5B1MA

The mouse nucleosome structure containing h3.1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mA00
5DNNB 5CPKA 4ZBJB 4J8XB 4G92B 1H3OA 1U35A 5AV5D 4LD9C 4LD9D 3LZ1B 3KWQC 3KWQD 3C1BA 2BYMB 5AV8A 2IO5B 4M6BA 3UTAB 4WU9C 4WU9D 3AZFA 3TU4A 3X1TD 3X1TC 1M19B 1Q9CA 4YS3C 4YS3D 1P3MA 1P3GB 4JJNC 4J8VC 4JJND 4J8VD 3LELA 5FUGB 3X1SA 5BNXB 4KHAB 5B32A 1P3BC 1KX4C 1P3BD 1KX3D 1KX4D 5B31A 4UUZB 3AZHA 5BNVA 5DNNA 3MGRC 1P3KB 4J8XA 1KX5B 3LZ1A 2BYMA 5BT1C 3LJAC 3LJAD 5CHLB 3MGPC 3MGPD 3UTAA 1P3AB 2RVQC 1ZLAC 2RVQD 1ZLAD 1M19A 2BYKB 3AZGD 3AZLB 1P3GA 5GXQC 1P3FB 5GXQD 5FUGA 1ID3B 4WZSB 5BNXA 5AV5B 4KHAA 5B1LD 5B2JB 3WAAC 3WAAD 5AV6C 3V9RB 1P3KA 5AV6D 4NE5A 1EQZB 2F8ND 3REHB 1KX5A 5AVBC 5AVBD 3WA9B 3AV1B 4YS3B 2FJ7C 4WV4B 2FJ7D 5AVCB 4QLCC 4QLCD 4J8VB 4Z2MH 3REIB 1P3AA 4HGAB 1KX3B 2BYKA 2AROC 2AROD 3AZLA 3B0BA 4YM6B 1P3FA 4R8PC 5F99D 3MGQB 4R8PD 3X1UC 5B1MD 1ID3A 5AV5A 3WTPE 4J8UC 4J8UD 5GT0C 5GT0D 5B2JA 5B0ZC 5B0ZD 3V9RA 1S32B 1EQZA 3REHA 3WA9A 3AV1A 3AN2B 3AZKC 3AZGB 4YS3A 5E5AC 3C1CB 5B32G 3UTBD 5AVCA 3AZJC 3WKJB 3B0CT 5B31G 3AZJD 2CV5C 4J8VA 3REIA 5B0YD 3A6NC 3A6ND 1KX3A 5B1LB 3RELB 4XZQB 1F66C 1F66D 4YM6A 1M1AC 3WAAB 1M1AD 1HTAA 3MGQA 3KXBB 4WU8B 2NZDB 5C3IC 1S32A 3B0CW 4CSRB 3WTPB 5AV9C 3W98B 3B0DC 5AV9D 4J8WC 4J8WD 4X23B 3MVDB 2YFVB 5GSUC 3AZGA 3AN2A 5GSUD 3C1CA 3WKJA 5B24D 5F99B 5CPJB 3W96D 5B1MB 1HQ3C 5BO0B 5B40B 1HQ3D 4NE6A 4AWLB 3MGSC 3MGSD 4J8UB 1P3IB 5GT0B 3B6FC 5B1LA 3RELA 3B6FD 4XZQA 5JRGB 3WAAA 4KGCB 3KXBA 4Z2MG 4ZUXB 5BS7C 4WU8A 4EO5B 4Z66C 4Z66D 5AY8B 5B33D 5B33C 3AYWB 2F8NH 2NZDA 3UTBB 5CPIB 4KUDB 5DNMB 2NQBB 4CSRA 5B0YB 3WTPA 3AZMC 3W98A 3UT9B 3AZMD 3AZIB 3X1VB 4X23A 3MVDA 2YFVA 2HIOB 3W97C 3W97D 1P3PB 5F99A 5B2IB 5CPJA 5B1MA 5BO0A 5B40A 5GT3C 4J8UA 5GT3D 1P3IA 3REJB 3AZNC 5JRGA 3AZND 1TZYB 4KGCA 4ZUXA 3MGRD 3AYWA 5AY8A 4J8WB 3MNNB 5GSUB 3UTBA 5CPIA 4H9RB 5BT1D 3B6GB 3REKC 1M18B 4KUDA 5B24B 5DNMA 3REKD 2NQBA 3W96B 5B0YA 1F1EA 3UT9A 3O62B 3AZIA 3X1VA 1P3OB 1P3LB 1KU5A 5JA4B 2HIOA 1P3PA 5B2IA 5B33B 4LD9B 4H9PB 2JSSA 3KWQB 1N1JB 3REJA 3AZEC 4Z5TC 3AZED 1TZYA 4UUZA 4WU9B 1P34C 3X1TB 1P34D 3MNNA 5GSUA 5KDMB 3KUYC 3KUYD 3LZ0C 1M18A 3B6GA 3LZ0D 5CP6C 5B24A 5CP6D 3W96A 4NE3A 4JJNB 2PYOC 2PYOD 2F8NG 3O62A 1P3OA 1P3BB 1P3LA 5JA4A 1KX4B 1AOIC 3AFAC 1AOID 3AFAD 1BFMA 3MGRB 5BS7A 4XUJC 5B33A 4XUJD 3X1UD 1WWSA 4LD9A 4H9SC 4H9PA 3KWQA 5CPKC 1N1JA 5CPKD 3LJAB 1U35C 1U35D 3MGPB 3C1BC 3C1BD 5AV8C 4WU9A 5AV8D 3X1TA 1ZLAB 5KDMA 3AZFC 3TU4C 3AZKD 3TU4D 5E5AD 4E45A 5GXQB 2CV5D 4JJNA 2LY8A 3AV2C 3AV2D 1P3BA 1KX4A 3LELC 3LELD 3X1SC 3X1SD 5B32C 4G91C 4DRBA 5B32D 5AV6B 3MGRA 2F8NB 1P34B 3AZHC 3AZHD 3NQJB 5AVBB 4ZBJC 3LJAA 4J8XC 4G92C 4J8XD 2FJ7B 3MGPA 3LZ1C 4QLCB 3LZ1D 2PYOB 2IO5C 1ZLAA 3UTAC 3UTAD 3KSYA 2AROB 5GXQA 5G49B 4R8PB 4XUJB 3X1UB 3VH5T 1P3GC 1P3GD 5B0ZB 5AV6A 2F8NA 1P34A 3NQJA 5AVBA 1P3KC 1P3KD 3AZKB 2FJ7A 1BH8B 5E5AB 3AZJB 4QLCA 2CV5B 3AV2B 3A6NB 3VH5W 1P3AC 2AROA 1P3AD 1F66B 1R4VA 1M1AB 5G49A 4R8PA 1BH9B 4XUJA 3X1UA 3AZLC 1JFIB 3AZLD 4H9SA 1P3FC 1P3FD 5GT0A 1ID3C 5AV5C 1ID3D 5B0ZA 2HUEC 5C3IB 5B2JC 5B2JD 4NFTA 5AV9B 3B0DB 1EQZC 3AZKA 1EQZD 1BH8A 5E5AA 3REHC 3REHD 3AZJA 2CV5A 3WA9C 3AV1C 3WA9D 3AV1D 3AV2A 3W99C 3A6NA 1HQ3B 3R45B 3W99D 5AVCC 5AVCD 3MGSB 3B6FB 3REIC 3REID 4HGAC 4H9OB 1F66A 1M1AA 1KX3C 1BH9A 1JFIA 4Z66B 1B67A 4YM6C 4YM6D 4E44A 3MGQC 3MGQD 4Z5TD 3VH6A 5AV9A 3AZMB 4J8WA 1S32C 1S32D 4H9RA 3W97B 3AN2C 3AZGC 3AN2D 4H9NB 3C1CC 1HQ3A 3R45A 3C1CD 3WKJC 3WKJD 3MGSA 5GT3B 3B6FA 4H9OA 3AZNB 4DRAA 2HUEB 1ULYA 5B1LC 3RELC 3RELD 4XZQC 4WNNB 4XZQD 4Z66A 3KXBC 3KXBD 4WU8C 4WU8D 2NZDC 3REKB 2NZDD 3VH5A 2F8NK 3W99B 1WWIA 3AZMA 4CAYB 3WTPC 1TAFB 3WTPD 3W98C 3W98D 3AZFD 3W97A 4X23C 3MVDC 4X23D 3MVDD 4H9NA 5GT3A 5F99C 5CPJC 1P3MC 5CPJD 1P3MD 5B1MC 3AZEB 1B6WA 5B40C 4H9QB 4Z5TB 5B40D 3VH6T 4AWLC 3AZNA 1P3IC 1P3ID 4WNNA 5B31C 5JRGC 2CWEA 5JRGD 5B31D 4KGCC 5DNNC 4KGCD 5DNND 4ZUXC 4ZUXD 3KUYB 4EO5C 3AYWC 5AY8C 3AYWD 5AY8D 3LZ0B 3REKA 5CP6B 3UTBC 2YFWB 5CPIC 3W99A 5CPID 4KUDC 5DNMC 4KUDD 2NQBC 5DNMD 2NQBD 4CAYA 5B0YC 1TAFA 3UT9C 1AOIB 3UT9D 3AFAB 3X1VC 3AZIC 1M19C 3AZID 3NQUB 3X1VD 3VH6W 1M19D 2HIOC 2HIOD 1P3PC 5B2IC 1P3PD 5B2ID 3AZEA 5CPKB 4H9QA 4Z5TA 1H3OB 1U35B 3REJC 3C1BB 3REJD 5AV8B 1A7WA 1TZYC 1TZYD 3KUYA 3AZFB 3TU4B 3LZ0A 1KX5C 5CP6A 1KX5D 3MNNC 3MNND 2PYOA 2YFWA 3B6GC 1M18C 2L5AA 5B24C 1M18D 3B6GD 1P3MB 3W96C 3LELB 1AOIA 3X1SB 3AFAA 3O62C 3O62D 3NQUA 1P3OC 5B32B 1P3LC 1P3OD 4G91B 1P3LD 5B31B 3AZHB 5BNVB
