  1S32 B;  1WWS A;  5B0Y A;  3C1B B;  5G49 B;  5B24 D;  3W97 A;  3W99 C;  5B40 A;  1N1J B;  1TZY D;  1S32 C;  1P3A A;  4J8X A;  5GXQ D;  3AFA B;  3C1B C;  4H9P B;  2CV5 D;  1M1A B;  3VH5 W;  5DNM B;  1U35 A;  3LJA B;  1EQZ B;  4WV4 B;  5BNX B;  5AVC B;  1KX5 D;  3KSY A;  1KU5 A;  1M1A C;  5AVB B;  5BS7 A;  3UTA D;  3AYW C;  5GSU D;  3AZL A;  5AVC C;  4H9S A;  3WA9 A;  3R45 A;  5AVB C;  3X1U B;  3VH5 T;  5B33 D;  3AZF A;  4Z2M G;  1ZLA D;  3W99 A;  1M19 B;  4KUD D;  5G49 A;  3X1U C;  1P3P B;  4WU9 C;  4YS3 A;  1P3M B;  2L5A A;  1R4V A;  2F8N G;  1F66 D;  3AFA A;  3AZN B;  5DNM A;  1P3L A;  3LJA A;  3AZH C;  4XUJ C;  1EQZ A;  5BNX A;  2JSS A;  5CP6 C;  3W98 B;  5AVC A;  2YFV B;  3MNN D;  4LD9 A;  4G91 B;  3X1V A;  3LZ1 D;  3AZM B;  4Z66 B;  4YM6 D;  3AZN C;  5CPI B;  3REH A;  5F99 B;  4J8U D;  4QLC B;  2F8N A;  5AV5 D;  4ZUX B;  3REJ B;  3UT9 D;  5BO0 B;  3W98 C;  3AZG B;  3REI C;  3KUY A;  1JFI B;  2LY8 A;  3AZM C;  5CPI C;  3X1T A;  4Z2M H;  5CPJ C;  5F99 C;  4QLC C;  3LZ0 D;  4CSR B;  4ZBJ C;  1P3K B;  3AZG C;  4WU9 D;  3AZK B;  1M19 A;  4NE3 A;  4X23 D;  5B2J D;  3O62 D;  5AV8 B;  1B6W A;  1P3I D;  1P3P A;  4EO5 B;  2F8N H;  1P3M A;  1P3K C;  5CHL B;  3AZK C;  3AZH D;  4XUJ D;  1WWI A;  3C1C A;  1B67 A;  5AV8 C;  4J8V C;  5DNN B;  3WTP A;  4EO5 C;  3A6N B;  3TU4 D;  1KX4 C;  3AZE C;  3W98 A;  2YFV A;  2FJ7 C;  3W97 B;  4Z66 A;  2HIO D;  4KGC B;  4Z5T B;  3MGR D;  5DNN C;  3MGQ C;  5B32 B;  3REI D;  4ZUX A;  3REJ A;  5BO0 A;  3LEL A;  4J8X B;  3REL D;  3AZG A;  1P3F B;  4KHA B;  1JFI A;  3W97 C;  4KGC C;  1P3B D;  5B40 C;  4WU8 D;  5B32 C;  1P3A C;  1H3O A;  4J8X C;  3REK D;  5AY8 B;  4JJN A;  3UTB B;  1U35 C;  4XZQ A;  3WAA A;  2CWE A;  3B0C T;  5GXQ B;  1P34 B;  1AOI B;  3AV2 B;  1ID3 D;  5FUG A;  5B31 B;  3AV1 B;  5AY8 C;  5B32 G;  1HQ3 D;  3WA9 B;  3UTB C;  3AZF B;  5BS7 C;  3AZE D;  4DRA A;  4E45 A;  3AZL C;  1ULY A;  4H9S C;  3VH6 A;  3A6N A;  3AN2 D;  3AV2 C;  1AOI C;  3AV1 C;  3UTA B;  5GT3 B;  3WA9 C;  5GT0 A;  3AZF C;  4YS3 B;  3AZJ D;  4Z5T A;  4KGC A;  3WTP E;  5BT1 C;  1P3O D;  5B0Y D;  4R8P B;  3NQU B;  5B32 A;  2PYO D;  1ZLA B;  5B40 D;  1P3F A;  4KHA A;  1P3L B;  4YS3 C;  5B31 G;  1P3A D;  3AZI D;  4LD9 B;  1U35 D;  5B2I B;  1HTA A;  3AFA C;  3X1V B;  5AY8 A;  5DNM C;  1P3L C;  1Q9C A;  3REH B;  3LJA C;  3UTB A;  2F8N B;  2ARO B;  3W96 B;  1EQZ C;  2NZD D;  5GXQ A;  1BH9 A;  3MGS D;  3AV2 A;  2BYK A;  1P34 A;  1AOI A;  4LD9 C;  2CV5 A;  3X1S B;  5B31 A;  3KUY B;  3WKJ D;  3X1V C;  3AV1 A;  2RVQ D;  4NFT A;  3X1T B;  3MVD D;  3REH C;  3VH6 W;  1KX5 A;  2NQB B;  4J8W B;  3KUY C;  3W99 D;  3UTA A;  5GT3 A;  5AV5 B;  3X1T C;  5AV6 B;  4AWL B;  1S32 D;  5GSU A;  3B0D B;  5JA4 A;  2NQB C;  3C1B D;  4R8P A;  3NQU A;  4M6B A;  4J8W C;  3MGP B;  1M19 C; 
#chains in the Genus database with same CATH topology
 5B33 A;  3LZ0 B;  3C1C B;  1ZLA A;  3B6G B;  5AV6 C;  1P3P C;  2J8P A;  3VH6 T;  3WTP B;  3H0R C;  3EPH A;  1P3M C;  3AFA D;  1M1A D;  5DNM D;  4X23 B;  4KUD A;  5B2I A;  3LJA D;  3C1C C;  5E5A B;  3AYW D;  5AVC D;  3WTP C;  2ARO A;  3W96 A;  2VQR A;  3LEL B;  5AVB D;  4G91 C;  3X1S A;  1P3G B;  4Z66 C;  5JRG B;  4ZUX C;  3REJ C;  3MNN A;  1H3O B;  3LEL C;  2NQB A;  5CPK B;  3X1U D;  3LZ1 A;  5B0Z B;  4YM6 A;  4J8W A;  2HIO B;  5AV9 B;  4JJN B;  4J8U A;  5AV5 A;  4XZQ B;  5AV6 A;  3UT9 A;  1M18 B;  3WAA B;  4CAY A;  2FFF B;  5FUG B;  5CPK C;  3MGP A;  1P3P D;  5AV9 C;  4JJN C;  4WU8 B;  3LZ0 A;  1KX3 B;  3B6G A;  1P3M D;  3WAA C;  4XZQ C;  5CP6 D;  5B1L B;  3AZN D;  1TAF B;  5B1M B;  4X23 A;  5B2J A;  1P3I A;  3B6F B;  4HGA B;  5GT0 B;  1KX3 C;  5E5A A;  1ID3 B;  3W98 D;  3KWQ B;  3KXB B;  3A6N C;  2F8N K;  3AZM D;  4Z66 D;  5CPI D;  5B1M C;  5CPJ D;  3B6F C;  5F99 D;  4H9O A;  4QLC D;  1P3G A;  5GT0 C;  4WNN B;  4ZUX D;  1T3U A;  4Z5T C;  5JRG A;  3AZG D;  5CPK A;  5B24 B;  5B0Z A;  2HIO A;  3AZJ B;  3MGR A;  5AV9 A;  1P3F C;  3EPL A;  4WJ3 C;  1TZY B;  1M18 A;  1P3K D;  3REL A;  1BH9 B;  3AZK D;  2BYK B;  3NQJ B;  2CV5 B;  5AV8 D;  5B24 C;  4H9Q A;  4J8V D;  1P3B A;  4WU8 A;  1KX4 D;  1KX3 A;  3AZI B;  1BFM A;  4G92 B;  3REK A;  1KX5 B;  5GXQ C;  5B1L A;  2FJ7 D;  1P34 C;  2HUE B;  4E44 A;  3B0B A;  2CV5 