chains in the Genus database with same CATH superfamily
5DNNB 5CPKA 4ZBJB 4J8XB 4G92B 1H3OA 1U35A 5AV5D 4LD9C 4LD9D 3LZ1B 3KWQC 3KWQD 3C1BA 2BYMB 5AV8A 2IO5B 4M6BA 3UTAB 4WU9C 4WU9D 3AZFA 3TU4A 3X1TD 3X1TC 1M19B 2Y2HA 1Q9CA 4YS3C 4YS3D 1P3MA 1P3GB 4JJNC 4J8VC 4JJND 4J8VD 3LELA 5FUGB 3X1SA 5BNXB 4KHAB 5B32A 1P3BC 1KX4C 1P3BD 1KX3D 1KX4D 5B31A 2ZY3A 4UUZB 3AZHA 5BNVA 5DNNA 3MGRC 1P3KB 4J8XA 1KX5B 3LZ1A 2DF4C 2BYMA 5BT1C 3LJAC 3LJAD 5CHLB 1W2EA 4UPKA 3MGPC 3MGPD 3UTAA 1P3AB 2RVQC 1ZLAC 2RVQD 1ZLAD 1M19A 2BYKB 3AZGD 2FFFB 2ZY2A 3AZLB 1P3GA 5GXQC 1P3FB 5GXQD 5FUGA 1ID3B 4WZSB 5BNXA 5AV5B 4KHAA 5B1LD 5B2JB 3WAAC 3WAAD 5AV6C 3V9RB 1P3KA 5AV6D 4NE5A 1EQZB 2F8ND 3REHB 1KX5A 5AVBC 5AVBD 3WA9B 3AV1B 4YS3B 2FJ7C 4WV4B 2FJ7D 5AVCB 4QLCC 4QLCD 4J8VB 4Z2MH 3REIB 1P3AA 4HGAB 1KX3B 2BYKA 2AROC 2AROD 3AZLA 3B0BA 4YM6B 1P3FA 4R8PC 5F99D 3MGQB 4R8PD 3X1UC 5B1MD 1ID3A 5AV5A 3WTPE 4J8UC 4J8UD 5GT0C 2JCHA 5GT0D 5B2JA 2JE5A 5B0ZC 5B0ZD 3V9RA 1S32B 1EQZA 3REHA 3WA9A 3AV1A 3AN2B 3AZKC 3AZGB 4YS3A 5E5AC 3C1CB 5B32G 3UTBD 5AVCA 3AZJC 3WKJB 3B0CT 5B31G 3AZJD 2CV5C 3FDDA 4J8VA 3REIA 5B0YD 3A6NC 3A6ND 1KX3A 5B1LB 3RELB 4XZQB 1F66C 1F66D 4YM6A 1M1AC 3WAAB 1M1AD 1HTAA 3MGQA 3KXBB 4WU8B 2RIQA 2NZDB 5C3IC 1S32A 3B0CW 4CSRB 3WTPB 5AV9C 3W98B 3B0DC 5AV9D 4J8WC 4J8WD 4X23B 3MVDB 2YFVB 5GSUC 3AZGA 3AN2A 5GSUD 3C1CA 4DQYB 3H0MC 3WKJA 5B24D 5F99B 5CPJB 3W96D 5B1MB 1HQ3C 5BO0B 5B40B 1HQ3D 4NE6A 4AWLB 3MGSC 3MGSD 4J8UB 1P3IB 5GT0B 3B6FC 5B1LA 3RELA 3B6FD 4XZQA 5JRGB 3WAAA 2Y2PA 2Y2LA 4KGCB 3KXBA 4Z2MG 4ZUXB 5BS7C 4WU8A 4EO5B 4Z66C 4Z66D 5AY8B 5B33D 5B33C 3AYWB 2F8NH 2NZDA 3UTBB 5CPIB 4KUDB 5DNMB 2NQBB 4CSRA 3EPKA 5B0YB 3WTPA 3AZMC 3W98A 3UT9B 3AZMD 3AZIB 3X1VB 4X23A 3MVDA 2YFVA 2HIOB 3W97C 3W97D 1P3PB 3EG5B 5F99A 5B2IB 5CPJA 2F2AC 5B1MA 5BO0A 5B40A 5GT3C 4J8UA 5GT3D 1P3IA 3REJB 3AZNC 5JRGA 3AZND 1TZYB 4KGCA 4ZUXA 3MGRD 3AYWA 1T3UA 5AY8A 3EPJA 2Y2MA 4J8WB 3F6TA 3MNNB 5GSUB 3UTBA 5CPIA 4H9RB 5BT1D 3B6GB 3REKC 1M18B 4KUDA 5B24B 5DNMA 3REKD 2NQBA 3W96B 5B0YA 2J8PA 1F1EA 3UT9A 3O62B 3AZIA 3X1VA 1P3OB 1P3LB 1KU5A 5JA4B 2HIOA 1P3PA 5B2IA 2ZM5A 5B33B 4LD9B 4H9PB 2JSSA 3KWQB 1N1JB 3REJA 3AZEC 4Z5TC 3AZED 1TZYA 4UUZA 4WU9B 1P34C 3X1TB 1P34D 3MNNA 5GSUA 5KDMB 3KUYC 3KUYD 3LZ0C 1M18A 3B6GA 3LZ0D 5CP6C 5B24A 5CP6D 3W96A 4NE3A 4JJNB 2PYOC 2PYOD 2F8NG 3O62A 2ZY4A 1P3OA 1P3BB 1P3LA 5JA4A 1KX4B 1AOIC 3AFAC 1AOID 3AFAD 1BFMA 3MGRB 5BS7A 4XUJC 5B33A 4XUJD 3X1UD 1WWSA 4LD9A 4H9SC 4H9PA 3KWQA 5CPKC 1N1JA 5CPKD 3LJAB 2ZY5A 1U35C 1U35D 3MGPB 3C1BC 3C1BD 5AV8C 4WU9A 5AV8D 3X1TA 1PZRA 1ZLAB 5KDMA 3AZFC 3TU4C 3AZKD 3TU4D 5E5AD 2XD5A 4E45A 5GXQB 2CV5D 4JJNA 2LY8A 3AV2C 3AV2D 1P3BA 2Y2NA 1KX4A 3LELC 3LELD 3X1SC 3X1SD 5B32C 4G91C 4DRBA 5B32D 5AV6B 3MGRA 2F8NB 1P34B 3AZHC 3AZHD 3NQJB 5AVBB 4ZBJC 3LJAA 4J8XC 4G92C 4J8XD 2FJ7B 3MGPA 3LZ1C 4QLCB 3LZ1D 2PYOB 2Y2KA 2IO5C 1ZLAA 2Y2IA 3UTAC 3UTAD 3KSYA 2AROB 5GXQA 5G49B 4R8PB 4XUJB 3X1UB 2DQNC 3VH5T 1P3GC 1P3GD 5B0ZB 2Y2OA 5AV6A 2F8NA 1P34A 3NQJA 5AVBA 1P3KC 1P3KD 3AZKB 2FJ7A 1BH8B 5E5AB 3AZJB 4QLCA 2CV5B 3AV2B 3A6NB 3VH5W 1P3AC 2AROA 1P3AD 1F66B 1R4VA 1M1AB 5G49A 4R8PA 1BH9B 4XUJA 3X1UA 3AZLC 1JFIB 3AZLD 4H9SA 1P3FC 1P3FD 5GT0A 1ID3C 5AV5C 1ID3D 3A1KA 4WJ3C 5B0ZA 2HUEC 5C3IB 5B2JC 5B2JD 4NFTA 5AV9B 3B0DB 3H0LC 1EQZC 3AZKA 1EQZD 2G5HC 1BH8A 2Y2QA 5E5AA 3REHC 3REHD 3AZJA 2CV5A 3WA9C 3AV1C 3WA9D 3AV1D 3AV2A 3W99C 3A6NA 1HQ3B 3R45B 3W99D 5AVCC 5AVCD 3MGSB 3B6FB 3REIC 3REID 4HGAC 4H9OB 1F66A 1M1AA 1KX3C 2Y2JA 1BH9A 1JFIA 2BG1A 4Z66B 1B67A 4YM6C 4YM6D 4E44A 3MGQC 3MGQD 4Z5TD 3VH6A 2Y2GA 5AV9A 3AZMB 4J8WA 1S32C 1S32D 3A1IA 4H9RA 3W97B 3AN2C 3AZGC 3AN2D 3EPHA 4H9NB 3C1CC 1HQ3A 3R45A 3C1CD 3WKJC 3WKJD 3MGSA 5GT3B 3B6FA 2XD1A 4H9OA 3AZNB 4DRAA 2W8SA 2HUEB 1ULYA 1Z2CB 5B1LC 3RELC 3RELD 4XZQC 4WNNB 4XZQD 4Z66A 3KXBC 3H0RC 3KXBD 4WU8C 4WU8D 2NZDC 3REKB 2NZDD 3VH5A 2F8NK 3W99B 1WWIA 2VQRA 3AZMA 4CAYB 