C;  5B31 C;  1TAF A;  5B1M A;  3B6F A;  5DNN D;  4DRB A;  3MGQ D;  3A6N D;  5GSU B;  2XD1 A;  1ID3 A;  5JA4 B;  1KX5 C;  3EG5 B;  3KWQ A;  4NE5 A;  3KXB A;  3W97 D;  1HQ3 A;  3H0L C;  3MVD B;  2BYM A;  4Z5T D;  5B33 B;  4KGC D;  3UTA C;  5GT3 C;  3KFU G;  4H9N B;  5B32 D;  4WNN A;  4J8X D;  5GSU C;  3AN2 A;  2Y2I A;  4R8P C;  5BNV B;  1P3F D;  4KUD B;  5B24 A;  5B33 C;  1ZLA C;  3AZJ A;  1P3O A;  3F6T A;  1TZY A;  5AY8 D;  2PYO A;  1F66 B;  3NQJ A;  3UTB D;  4KUD C;  5B2I C;  2Y2K A;  3EPK A;  1P34 D;  3AZL D;  3AV2 D;  1AOI D;  3AZI A;  3AL0 C;  2ARO C;  3W96 C;  5B31 D;  3MNN B;  3AV1 D;  1F66 C;  3WA9 D;  3LZ1 B;  3AZF D;  4YM6 B;  3X1S C;  3AYW B;  5C3I B;  4J8U B;  2JE5 A;  5BT1 D;  3UT9 B;  2NZD A;  4CAY B;  3MGS A;  3MNN C;  2W8S A;  5GT3 D;  3WKJ A;  3LZ1 C;  4YM6 C;  4YS3 D;  1BH8 B;  3MVD A;  5C3I C;  4J8U C;  5AV5 C;  2Y2P A;  4H9N A;  4R8P D;  4AWL C;  2Y2H A;  3UT9 C;  3P5J B;  3B0D C;  4WU9 B;  5BNV A;  3MGP C;  1P3L D;  5B2J B;  3O62 B;  1P3I B;  2ZY5 A;  1S32 A;  3LZ0 C;  1EQZ D;  3B6G C;  3C1B A;  4LD9 D;  5B2I D;  3V9R B;  3X1V D;  3AZH B;  4XUJ B;  1F66 A;  4X23 C;  5B2J C;  3O62 C;  3REH D;  4H9O B;  1P3I C;  2F8N D;  1N1J A;  2ARO D;  5CP6 B;  3W96 D;  5E5A C;  4UUZ B;  3TU4 B;  4H9P A;  3X1S D;  1M1A A;  3KUY D;  3X1T D;  1P3G C;  3MGR B;  3AYW A;  2NQB D;  3REI B;  3TU4 C;  5JRG C;  2JCH A;  3REL B;  4J8W D;  1M19 D;  5AVB A;  5CPJ B;  3EPJ A;  5AV6 D;  5B0Z C;  4H9Q B;  2HIO C;  2IO5 B;  1BH8 A;  4ZBJ B;  3MGR C;  1P3B B;  1A7W A;  1M18 C;  3REK B;  3REL C;  3MGP D;  3X1U A;  4WU9 A;  3C1C D;  3B6G D;  2IO5 C;  4H9R B;  3WTP D;  3O62 A;  1P3B C;  4WU8 C;  3REK C;  5B1L C;  3V9R A;  4J8V B;  1HQ3 B;  5E5A D;  3AZH A;  2BYM B;  4XUJ A;  1KX4 B;  2YFW B;  5KDM B;  4HGA C;  5CP6 A;  3AZE B;  4UUZ A;  3REJ D;  3LEL D;  2FJ7 B;  2Y2J A;  3TU4 A;  3AN2 B;  1ID3 C;  3KWQ C;  3AZN A;  3KXB C;  1P3G D;  1HQ3 C;  3MGQ B;  5JRG D;  1P3O B;  5B0Y B;  3REI A;  3AN2 C;  5CPK D;  4NE6 A;  3AZM A;  5B0Z D;  4WZS B;  5CPI A;  2PYO B;  5AV9 D;  5CPJ A;  4JJN D;  1F1E A;  3B0C W;  5F99 A;  4QLC A;  5B40 B;  4XZQ D;  1M18 D;  1P3A B;  3WAA D;  3AZJ C;  1P3O C;  5B0Y C;  1TZY C;  1U35 B;  2PYO C;  1KX3 D;  3VH5 A;  4CSR A;  4H9R A;  5B1L D;  1P3K A;  2Y2L A;  3AZI C;  2NZD B;  3MGS B;  4G92 C;  3AZK A;  5B1M D;  3B6F D;  2XD5 A;  3WKJ B;  2HUE C;  5AV8 A;  5GT0 D;  4J8V A;  3AZL B;  1KX4 A;  2YFW A;  5KDM A;  3KWQ D;  3AZE A;  3KXB D;  2NZD C;  2FJ7 A;  3MGS C;  3R45 B;  3WKJ C;  3W99 B;  2RVQ C;  2ZY4 A;  5DNN A;  3IP4 C;  3MVD C;  3MGQ A;  1S32 B;  1WWS A;  5B0Y A;  2F2A C;  3C1B B;  5G49 B;  5B24 D;  3W97 A;  3A1K A;  3W99 C;  5B40 A;  1N1J B;  1TZY D;  1S32 C;  1P3A A;  4J8X A;  5GXQ D;  3AFA B;  3C1B C;  4H9P B;  2CV5 D;  1M1A B;  3VH5 W;  5DNM B;  1U35 A;  3LJA B;  3H0M C;  1EQZ B;  4WV4 B;  5BNX B;  5AVC B;  1KX5 D;  3KSY A;  1KU5 A;  1M1A C;  5AVB B;  2Y2N A;  4UPK A;  5BS7 A;  3UTA D;  3AYW C;  5GSU D;  3AZL A;  5AVC C;  4H9S A;  4DQY B;  3WA9 A;  3R45 A;  5AVB C;  3X1U B;  3VH5 T;  5B33 D;  3AZF A;  4Z2M G;  1ZLA D;  3W99 A;  1M19 B;  4KUD D;  5G49 A;  3X1U C;  1P3P B;  4WU9 C;  4YS3 A;  2G5I C;  1P3M B;  2L5A A;  1R4V A;  2F8N G;  1F66 D;  3AFA A;  3AZN B;  5DNM A;  1P3L A;  3LJA A;  3AZH C;  4XUJ C;  1EQZ A;  5BNX A;  2JSS A;  5CP6 C;  3W98 B;  2DF4 C;  5AVC A;  2YFV B;  3MNN D;  4LD9 A;  4G91 B;  3X1V A;  3LZ1 D;  3AZM B;  4Z66 B;  4YM6 D;  3AZN C;  5CPI B;  3REH A;  5F99 B;  4J8U D;  4QLC B;  2F8N A;  5AV5 D;  4ZUX B;  3REJ B;  3UT9 D;  5BO0 B;  3W98 C;  2Y2O A;  3AZG B;  3REI C;  3KUY A;  1JFI B;  2LY8 A;  3AZM C;  5CPI C;  3X1T A;  4Z2M H;  5CPJ C;  5F99 C;  4QLC C;  3LZ0 D;  4CSR B;  4ZBJ C;  1P3K B;  3AZG C;  4WU9 D;  3AZK B;  1M19 A;  4NE3 A;  4X23 D;  5B2J D;  3O62 D;  5AV8 B;  1B6W A;  1P3I D;  1P3P A;  4EO5 B;  2F8N H;  1P3M A;  1P3K C;  2DQN C;  5CHL B;  3AZK C;  3AZH D;  4XUJ D;  1WWI A;  3C1C A;  1B67 A;  5AV8 C;  4J8V C;  5DNN B;  2RIQ A;  3WTP A;  4EO5 C;  3A6N B;  3TU4 D;  1KX4 C;  3AZE C;  3W98 A;  2YFV A;  2FJ7 C;  3W97 B;  4Z66 A;  2HIO D;  4KGC B;  4Z5T B;  3MGR D;  5DNN C;  3MGQ C;  5B32 B;  3REI D;  4ZUX A;  3REJ A;  5BO0 A;  3LEL A;  4J8X B;  3REL D;  3AZG A;  1P3F B;  4KHA B;  