3WTPC 1TAFB 3WTPD 3W98C 3W98D 3AZFD 3P5JB 3W97A 3AL0C 4X23C 3MVDC 4X23D 3MVDD 4H9NA 5GT3A 5F99C 5CPJC 1P3MC 5CPJD 1P3MD 5B1MC 3AZEB 1B6WA 5B40C 4H9QB 4Z5TB 5B40D 3VH6T 4AWLC 3AZNA 1P3IC 1P3ID 4WNNA 5B31C 5JRGC 2CWEA 5JRGD 5B31D 4KGCC 5DNNC 4KGCD 5DNND 2G5IC 2UWXA 4ZUXC 4ZUXD 3KUYB 4EO5C 3AYWC 5AY8C 3AYWD 5AY8D 3LZ0B 3REKA 5CP6B 3UTBC 2YFWB 5CPIC 3W99A 5CPID 4KUDC 5DNMC 4KUDD 2NQBC 5DNMD 2NQBD 4CAYA 5B0YC 1TAFA 3UT9C 1AOIB 3UT9D 3AFAB 3X1VC 3AZIC 1M19C 3AZID 3NQUB 3X1VD 3VH6W 1M19D 2HIOC 2HIOD 3IP4C 1P3PC 5B2IC 1P3PD 5B2ID 3AZEA 5CPKB 4H9QA 4Z5TA 1H3OB 1U35B 3REJC 3C1BB 3REJD 5AV8B 1A7WA 1TZYC 3EPLA 1TZYD 3KUYA 3AZFB 3TU4B 3LZ0A 1KX5C 5CP6A 1KX5D 3KFUG 3MNNC 3MNND 2PYOA 2YFWA 3B6GC 1M18C 2L5AA 5B24C 1M18D 3B6GD 1P3MB 3W96C 3LELB 1AOIA 3X1SB 3AFAA 3O62C 3O62D 3NQUA 1P3OC 5B32B 1P3LC 1P3OD 4G91B 1P3LD 5B31B 3AZHB 5BNVB
chains in the Genus database with same CATH topology
5DNNB 5CPKA 4ZBJB 4J8XB 4G92B 1H3OA 1U35A 5AV5D 4LD9C 4LD9D 3LZ1B 3KWQC 3KWQD 3C1BA 2BYMB 5AV8A 2IO5B 4M6BA 3UTAB 4WU9C 4WU9D 3AZFA 3TU4A 3X1TD 3X1TC 1M19B 2Y2HA 1Q9CA 4YS3C 4YS3D 1P3MA 1P3GB 4JJNC 4J8VC 4JJND 4J8VD 3LELA 5FUGB 3X1SA 5BNXB 4KHAB 5B32A 1P3BC 1KX4C 1P3BD 1KX3D 1KX4D 5B31A 2ZY3A 4UUZB 3AZHA 5BNVA 5DNNA 3MGRC 1P3KB 4J8XA 1KX5B 3LZ1A 2DF4C 2BYMA 5BT1C 3LJAC 3LJAD 5CHLB 1W2EA 4UPKA 3MGPC 3MGPD 3UTAA 1P3AB 2RVQC 1ZLAC 2RVQD 1ZLAD 1M19A 2BYKB 3AZGD 2FFFB 2ZY2A 3AZLB 1P3GA 5GXQC 1P3FB 5GXQD 5FUGA 1ID3B 4WZSB 5BNXA 5AV5B 4KHAA 5B1LD 5B2JB 3WAAC 3WAAD 5AV6C 3V9RB 1P3KA 5AV6D 4NE5A 1EQZB 2F8ND 3REHB 1KX5A 5AVBC 5AVBD 3WA9B 3AV1B 4YS3B 2FJ7C 4WV4B 2FJ7D 5AVCB 4QLCC 4QLCD 4J8VB 4Z2MH 3REIB 1P3AA 4HGAB 1KX3B 2BYKA 2AROC 2AROD 3AZLA 3B0BA 4YM6B 1P3FA 4R8PC 5F99D 3MGQB 4R8PD 3X1UC 5B1MD 1ID3A 5AV5A 3WTPE 4J8UC 4J8UD 5GT0C 2JCHA 5GT0D 5B2JA 2JE5A 5B0ZC 5B0ZD 3V9RA 1S32B 1EQZA 3REHA 3WA9A 3AV1A 3AN2B 3AZKC 3AZGB 4YS3A 5E5AC 3C1CB 5B32G 3UTBD 5AVCA 3AZJC 3WKJB 3B0CT 5B31G 3AZJD 2CV5C 3FDDA 4J8VA 3REIA 5B0YD 3A6NC 3A6ND 1KX3A 5B1LB 3RELB 4XZQB 1F66C 1F66D 4YM6A 1M1AC 3WAAB 1M1AD 1HTAA 3MGQA 3KXBB 4WU8B 2RIQA 2NZDB 5C3IC 1S32A 3B0CW 4CSRB 3WTPB 5AV9C 3W98B 3B0DC 5AV9D 4J8WC 4J8WD 4X23B 3MVDB 2YFVB 5GSUC 3AZGA 3AN2A 5GSUD 3C1CA 4DQYB 3H0MC 3WKJA 5B24D 5F99B 5CPJB 3W96D 5B1MB 1HQ3C 5BO0B 5B40B 1HQ3D 4NE6A 4AWLB 3MGSC 3MGSD 4J8UB 1P3IB 5GT0B 3B6FC 5B1LA 3RELA 3B6FD 4XZQA 5JRGB 3WAAA 2Y2PA 2Y2LA 4KGCB 3KXBA 4Z2MG 4ZUXB 5BS7C 4WU8A 4EO5B 4Z66C 4Z66D 5AY8B 5B33D 5B33C 3AYWB 2F8NH 2NZDA 3UTBB 5CPIB 4KUDB 5DNMB 2NQBB 4CSRA 3EPKA 5B0YB 3WTPA 3AZMC 3W98A 3UT9B 3AZMD 3AZIB 3X1VB 4X23A 3MVDA 2YFVA 2HIOB 3W97C 3W97D 1P3PB 3EG5B 5F99A 5B2IB 5CPJA 2F2AC 5B1MA 5BO0A 5B40A 5GT3C 4J8UA 5GT3D 1P3IA 3REJB 3AZNC 5JRGA 3AZND 1TZYB 4KGCA 4ZUXA 3MGRD 3AYWA 1T3UA 5AY8A 3EPJA 2Y2MA 4J8WB 3F6TA 3MNNB 5GSUB 3UTBA 5CPIA 4H9RB 5BT1D 3B6GB 3REKC 1M18B 4KUDA 5B24B 5DNMA 3REKD 2NQBA 3W96B 5B0YA 2J8PA 1F1EA 3UT9A 3O62B 3AZIA 3X1VA 1P3OB 1P3LB 1KU5A 5JA4B 2HIOA 1P3PA 5B2IA 2ZM5A 5B33B 4LD9B 4H9PB 2JSSA 3KWQB 1N1JB 3REJA 3AZEC 4Z5TC 3AZED 1TZYA 4UUZA 4WU9B 1P34C 3X1TB 1P34D 3MNNA 5GSUA 5KDMB 3KUYC 3KUYD 3LZ0C 1M18A 3B6GA 3LZ0D 5CP6C 5B24A 5CP6D 3W96A 4NE3A 4JJNB 2PYOC 2PYOD 2F8NG 3O62A 2ZY4A 1P3OA 1P3BB 1P3LA 5JA4A 1KX4B 1AOIC 3AFAC 1AOID 3AFAD 1BFMA 3MGRB 5BS7A 4XUJC 5B33A 4XUJD 3X1UD 1WWSA 4LD9A 4H9SC 4H9PA 3KWQA 5CPKC 1N1JA 5CPKD 3LJAB 2ZY5A 1U35C 1U35D 3MGPB 3C1BC 3C1BD 5AV8C 4WU9A 5AV8D 3X1TA 1PZRA 1ZLAB 5KDMA 3AZFC 3TU4C 3AZKD 3TU4D 5E5AD 2XD5A 4E45A 5GXQB 2CV5D 4JJNA 2LY8A 3AV2C 3AV2D 1P3BA 2Y2NA 1KX4A 3LELC 3LELD 3X1SC 3X1SD 5B32C 4G91C 4DRBA 5B32D 5AV6B 3MGRA 2F8NB 1P34B 3AZHC 3AZHD 3NQJB 5AVBB 4ZBJC 3LJAA 4J8XC 4G92C 4J8XD 2FJ7B 3MGPA 3LZ1C 4QLCB 3LZ1D 2PYOB 2Y2KA 2IO5C 1ZLAA 2Y2IA 3UTAC 3UTAD 3KSYA 2AROB 5GXQA 5G49B 4R8PB 4XUJB 3X1UB 2DQNC 3VH5T 1P3GC 1P3GD 5B0ZB 2Y2OA 5AV6A 2F8NA 1P34A 3NQJA 5AVBA 1P3KC 1P3KD 3AZKB 2FJ7A 1BH8B 5E5AB 3AZJB 4QLCA 2CV5B 3AV2B 3A6NB 3VH5W 1P3AC 2AROA 1P3AD 1F66B 1R4VA 1M1AB 5G49A 4R8PA 1BH9B 4XUJA 3X1UA 3AZLC 1JFIB 3AZLD 4H9SA 1P3FC 1P3FD 5GT0A 1ID3C 5AV5C 1ID3D 3A1KA 4WJ3C 5B0ZA 2HUEC 5C3IB 5B2JC 5B2JD 4NFTA 5AV9B 3B0DB 3H0LC 1EQZC 3AZKA 1EQZD 2G5HC 1BH8A 2Y2QA 