1JFI A;  3W97 C;  4KGC C;  1P3B D;  5B40 C;  4WU8 D;  5B32 C;  1P3A C;  1H3O A;  4J8X C;  3REK D;  5AY8 B;  4JJN A;  3UTB B;  1U35 C;  4XZQ A;  3FDD A;  3WAA A;  2CWE A;  3B0C T;  5GXQ B;  1P34 B;  1AOI B;  3AV2 B;  1ID3 D;  5FUG A;  1PZR A;  5B31 B;  3AV1 B;  5AY8 C;  2Y2M A;  5B32 G;  1HQ3 D;  3WA9 B;  3UTB C;  3AZF B;  5BS7 C;  3AZE D;  4DRA A;  4E45 A;  3AZL C;  1ULY A;  4H9S C;  3VH6 A;  3A6N A;  3AN2 D;  3AV2 C;  1AOI C;  3AV1 C;  2ZM5 A;  2G5H C;  3UTA B;  5GT3 B;  3WA9 C;  5GT0 A;  3AZF C;  4YS3 B;  3AZJ D;  4Z5T A;  4KGC A;  3WTP E;  5BT1 C;  1P3O D;  5B0Y D;  4R8P B;  3NQU B;  5B32 A;  2UWX A;  1Z2C B;  2PYO D;  2BG1 A;  1ZLA B;  5B40 D;  1P3F A;  4KHA A;  1P3L B;  4YS3 C;  5B31 G;  1P3A D;  2Y2Q A;  3AZI D;  4LD9 B;  1U35 D;  5B2I B;  1HTA A;  2Y2G A;  3AFA C;  3X1V B;  5AY8 A;  5DNM C;  1P3L C;  1Q9C A;  3REH B;  3LJA C;  3UTB A;  2F8N B;  2ARO B;  3W96 B;  1EQZ C;  2NZD D;  5GXQ A;  1BH9 A;  3MGS D;  3AV2 A;  2BYK A;  1P34 A;  1AOI A;  4LD9 C;  1W2E A;  2CV5 A;  5B31 A;  3X1S B;  3KUY B;  3WKJ D;  3X1V C;  3AV1 A;  2RVQ D;  4NFT A;  3X1T B;  3MVD D;  3REH C;  3VH6 W;  1KX5 A;  2ZY3 A;  2NQB B;  4J8W B;  3KUY C;  3W99 D;  3UTA A;  5GT3 A;  5AV5 B;  3X1T C;  5AV6 B;  4AWL B;  1S32 D;  5GSU A;  3B0D B;  5JA4 A;  2NQB C;  3C1B D;  4R8P A;  3NQU A;  3A1I A;  4M6B A;  4J8W C;  3MGP B;  1M19 C;  2ZY2 A; 
#chains in the Genus database with same CATH homology
 5B33 A;  3LZ0 B;  3C1C B;  1ZLA A;  3B6G B;  5AV6 C;  1P3P C;  2J8P A;  3VH6 T;  3WTP B;  3H0R C;  3EPH A;  1P3M C;  3AFA D;  1M1A D;  5DNM D;  4X23 B;  4KUD A;  5B2I A;  3LJA D;  3C1C C;  5E5A B;  3AYW D;  5AVC D;  3WTP C;  2ARO A;  3W96 A;  2VQR A;  3LEL B;  5AVB D;  4G91 C;  3X1S A;  1P3G B;  4Z66 C;  5JRG B;  4ZUX C;  3REJ C;  3MNN A;  1H3O B;  3LEL C;  2NQB A;  5CPK B;  3X1U D;  3LZ1 A;  5B0Z B;  4YM6 A;  4J8W A;  2HIO B;  5AV9 B;  4JJN B;  4J8U A;  5AV5 A;  4XZQ B;  5AV6 A;  3UT9 A;  1M18 B;  3WAA B;  4CAY A;  2FFF B;  5FUG B;  5CPK C;  3MGP A;  1P3P D;  5AV9 C;  4JJN C;  4WU8 B;  3LZ0 A;  1KX3 B;  3B6G A;  1P3M D;  3WAA C;  4XZQ C;  5CP6 D;  5B1L B;  3AZN D;  1TAF B;  5B1M B;  4X23 A;  5B2J A;  1P3I A;  3B6F B;  4HGA B;  5GT0 B;  1KX3 C;  5E5A A;  1ID3 B;  3W98 D;  3KWQ B;  3KXB B;  3A6N C;  2F8N K;  3AZM D;  4Z66 D;  5CPI D;  5B1M C;  5CPJ D;  3B6F C;  5F99 D;  4H9O A;  4QLC D;  1P3G A;  5GT0 C;  4WNN B;  4ZUX D;  1T3U A;  4Z5T C;  5JRG A;  3AZG D;  5CPK A;  5B24 B;  5B0Z A;  2HIO A;  3AZJ B;  3MGR A;  5AV9 A;  1P3F C;  3EPL A;  4WJ3 C;  1TZY B;  1M18 A;  1P3K D;  3REL A;  1BH9 B;  3AZK D;  2BYK B;  3NQJ B;  2CV5 B;  5AV8 D;  5B24 C;  4H9Q A;  4J8V D;  1P3B A;  4WU8 A;  1KX4 D;  1KX3 A;  3AZI B;  1BFM A;  4G92 B;  3REK A;  1KX5 B;  5GXQ C;  5B1L A;  2FJ7 D;  1P34 C;  2HUE B;  4E44 A;  3B0B A;  2CV5 C;  5B31 C;  1TAF A;  5B1M A;  3B6F A;  5DNN D;  4DRB A;  3MGQ D;  3A6N D;  5GSU B;  2XD1 A;  1ID3 A;  5JA4 B;  1KX5 C;  3EG5 B;  3KWQ A;  4NE5 A;  3KXB A;  3W97 D;  1HQ3 A;  3H0L C;  3MVD B;  2BYM A;  4Z5T D;  5B33 B;  4KGC D;  3UTA C;  5GT3 C;  3KFU G;  4H9N B;  5B32 D;  4WNN A;  4J8X D;  5GSU C;  3AN2 A;  2Y2I A;  4R8P C;  5BNV B;  1P3F D;  4KUD B;  5B24 A;  5B33 C;  1ZLA C;  3AZJ A;  1P3O A;  3F6T A;  1TZY A;  5AY8 D;  2PYO A;  1F66 B;  3NQJ A;  3UTB D;  4KUD C;  5B2I C;  2Y2K A;  3EPK A;  1P34 D;  3AZL D;  3AV2 D;  1AOI D;  3AZI A;  3AL0 C;  2ARO C;  3W96 C;  5B31 D;  3MNN B;  3AV1 D;  1F66 C;  3WA9 D;  3LZ1 B;  3AZF D;  4YM6 B;  3X1S C;  3AYW B;  5C3I B;  4J8U B;  2JE5 A;  5BT1 D;  3UT9 B;  2NZD A;  4CAY B;  3MGS A;  3MNN C;  2W8S A;  5GT3 D;  3WKJ A;  3LZ1 C;  4YM6 C;  4YS3 D;  1BH8 B;  3MVD A;  5C3I C;  4J8U C;  5AV5 C;  2Y2P A;  4H9N A;  4R8P D;  4AWL C;  2Y2H A;  3UT9 C;  3P5J B;  3B0D C;  4WU9 B;  5BNV A;  3MGP C;  1P3L D;  5B2J B;  3O62 B;  1P3I B;  2ZY5 A;  1S32 A;  3LZ0 C;  1EQZ D;  3B6G C;  3C1B A;  4LD9 D;  5B2I D;  3V9R B;  3X1V D;  3AZH B;  4XUJ B;  1F66 A;  4X23 C;  5B2J C;  3O62 C;  3REH D;  4H9O B;  1P3I C;  2F8N D;  1N1J A;  2ARO D;  5CP6 B;  3W96 D;  5E5A C;  4UUZ B;  3TU4 B;  4H9P A;  3X1S D;  1M1A A;  3KUY D;  3X1T D;  1P3G C;  3MGR B;  3AYW A;  2NQB D;  3REI B;  3TU4 C;  5JRG C;  2JCH A;  3REL B;  4J8W D;  1M19 D;  5AVB A;  5CPJ B;  