5E5AA 3REHC 3REHD 3AZJA 2CV5A 3WA9C 3AV1C 3WA9D 3AV1D 3AV2A 3W99C 3A6NA 1HQ3B 3R45B 3W99D 5AVCC 5AVCD 3MGSB 3B6FB 3REIC 3REID 4HGAC 4H9OB 1F66A 1M1AA 1KX3C 2Y2JA 1BH9A 1JFIA 2BG1A 4Z66B 1B67A 4YM6C 4YM6D 4E44A 3MGQC 3MGQD 4Z5TD 3VH6A 2Y2GA 5AV9A 3AZMB 4J8WA 1S32C 1S32D 3A1IA 4H9RA 3W97B 3AN2C 3AZGC 3AN2D 3EPHA 4H9NB 3C1CC 1HQ3A 3R45A 3C1CD 3WKJC 3WKJD 3MGSA 5GT3B 3B6FA 2XD1A 4H9OA 3AZNB 4DRAA 2W8SA 2HUEB 1ULYA 1Z2CB 5B1LC 3RELC 3RELD 4XZQC 4WNNB 4XZQD 4Z66A 3KXBC 3H0RC 3KXBD 4WU8C 4WU8D 2NZDC 3REKB 2NZDD 3VH5A 2F8NK 3W99B 1WWIA 2VQRA 3AZMA 4CAYB 3WTPC 1TAFB 3WTPD 3W98C 3W98D 3AZFD 3P5JB 3W97A 3AL0C 4X23C 3MVDC 4X23D 3MVDD 4H9NA 5GT3A 5F99C 5CPJC 1P3MC 5CPJD 1P3MD 5B1MC 3AZEB 1B6WA 5B40C 4H9QB 4Z5TB 5B40D 3VH6T 4AWLC 3AZNA 1P3IC 1P3ID 4WNNA 5B31C 5JRGC 2CWEA 5JRGD 5B31D 4KGCC 5DNNC 4KGCD 5DNND 2G5IC 2UWXA 4ZUXC 4ZUXD 3KUYB 4EO5C 3AYWC 5AY8C 3AYWD 5AY8D 3LZ0B 3REKA 5CP6B 3UTBC 2YFWB 5CPIC 3W99A 5CPID 4KUDC 5DNMC 4KUDD 2NQBC 5DNMD 2NQBD 4CAYA 5B0YC 1TAFA 3UT9C 1AOIB 3UT9D 3AFAB 3X1VC 3AZIC 1M19C 3AZID 3NQUB 3X1VD 3VH6W 1M19D 2HIOC 2HIOD 3IP4C 1P3PC 5B2IC 1P3PD 5B2ID 3AZEA 5CPKB 4H9QA 4Z5TA 1H3OB 1U35B 3REJC 3C1BB 3REJD 5AV8B 1A7WA 1TZYC 3EPLA 1TZYD 3KUYA 3AZFB 3TU4B 3LZ0A 1KX5C 5CP6A 1KX5D 3KFUG 3MNNC 3MNND 2PYOA 2YFWA 3B6GC 1M18C 2L5AA 5B24C 1M18D 3B6GD 1P3MB 3W96C 3LELB 1AOIA 3X1SB 3AFAA 3O62C 3O62D 3NQUA 1P3OC 5B32B 1P3LC 1P3OD 4G91B 1P3LD 5B31B 3AZHB 5BNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNN B;  5CPK A;  4ZBJ B;  4J8X B;  4G92 B;  1H3O A;  1U35 A;  5AV5 D;  4LD9 C;  4LD9 D;  3LZ1 B;  3KWQ C;  3KWQ D;  3C1B A;  2BYM B;  5AV8 A;  2IO5 B;  4M6B A;  3UTA B;  4WU9 C;  4WU9 D;  3AZF A;  3TU4 A;  3X1T D;  3X1T C;  1M19 B;  1Q9C A;  4YS3 C;  4YS3 D;  1P3M A;  1P3G B;  4JJN C;  4J8V C;  4JJN D;  4J8V D;  3LEL A;  5FUG B;  3X1S A;  5BNX B;  4KHA B;  5B32 A;  1P3B C;  1KX4 C;  1P3B D;  1KX3 D;  1KX4 D;  5B31 A;  4UUZ B;  3AZH A;  5BNV A;  5DNN A;  3MGR C;  1P3K B;  4J8X A;  1KX5 B;  3LZ1 A;  2BYM A;  5BT1 C;  3LJA C;  3LJA D;  5CHL B;  3MGP C;  3MGP D;  3UTA A;  1P3A B;  2RVQ C;  1ZLA C;  2RVQ D;  1ZLA D;  1M19 A;  2BYK B;  3AZG D;  3AZL B;  1P3G A;  5GXQ C;  1P3F B;  5GXQ D;  5FUG A;  1ID3 B;  4WZS B;  5BNX A;  5AV5 B;  4KHA A;  5B1L D;  5B2J B;  3WAA C;  3WAA D;  5AV6 C;  3V9R B;  1P3K A;  5AV6 D;  4NE5 A;  1EQZ B;  2F8N D;  3REH B;  1KX5 A;  5AVB C;  5AVB D;  3WA9 B;  3AV1 B;  4YS3 B;  2FJ7 C;  4WV4 B;  2FJ7 D;  5AVC B;  4QLC C;  4QLC D;  4J8V B;  4Z2M H;  3REI B;  1P3A A;  4HGA B;  1KX3 B;  2BYK A;  2ARO C;  2ARO D;  3AZL A;  3B0B A;  4YM6 B;  1P3F A;  4R8P C;  5F99 D;  3MGQ B;  4R8P D;  3X1U C;  5B1M D;  1ID3 A;  5AV5 A;  3WTP E;  4J8U C;  4J8U D;  5GT0 C;  5GT0 D;  5B2J A;  5B0Z C;  5B0Z D;  3V9R A;  1S32 B;  1EQZ A;  3REH A;  3WA9 A;  3AV1 A;  3AN2 B;  3AZK C;  3AZG B;  4YS3 A;  5E5A C;  3C1C B;  5B32 G;  3UTB D;  5AVC A;  3AZJ C;  3WKJ B;  3B0C T;  5B31 G;  3AZJ D;  2CV5 C;  4J8V A;  3REI A;  5B0Y D;  3A6N C;  3A6N D;  1KX3 A;  5B1L B;  3REL B;  4XZQ B;  1F66 C;  1F66 D;  4YM6 A;  1M1A C;  3WAA B;  1M1A D;  1HTA A;  3MGQ A;  3KXB B;  4WU8 B;  2NZD B;  5C3I C;  1S32 A;  3B0C W;  4CSR B;  3WTP B;  5AV9 C;  3W98 B;  3B0D C;  5AV9 D;  4J8W C;  4J8W D;  4X23 B;  3MVD B;  2YFV B;  5GSU C;  3AZG A;  3AN2 A;  5GSU D;  3C1C A;  3WKJ A;  5B24 D;  5F99 B;  5CPJ B;  3W96 D;  5B1M B;  1HQ3 C;  5BO0 B;  5B40 B;  1HQ3 D;  4NE6 A;  4AWL B;  3MGS C;  3MGS D;  4J8U B;  1P3I B;  5GT0 B;  3B6F C;  5B1L A;  3REL A;  3B6F D;  4XZQ A;  5JRG B;  3WAA A;  4KGC B;  3KXB A;  4Z2M G;  4ZUX B;  5BS7 C;  4WU8 A;  4EO5 B;  4Z66 C;  4Z66 D;  5AY8 B;  5B33 D;  5B33 C;  3AYW B;  2F8N H;  2NZD A;  3UTB B;  5CPI B;  4KUD B;  5DNM B;  2NQB B;  4CSR A;  5B0Y B;  3WTP A;  3AZM C;  3W98 A;  3UT9 B;  3AZM D;  3AZI B;  3X1V B;  4X23 A;  3MVD A;  2YFV A;  2HIO B;  3W97 C;  3W97 D;  1P3P B;  5F99 A;  5B2I B;  5CPJ A;  5B1M A;  5BO0 A;  5B40 A;  5GT3 C;  4J8U A;  5GT3 D;  1P3I A;  3REJ B;  3AZN C;  5JRG A;  3AZN D;  1TZY B;  4KGC A;  4ZUX A;  3MGR D;  3AYW A;  5AY8 A;  4J8W B;  3MNN B;  5GSU B;  3UTB A;  5CPI A;  4H9R B;  5BT1 D;  3B6G B;  3REK C;  1M18 B;  