3EPJ A;  5AV6 D;  5B0Z C;  4H9Q B;  2HIO C;  2IO5 B;  1BH8 A;  4ZBJ B;  3MGR C;  1P3B B;  1A7W A;  1M18 C;  3REK B;  3REL C;  3MGP D;  3X1U A;  4WU9 A;  3C1C D;  3B6G D;  2IO5 C;  4H9R B;  3WTP D;  3O62 A;  1P3B C;  4WU8 C;  3REK C;  5B1L C;  3V9R A;  4J8V B;  1HQ3 B;  5E5A D;  3AZH A;  2BYM B;  4XUJ A;  1KX4 B;  2YFW B;  5KDM B;  4HGA C;  5CP6 A;  3AZE B;  4UUZ A;  3REJ D;  3LEL D;  2FJ7 B;  2Y2J A;  3TU4 A;  3AN2 B;  1ID3 C;  3KWQ C;  3AZN A;  3KXB C;  1P3G D;  1HQ3 C;  3MGQ B;  5JRG D;  1P3O B;  5B0Y B;  3REI A;  3AN2 C;  5CPK D;  4NE6 A;  3AZM A;  5B0Z D;  4WZS B;  5CPI A;  2PYO B;  5AV9 D;  5CPJ A;  4JJN D;  1F1E A;  3B0C W;  5F99 A;  4QLC A;  5B40 B;  4XZQ D;  1M18 D;  1P3A B;  3WAA D;  3AZJ C;  1P3O C;  5B0Y C;  1TZY C;  1U35 B;  2PYO C;  1KX3 D;  3VH5 A;  4CSR A;  4H9R A;  5B1L D;  1P3K A;  2Y2L A;  3AZI C;  2NZD B;  3MGS B;  4G92 C;  3AZK A;  5B1M D;  3B6F D;  2XD5 A;  3WKJ B;  2HUE C;  5AV8 A;  5GT0 D;  4J8V A;  3AZL B;  1KX4 A;  2YFW A;  5KDM A;  3KWQ D;  3AZE A;  3KXB D;  2NZD C;  2FJ7 A;  3MGS C;  3R45 B;  3WKJ C;  3W99 B;  2RVQ C;  2ZY4 A;  5DNN A;  3IP4 C;  3MVD C;  3MGQ A;  1S32 B;  1WWS A;  5B0Y A;  2F2A C;  3C1B B;  5G49 B;  5B24 D;  3W97 A;  3A1K A;  3W99 C;  5B40 A;  1N1J B;  1TZY D;  1S32 C;  1P3A A;  4J8X A;  5GXQ D;  3AFA B;  3C1B C;  4H9P B;  2CV5 D;  1M1A B;  3VH5 W;  5DNM B;  1U35 A;  3LJA B;  3H0M C;  1EQZ B;  4WV4 B;  5BNX B;  5AVC B;  1KX5 D;  3KSY A;  1KU5 A;  1M1A C;  5AVB B;  2Y2N A;  4UPK A;  5BS7 A;  3UTA D;  3AYW C;  5GSU D;  3AZL A;  5AVC C;  4H9S A;  4DQY B;  3WA9 A;  3R45 A;  5AVB C;  3X1U B;  3VH5 T;  5B33 D;  3AZF A;  4Z2M G;  1ZLA D;  3W99 A;  1M19 B;  4KUD D;  5G49 A;  3X1U C;  1P3P B;  4WU9 C;  4YS3 A;  2G5I C;  1P3M B;  2L5A A;  1R4V A;  2F8N G;  1F66 D;  3AFA A;  3AZN B;  5DNM A;  1P3L A;  3LJA A;  3AZH C;  4XUJ C;  1EQZ A;  5BNX A;  2JSS A;  5CP6 C;  3W98 B;  2DF4 C;  5AVC A;  2YFV B;  3MNN D;  4LD9 A;  4G91 B;  3X1V A;  3LZ1 D;  3AZM B;  4Z66 B;  4YM6 D;  3AZN C;  5CPI B;  3REH A;  5F99 B;  4J8U D;  4QLC B;  2F8N A;  5AV5 D;  4ZUX B;  3REJ B;  3UT9 D;  5BO0 B;  3W98 C;  2Y2O A;  3AZG B;  3REI C;  3KUY A;  1JFI B;  2LY8 A;  3AZM C;  5CPI C;  3X1T A;  4Z2M H;  5CPJ C;  5F99 C;  4QLC C;  3LZ0 D;  4CSR B;  4ZBJ C;  1P3K B;  3AZG C;  4WU9 D;  3AZK B;  1M19 A;  4NE3 A;  4X23 D;  5B2J D;  3O62 D;  5AV8 B;  1B6W A;  1P3I D;  1P3P A;  4EO5 B;  2F8N H;  1P3M A;  1P3K C;  2DQN C;  5CHL B;  3AZK C;  3AZH D;  4XUJ D;  1WWI A;  3C1C A;  1B67 A;  5AV8 C;  4J8V C;  5DNN B;  2RIQ A;  3WTP A;  4EO5 C;  3A6N B;  3TU4 D;  1KX4 C;  3AZE C;  3W98 A;  2YFV A;  2FJ7 C;  3W97 B;  4Z66 A;  2HIO D;  4KGC B;  4Z5T B;  3MGR D;  5DNN C;  3MGQ C;  5B32 B;  3REI D;  4ZUX A;  3REJ A;  5BO0 A;  3LEL A;  4J8X B;  3REL D;  3AZG A;  1P3F B;  4KHA B;  1JFI A;  3W97 C;  4KGC C;  1P3B D;  5B40 C;  4WU8 D;  5B32 C;  1P3A C;  1H3O A;  4J8X C;  3REK D;  5AY8 B;  4JJN A;  3UTB B;  1U35 C;  4XZQ A;  3FDD A;  3WAA A;  2CWE A;  3B0C T;  5GXQ B;  1P34 B;  1AOI B;  3AV2 B;  1ID3 D;  5FUG A;  1PZR A;  5B31 B;  3AV1 B;  5AY8 C;  2Y2M A;  5B32 G;  1HQ3 D;  3WA9 B;  3UTB C;  3AZF B;  5BS7 C;  3AZE D;  4DRA A;  4E45 A;  3AZL C;  1ULY A;  4H9S C;  3VH6 A;  3A6N A;  3AN2 D;  3AV2 C;  1AOI C;  3AV1 C;  2ZM5 A;  2G5H C;  3UTA B;  5GT3 B;  3WA9 C;  5GT0 A;  3AZF C;  4YS3 B;  3AZJ D;  4Z5T A;  4KGC A;  3WTP E;  5BT1 C;  1P3O D;  5B0Y D;  4R8P B;  3NQU B;  5B32 A;  2UWX A;  1Z2C B;  2PYO D;  2BG1 A;  1ZLA B;  5B40 D;  1P3F A;  4KHA A;  1P3L B;  4YS3 C;  5B31 G;  1P3A D;  2Y2Q A;  3AZI D;  4LD9 B;  1U35 D;  5B2I B;  1HTA A;  2Y2G A;  3AFA C;  3X1V B;  5AY8 A;  5DNM C;  1P3L C;  1Q9C A;  3REH B;  3LJA C;  3UTB A;  2F8N B;  2ARO B;  3W96 B;  1EQZ C;  2NZD D;  5GXQ A;  1BH9 A;  3MGS D;  3AV2 A;  2BYK A;  1P34 A;  1AOI A;  4LD9 C;  1W2E A;  2CV5 A;  5B31 A;  3X1S B;  3KUY B;  3WKJ D;  3X1V C;  3AV1 A;  2RVQ D;  4NFT A;  3X1T B;  3MVD D;  3REH C;  3VH6 W;  1KX5 A;  2ZY3 A;  2NQB B;  4J8W B;  3KUY C;  3W99 D;  3UTA A;  5GT3 A;  5AV5 B;  3X1T C;  5AV6 B;  4AWL B;  1S32 D;  5GSU A;  3B0D B;  5JA4 A;  2NQB C;  3C1B D;  4R8P A;  3NQU A;  3A1I A;  4M6B A;  4J8W C;  3MGP B;  1M19 C;  2ZY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...