4KUD A;  5B24 B;  5DNM A;  3REK D;  2NQB A;  3W96 B;  5B0Y A;  1F1E A;  3UT9 A;  3O62 B;  3AZI A;  3X1V A;  1P3O B;  1P3L B;  1KU5 A;  5JA4 B;  2HIO A;  1P3P A;  5B2I A;  5B33 B;  4LD9 B;  4H9P B;  2JSS A;  3KWQ B;  1N1J B;  3REJ A;  3AZE C;  4Z5T C;  3AZE D;  1TZY A;  4UUZ A;  4WU9 B;  1P34 C;  3X1T B;  1P34 D;  3MNN A;  5GSU A;  5KDM B;  3KUY C;  3KUY D;  3LZ0 C;  1M18 A;  3B6G A;  3LZ0 D;  5CP6 C;  5B24 A;  5CP6 D;  3W96 A;  4NE3 A;  4JJN B;  2PYO C;  2PYO D;  2F8N G;  3O62 A;  1P3O A;  1P3B B;  1P3L A;  5JA4 A;  1KX4 B;  1AOI C;  3AFA C;  1AOI D;  3AFA D;  1BFM A;  3MGR B;  5BS7 A;  4XUJ C;  5B33 A;  4XUJ D;  3X1U D;  1WWS A;  4LD9 A;  4H9S C;  4H9P A;  3KWQ A;  5CPK C;  1N1J A;  5CPK D;  3LJA B;  1U35 C;  1U35 D;  3MGP B;  3C1B C;  3C1B D;  5AV8 C;  4WU9 A;  5AV8 D;  3X1T A;  1ZLA B;  5KDM A;  3AZF C;  3TU4 C;  3AZK D;  3TU4 D;  5E5A D;  4E45 A;  5GXQ B;  2CV5 D;  4JJN A;  2LY8 A;  3AV2 C;  3AV2 D;  1P3B A;  1KX4 A;  3LEL C;  3LEL D;  3X1S C;  3X1S D;  5B32 C;  4G91 C;  4DRB A;  5B32 D;  5AV6 B;  3MGR A;  2F8N B;  1P34 B;  3AZH C;  3AZH D;  3NQJ B;  5AVB B;  4ZBJ C;  3LJA A;  4J8X C;  4G92 C;  4J8X D;  2FJ7 B;  3MGP A;  3LZ1 C;  4QLC B;  3LZ1 D;  2PYO B;  2IO5 C;  1ZLA A;  3UTA C;  3UTA D;  3KSY A;  2ARO B;  5GXQ A;  5G49 B;  4R8P B;  4XUJ B;  3X1U B;  3VH5 T;  1P3G C;  1P3G D;  5B0Z B;  5AV6 A;  2F8N A;  1P34 A;  3NQJ A;  5AVB A;  1P3K C;  1P3K D;  3AZK B;  2FJ7 A;  1BH8 B;  5E5A B;  3AZJ B;  4QLC A;  2CV5 B;  3AV2 B;  3A6N B;  3VH5 W;  1P3A C;  2ARO A;  1P3A D;  1F66 B;  1R4V A;  1M1A B;  5G49 A;  4R8P A;  1BH9 B;  4XUJ A;  3X1U A;  3AZL C;  1JFI B;  3AZL D;  4H9S A;  1P3F C;  1P3F D;  5GT0 A;  1ID3 C;  5AV5 C;  1ID3 D;  5B0Z A;  2HUE C;  5C3I B;  5B2J C;  5B2J D;  4NFT A;  5AV9 B;  3B0D B;  1EQZ C;  3AZK A;  1EQZ D;  1BH8 A;  5E5A A;  3REH C;  3REH D;  3AZJ A;  2CV5 A;  3WA9 C;  3AV1 C;  3WA9 D;  3AV1 D;  3AV2 A;  3W99 C;  3A6N A;  1HQ3 B;  3R45 B;  3W99 D;  5AVC C;  5AVC D;  3MGS B;  3B6F B;  3REI C;  3REI D;  4HGA C;  4H9O B;  1F66 A;  1M1A A;  1KX3 C;  1BH9 A;  1JFI A;  4Z66 B;  1B67 A;  4YM6 C;  4YM6 D;  4E44 A;  3MGQ C;  3MGQ D;  4Z5T D;  3VH6 A;  5AV9 A;  3AZM B;  4J8W A;  1S32 C;  1S32 D;  4H9R A;  3W97 B;  3AN2 C;  3AZG C;  3AN2 D;  4H9N B;  3C1C C;  1HQ3 A;  3R45 A;  3C1C D;  3WKJ C;  3WKJ D;  3MGS A;  5GT3 B;  3B6F A;  4H9O A;  3AZN B;  4DRA A;  2HUE B;  1ULY A;  5B1L C;  3REL C;  3REL D;  4XZQ C;  4WNN B;  4XZQ D;  4Z66 A;  3KXB C;  3KXB D;  4WU8 C;  4WU8 D;  2NZD C;  3REK B;  2NZD D;  3VH5 A;  2F8N K;  3W99 B;  1WWI A;  3AZM A;  4CAY B;  3WTP C;  1TAF B;  3WTP D;  3W98 C;  3W98 D;  3AZF D;  3W97 A;  4X23 C;  3MVD C;  4X23 D;  3MVD D;  4H9N A;  5GT3 A;  5F99 C;  5CPJ C;  1P3M C;  5CPJ D;  1P3M D;  5B1M C;  3AZE B;  1B6W A;  5B40 C;  4H9Q B;  4Z5T B;  5B40 D;  3VH6 T;  4AWL C;  3AZN A;  1P3I C;  1P3I D;  4WNN A;  5B31 C;  5JRG C;  2CWE A;  5JRG D;  5B31 D;  4KGC C;  5DNN C;  4KGC D;  5DNN D;  4ZUX C;  4ZUX D;  3KUY B;  4EO5 C;  3AYW C;  5AY8 C;  3AYW D;  5AY8 D;  3LZ0 B;  3REK A;  5CP6 B;  3UTB C;  2YFW B;  5CPI C;  3W99 A;  5CPI D;  4KUD C;  5DNM C;  4KUD D;  2NQB C;  5DNM D;  2NQB D;  4CAY A;  5B0Y C;  1TAF A;  3UT9 C;  1AOI B;  3UT9 D;  3AFA B;  3X1V C;  3AZI C;  1M19 C;  3AZI D;  3NQU B;  3X1V D;  3VH6 W;  1M19 D;  2HIO C;  2HIO D;  1P3P C;  5B2I C;  1P3P D;  5B2I D;  3AZE A;  5CPK B;  4H9Q A;  4Z5T A;  1H3O B;  1U35 B;  3REJ C;  3C1B B;  3REJ D;  5AV8 B;  1A7W A;  1TZY C;  1TZY D;  3KUY A;  3AZF B;  3TU4 B;  3LZ0 A;  1KX5 C;  5CP6 A;  1KX5 D;  3MNN C;  3MNN D;  2PYO A;  2YFW A;  3B6G C;  1M18 C;  2L5A A;  5B24 C;  1M18 D;  3B6G D;  1P3M B;  3W96 C;  3LEL B;  1AOI A;  3X1S B;  3AFA A;  3O62 C;  3O62 D;  3NQU A;  1P3O C;  5B32 B;  1P3L C;  1P3O D;  4G91 B;  1P3L D;  5B31 B;  3AZH B;  5BNV B; 
#chains in the Genus database with same CATH topology
 5DNN B;  5CPK A;  4ZBJ B;  4J8X B;  4G92 B;  1H3O A;  1U35 A;  5AV5 D;  4LD9 C;  4LD9 D;  3LZ1 B;  3KWQ C;  3KWQ D;  3C1B A;  2BYM B;  5AV8 A;  2IO5 B;  4M6B A;  3UTA B;  4WU9 C;  4WU9 D;  3AZF A;  3TU4 A;  3X1T D;  3X1T C;  1M19 B;  2Y2H A;  1Q9C A;  4YS3 C;  4YS3 D;  1P3M A;  1P3G B;  4JJN C;  4J8V C;  4JJN D;  4J8V D;  3LEL A;  5FUG B;  3X1S A;  5BNX B;  4KHA B;  5B32 A;  1P3B C;  1KX4 C;  1P3B D;  1KX3 D;  1KX4 D;  5B31 A;  2ZY3 A;  4UUZ B;  3AZH A;  5BNV A;  5DNN A;  3MGR C;  1P3K B;  4J8X A;  1KX5 B;  3LZ1 A;  2DF4 C;  2BYM A;  5BT1 C;  3LJA C;  3LJA D;  5CHL B;  1W2E A;  4UPK A;  3MGP C;  3MGP D;  3UTA A;  1P3A B;  2RVQ C;  1ZLA C;  2RVQ D;  1ZLA D;  1M19 A;  2BYK B;  3AZG D;  2FFF B;  2ZY2 A;  3AZL B;  1P3G A;  5GXQ C;  1P3F B;  5GXQ D;  5FUG A;  1ID3 B;  4WZS B;  5BNX A;  5AV5 B;  4KHA A;  5B1L D;  5B2J B;  3WAA C;  3WAA D;  5AV6 C;  3V9R B;  1P3K A;  5AV6 D;  4NE5 A;  1EQZ B;  2F8N D;  3REH B;  1KX5 A;  5AVB C;  5AVB D;  3WA9 B;  3AV1 B;  4YS3 B;  2FJ7 C;  4WV4 B;  2FJ7 D;  5AVC B;  4QLC C;  4QLC D;  4J8V B;  4Z2M H;  3REI B;  1P3A A;  4HGA B;  1KX3 B;  2BYK A;  2ARO C;  2ARO D;  3AZL A;  3B0B A;  4YM6 B;  1P3F A;  4R8P C;  5F99 D;  3MGQ B;  4R8P D;  3X1U C;  5B1M D;  1ID3 A;  5AV5 A;  3WTP E;  4J8U C;  4J8U D;  5GT0 C;  2JCH A;  5GT0 D;  5B2J A;  2JE5 A;  5B0Z C;  5B0Z D;  3V9R A;  1S32 B;  1EQZ A;  3REH A;  3WA9 A;  3AV1 A;  3AN2 B;  3AZK C;  3AZG B;  4YS3 A;  5E5A C;  3C1C B;  5B32 G;  3UTB D;  5AVC A;  3AZJ C;  3WKJ B;  3B0C T;  5B31 G;  3AZJ D;  2CV5 C;  3FDD A;  4J8V A;  3REI A;  5B0Y D;  3A6N C;  3A6N D;  1KX3 A;  5B1L B;  3REL B;  4XZQ B;  1F66 C;  1F66 D;  4YM6 A;  1M1A C;  3WAA B;  1M1A D;  1HTA A;  3MGQ A;  3KXB B;  4WU8 B;  2RIQ A;  2NZD B;  5C3I C;  1S32 A;  3B0C W;  4CSR B;  3WTP B;  5AV9 C;  3W98 B;  3B0D C;  5AV9 D;  4J8W C;  4J8W D;  4X23 B;  3MVD B;  2YFV B;  5GSU C;  3AZG A;  3AN2 A;  5GSU D;  3C1C A;  4DQY B;  3H0M C;  3WKJ A;  5B24 D;  5F99 B;  5CPJ B;  3W96 D;  5B1M B;  1HQ3 C;  5BO0 B;  5B40 B;  1HQ3 D;  4NE6 A;  4AWL B;  3MGS C;  3MGS D;  4J8U B;  1P3I B;  5GT0 B;  3B6F C;  5B1L A;  3REL A;  3B6F D;  4XZQ A;  5JRG B;  3WAA A;  2Y2P A;  2Y2L A;  4KGC B;  3KXB A;  4Z2M G;  4ZUX B;  5BS7 C;  4WU8 A;  4EO5 B;  4Z66 C;  4Z66 D;  5AY8 B;  5B33 D;  5B33 C;  3AYW B;  2F8N H;  2NZD A;  3UTB B;  5CPI B;  4KUD B;  5DNM B;  2NQB B;  4CSR A;  3EPK A;  5B0Y B;  3WTP A;  3AZM C;  3W98 A;  3UT9 B;  3AZM D;  3AZI B;  3X1V B;  4X23 A;  3MVD A;  2YFV A;  2HIO B;  3W97 C;  3W97 D;  1P3P B;  3EG5 B;  5F99 A;  5B2I B;  5CPJ A;  2F2A C;  5B1M A;  5BO0 A;  5B40 A;  5GT3 C;  4J8U A;  5GT3 D;  1P3I A;  3REJ B;  3AZN C;  5JRG A;  3AZN D;  1TZY B;  4KGC A;  4ZUX A;  3MGR D;  3AYW A;  1T3U A;  5AY8 A;  3EPJ A;  2Y2M A;  4J8W B;  3F6T A;  3MNN B;  5GSU B;  3UTB A;  5CPI A;  4H9R B;  5BT1 D;  3B6G B;  3REK C;  1M18 B;  4KUD A;  5B24 B;  5DNM A;  3REK D;  2NQB A;  3W96 B;  5B0Y A;  2J8P A;  1F1E A;  3UT9 A;  3O62 B;  3AZI A;  3X1V A;  1P3O B;  1P3L B;  1KU5 A;  5JA4 B;  2HIO A;  1P3P A;  5B2I A;  2ZM5 A;  5B33 B;  4LD9 B;  4H9P B;  2JSS A;  3KWQ B;  1N1J B;  3REJ A;  3AZE C;  4Z5T C;  3AZE D;  1TZY A;  4UUZ A;  4WU9 B;  1P34 C;  3X1T B;  1P34 D;  3MNN A;  5GSU A;  5KDM B;  3KUY C;  3KUY D;  3LZ0 C;  1M18 A;  3B6G A;  3LZ0 D;  5CP6 C;  5B24 A;  5CP6 D;  3W96 A;  4NE3 A;  4JJN B;  2PYO C;  2PYO D;  2F8N G;  3O62 A;  2ZY4 A;  1P3O A;  1P3B B;  1P3L A;  5JA4 A;  1KX4 B;  1AOI C;  3AFA C;  1AOI D;  3AFA D;  1BFM A;  3MGR B;  5BS7 A;  4XUJ C;  5B33 A;  4XUJ D;  3X1U D;  1WWS A;  4LD9 A;  4H9S C;  4H9P A;  3KWQ A;  5CPK C;  1N1J A;  5CPK D;  3LJA B;  2ZY5 A;  1U35 C;  1U35 D;  3MGP B;  3C1B C;  3C1B D;  5AV8 C;  4WU9 A;  5AV8 D;  3X1T A;  1PZR A;  1ZLA B;  5KDM A;  3AZF C;  3TU4 C;  3AZK D;  3TU4 D;  5E5A D;  2XD5 A;  4E45 A;  5GXQ B;  2CV5 D;  4JJN A;  2LY8 A;  3AV2 C;  3AV2 D;  1P3B A;  2Y2N A;  1KX4 A;  3LEL C;  3LEL D;  3X1S C;  3X1S D;  5B32 C;  4G91 C;  4DRB A;  5B32 D;  5AV6 B;  3MGR A;  2F8N B;  1P34 B;  3AZH C;  3AZH D;  3NQJ B;  5AVB B;  4ZBJ C;  3LJA A;  4J8X C;  4G92 C;  4J8X D;  2FJ7 B;  3MGP A;  3LZ1 C;  4QLC B;  3LZ1 D;  2PYO B;  2Y2K A;  2IO5 C;  1ZLA A;  2Y2I A;  3UTA C;  3UTA D;  3KSY A;  2ARO B;  5GXQ A;  5G49 B;  4R8P B;  4XUJ B;  3X1U B;  2DQN C;  3VH5 T;  1P3G C;  1P3G D;  5B0Z B;  2Y2O A;  5AV6 A;  2F8N A;  1P34 A;  3NQJ A;  5AVB A;  1P3K C;  1P3K D;  3AZK B;  2FJ7 A;  1BH8 B;  5E5A B;  3AZJ B;  4QLC A;  2CV5 B;  3AV2 B;  3A6N B;  3VH5 W;  1P3A C;  2ARO A;  1P3A D;  1F66 B;  1R4V A;  1M1A B;  5G49 A;  4R8P A;  1BH9 B;  4XUJ A;  3X1U A;  3AZL C;  1JFI B;  3AZL D;  4H9S A;  1P3F C;  1P3F D;  5GT0 A;  1ID3 C;  5AV5 C;  1ID3 D;  3A1K A;  4WJ3 C;  5B0Z A;  2HUE C;  5C3I B;  5B2J C;  5B2J D;  4NFT A;  5AV9 B;  3B0D B;  3H0L C;  1EQZ C;  3AZK A;  1EQZ D;  2G5H C;  1BH8 A;  2Y2Q A;  5E5A A;  3REH C;  3REH D;  3AZJ A;  2CV5 A;  3WA9 C;  3AV1 C;  3WA9 D;  3AV1 D;  3AV2 A;  3W99 C;  3A6N A;  1HQ3 B;  3R45 B;  3W99 D;  5AVC C;  5AVC D;  3MGS B;  3B6F B;  3REI C;  3REI D;  4HGA C;  4H9O B;  1F66 A;  1M1A A;  1KX3 C;  2Y2J A;  1BH9 A;  1JFI A;  2BG1 A;  4Z66 B;  1B67 A;  4YM6 C;  4YM6 D;  4E44 A;  3MGQ C;  3MGQ D;  4Z5T D;  3VH6 A;  2Y2G A;  5AV9 A;  3AZM B;  4J8W A;  1S32 C;  1S32 D;  3A1I A;  4H9R A;  3W97 B;  3AN2 C;  3AZG C;  3AN2 D;  3EPH A;  4H9N B;  3C1C C;  1HQ3 A;  3R45 A;  3C1C D;  3WKJ C;  3WKJ D;  3MGS A;  5GT3 B;  3B6F A;  2XD1 A;  4H9O A;  3AZN B;  4DRA A;  2W8S A;  2HUE B;  1ULY A;  1Z2C B;  5B1L C;  3REL C;  3REL D;  4XZQ C;  4WNN B;  4XZQ D;  4Z66 A;  3KXB C;  3H0R C;  3KXB D;  4WU8 C;  4WU8 D;  2NZD C;  3REK B;  2NZD D;  3VH5 A;  2F8N K;  3W99 B;  1WWI A;  2VQR A;  3AZM A;  4CAY B;  3WTP C;  1TAF B;  3WTP D;  3W98 C;  3W98 D;  3AZF D;  3P5J B;  3W97 A;  3AL0 C;  4X23 C;  3MVD C;  4X23 D;  3MVD D;  4H9N A;  5GT3 A;  5F99 C;  5CPJ C;  1P3M C;  5CPJ D;  1P3M D;  5B1M C;  3AZE B;  1B6W A;  5B40 C;  4H9Q B;  4Z5T B;  5B40 D;  3VH6 T;  4AWL C;  3AZN A;  1P3I C;  1P3I D;  4WNN A;  5B31 C;  5JRG C;  2CWE A;  5JRG D;  5B31 D;  4KGC C;  5DNN C;  4KGC D;  5DNN D;  2G5I C;  2UWX A;  4ZUX C;  4ZUX D;  3KUY B;  4EO5 C;  3AYW C;  5AY8 C;  3AYW D;  5AY8 D;  3LZ0 B;  3REK A;  5CP6 B;  3UTB C;  2YFW B;  5CPI C;  3W99 A;  5CPI D;  4KUD C;  5DNM C;  4KUD D;  2NQB C;  5DNM D;  2NQB D;  4CAY A;  5B0Y C;  1TAF A;  3UT9 C;  1AOI B;  3UT9 D;  3AFA B;  3X1V C;  3AZI C;  1M19 C;  3AZI D;  3NQU B;  3X1V D;  3VH6 W;  1M19 D;  2HIO C;  2HIO D;  3IP4 C;  1P3P C;  5B2I C;  1P3P D;  5B2I D;  3AZE A;  5CPK B;  4H9Q A;  4Z5T A;  1H3O B;  1U35 B;  3REJ C;  3C1B B;  3REJ D;  5AV8 B;  1A7W A;  1TZY C;  3EPL A;  1TZY D;  3KUY A;  3AZF B;  3TU4 B;  3LZ0 A;  1KX5 C;  5CP6 A;  1KX5 D;  3KFU G;  3MNN C;  3MNN D;  2PYO A;  2YFW A;  3B6G C;  1M18 C;  2L5A A;  5B24 C;  1M18 D;  3B6G D;  1P3M B;  3W96 C;  3LEL B;  1AOI A;  3X1S B;  3AFA A;  3O62 C;  3O62 D;  3NQU A;  1P3O C;  5B32 B;  1P3L C;  1P3O D;  4G91 B;  1P3L D;  5B31 B;  3AZH B;  5BNV B; 
#chains in the Genus database with same CATH homology
 5DNN B;  5CPK A;  4ZBJ B;  4J8X B;  4G92 B;  1H3O A;  1U35 A;  5AV5 D;  4LD9 C;  4LD9 D;  3LZ1 B;  3KWQ C;  3KWQ D;  3C1B A;  2BYM B;  5AV8 A;  2IO5 B;  4M6B A;  3UTA B;  4WU9 C;  4WU9 D;  3AZF A;  3TU4 A;  3X1T D;  3X1T C;  1M19 B;  2Y2H A;  1Q9C A;  4YS3 C;  4YS3 D;  1P3M A;  1P3G B;  4JJN C;  4J8V C;  4JJN D;  4J8V D;  3LEL A;  5FUG B;  3X1S A;  5BNX B;  4KHA B;  5B32 A;  1P3B C;  1KX4 C;  1P3B D;  1KX3 D;  1KX4 D;  5B31 A;  2ZY3 A;  4UUZ B;  3AZH A;  5BNV A;  5DNN A;  3MGR C;  1P3K B;  4J8X A;  1KX5 B;  3LZ1 A;  2DF4 C;  2BYM A;  5BT1 C;  3LJA C;  3LJA D;  5CHL B;  1W2E A;  4UPK A;  3MGP C;  3MGP D;  3UTA A;  1P3A B;  2RVQ C;  1ZLA C;  2RVQ D;  1ZLA D;  1M19 A;  2BYK B;  3AZG D;  2FFF B;  2ZY2 A;  3AZL B;  1P3G A;  5GXQ C;  1P3F B;  5GXQ D;  5FUG A;  1ID3 B;  4WZS B;  5BNX A;  5AV5 B;  4KHA A;  5B1L D;  5B2J B;  3WAA C;  3WAA D;  5AV6 C;  3V9R B;  1P3K A;  5AV6 D;  4NE5 A;  1EQZ B;  2F8N D;  3REH B;  1KX5 A;  5AVB C;  5AVB D;  3WA9 B;  3AV1 B;  4YS3 B;  2FJ7 C;  4WV4 B;  2FJ7 D;  5AVC B;  4QLC C;  4QLC D;  4J8V B;  4Z2M H;  3REI B;  1P3A A;  4HGA B;  1KX3 B;  2BYK A;  2ARO C;  2ARO D;  3AZL A;  3B0B A;  4YM6 B;  1P3F A;  4R8P C;  5F99 D;  3MGQ B;  4R8P D;  3X1U C;  5B1M D;  1ID3 A;  5AV5 A;  3WTP E;  4J8U C;  4J8U D;  5GT0 C;  2JCH A;  5GT0 D;  5B2J A;  2JE5 A;  5B0Z C;  5B0Z D;  3V9R A;  1S32 B;  1EQZ A;  3REH A;  3WA9 A;  3AV1 A;  3AN2 B;  3AZK C;  3AZG B;  4YS3 A;  5E5A C;  3C1C B;  5B32 G;  3UTB D;  5AVC A;  3AZJ C;  3WKJ B;  3B0C T;  5B31 G;  3AZJ D;  2CV5 C;  3FDD A;  4J8V A;  3REI A;  5B0Y D;  3A6N C;  3A6N D;  1KX3 A;  5B1L B;  3REL B;  4XZQ B;  1F66 C;  1F66 D;  4YM6 A;  1M1A C;  3WAA B;  1M1A D;  1HTA A;  3MGQ A;  3KXB B;  4WU8 B;  2RIQ A;  2NZD B;  5C3I C;  1S32 A;  3B0C W;  4CSR B;  3WTP B;  5AV9 C;  3W98 B;  3B0D C;  5AV9 D;  4J8W C;  4J8W D;  4X23 B;  3MVD B;  2YFV B;  5GSU C;  3AZG A;  3AN2 A;  5GSU D;  3C1C A;  4DQY B;  3H0M C;  3WKJ A;  5B24 D;  5F99 B;  5CPJ B;  3W96 D;  5B1M B;  1HQ3 C;  5BO0 B;  5B40 B;  1HQ3 D;  4NE6 A;  4AWL B;  3MGS C;  3MGS D;  4J8U B;  1P3I B;  5GT0 B;  3B6F C;  5B1L A;  3REL A;  3B6F D;  4XZQ A;  5JRG B;  3WAA A;  2Y2P A;  2Y2L A;  4KGC B;  3KXB A;  4Z2M G;  4ZUX B;  5BS7 C;  4WU8 A;  4EO5 B;  4Z66 C;  4Z66 D;  5AY8 B;  5B33 D;  5B33 C;  3AYW B;  2F8N H;  2NZD A;  3UTB B;  5CPI B;  4KUD B;  5DNM B;  2NQB B;  4CSR A;  3EPK A;  5B0Y B;  3WTP A;  3AZM C;  3W98 A;  3UT9 B;  3AZM D;  3AZI B;  3X1V B;  4X23 A;  3MVD A;  2YFV A;  2HIO B;  3W97 C;  3W97 D;  1P3P B;  3EG5 B;  5F99 A;  5B2I B;  5CPJ A;  2F2A C;  5B1M A;  5BO0 A;  5B40 A;  5GT3 C;  4J8U A;  5GT3 D;  1P3I A;  3REJ B;  3AZN C;  5JRG A;  3AZN D;  1TZY B;  4KGC A;  4ZUX A;  3MGR D;  3AYW A;  1T3U A;  5AY8 A;  3EPJ A;  2Y2M A;  4J8W B;  3F6T A;  3MNN B;  5GSU B;  3UTB A;  5CPI A;  4H9R B;  5BT1 D;  3B6G B;  3REK C;  1M18 B;  4KUD A;  5B24 B;  5DNM A;  3REK D;  2NQB A;  3W96 B;  5B0Y A;  2J8P A;  1F1E A;  3UT9 A;  3O62 B;  3AZI A;  3X1V A;  1P3O B;  1P3L B;  1KU5 A;  5JA4 B;  2HIO A;  1P3P A;  5B2I A;  2ZM5 A;  5B33 B;  4LD9 B;  4H9P B;  2JSS A;  3KWQ B;  1N1J B;  3REJ A;  3AZE C;  4Z5T C;  3AZE D;  1TZY A;  4UUZ A;  4WU9 B;  1P34 C;  3X1T B;  1P34 D;  3MNN A;  5GSU A;  5KDM B;  3KUY C;  3KUY D;  3LZ0 C;  1M18 A;  3B6G A;  3LZ0 D;  5CP6 C;  5B24 A;  5CP6 D;  3W96 A;  4NE3 A;  4JJN B;  2PYO C;  2PYO D;  2F8N G;  3O62 A;  2ZY4 A;  1P3O A;  1P3B B;  1P3L A;  5JA4 A;  1KX4 B;  1AOI C;  3AFA C;  1AOI D;  3AFA D;  1BFM A;  3MGR B;  5BS7 A;  4XUJ C;  5B33 A;  4XUJ D;  3X1U D;  1WWS A;  4LD9 A;  4H9S C;  4H9P A;  3KWQ A;  5CPK C;  1N1J A;  5CPK D;  3LJA B;  2ZY5 A;  1U35 C;  1U35 D;  3MGP B;  3C1B C;  3C1B D;  5AV8 C;  4WU9 A;  5AV8 D;  3X1T A;  1PZR A;  1ZLA B;  5KDM A;  3AZF C;  3TU4 C;  3AZK D;  3TU4 D;  5E5A D;  2XD5 A;  4E45 A;  5GXQ B;  2CV5 D;  4JJN A;  2LY8 A;  3AV2 C;  3AV2 D;  1P3B A;  2Y2N A;  1KX4 A;  3LEL C;  3LEL D;  3X1S C;  3X1S D;  5B32 C;  4G91 C;  4DRB A;  5B32 D;  5AV6 B;  3MGR A;  2F8N B;  1P34 B;  3AZH C;  3AZH D;  3NQJ B;  5AVB B;  4ZBJ C;  3LJA A;  4J8X C;  4G92 C;  4J8X D;  2FJ7 B;  3MGP A;  3LZ1 C;  4QLC B;  3LZ1 D;  2PYO B;  2Y2K A;  2IO5 C;  1ZLA A;  2Y2I A;  3UTA C;  3UTA D;  3KSY A;  2ARO B;  5GXQ A;  5G49 B;  4R8P B;  4XUJ B;  3X1U B;  2DQN C;  3VH5 T;  1P3G C;  1P3G D;  5B0Z B;  2Y2O A;  5AV6 A;  2F8N A;  1P34 A;  3NQJ A;  5AVB A;  1P3K C;  1P3K D;  3AZK B;  2FJ7 A;  1BH8 B;  5E5A B;  3AZJ B;  4QLC A;  2CV5 B;  3AV2 B;  3A6N B;  3VH5 W;  1P3A C;  2ARO A;  1P3A D;  1F66 B;  1R4V A;  1M1A B;  5G49 A;  4R8P A;  1BH9 B;  4XUJ A;  3X1U A;  3AZL C;  1JFI B;  3AZL D;  4H9S A;  1P3F C;  1P3F D;  5GT0 A;  1ID3 C;  5AV5 C;  1ID3 D;  3A1K A;  4WJ3 C;  5B0Z A;  2HUE C;  5C3I B;  5B2J C;  5B2J D;  4NFT A;  5AV9 B;  3B0D B;  3H0L C;  1EQZ C;  3AZK A;  1EQZ D;  2G5H C;  1BH8 A;  2Y2Q A;  5E5A A;  3REH C;  3REH D;  3AZJ A;  2CV5 A;  3WA9 C;  3AV1 C;  3WA9 D;  3AV1 D;  3AV2 A;  3W99 C;  3A6N A;  1HQ3 B;  3R45 B;  3W99 D;  5AVC C;  5AVC D;  3MGS B;  3B6F B;  3REI C;  3REI D;  4HGA C;  4H9O B;  1F66 A;  1M1A A;  1KX3 C;  2Y2J A;  1BH9 A;  1JFI A;  2BG1 A;  4Z66 B;  1B67 A;  4YM6 C;  4YM6 D;  4E44 A;  3MGQ C;  3MGQ D;  4Z5T D;  3VH6 A;  2Y2G A;  5AV9 A;  3AZM B;  4J8W A;  1S32 C;  1S32 D;  3A1I A;  4H9R A;  3W97 B;  3AN2 C;  3AZG C;  3AN2 D;  3EPH A;  4H9N B;  3C1C C;  1HQ3 A;  3R45 A;  3C1C D;  3WKJ C;  3WKJ D;  3MGS A;  5GT3 B;  3B6F A;  2XD1 A;  4H9O A;  3AZN B;  4DRA A;  2W8S A;  2HUE B;  1ULY A;  1Z2C B;  5B1L C;  3REL C;  3REL D;  4XZQ C;  4WNN B;  4XZQ D;  4Z66 A;  3KXB C;  3H0R C;  3KXB D;  4WU8 C;  4WU8 D;  2NZD C;  3REK B;  2NZD D;  3VH5 A;  2F8N K;  3W99 B;  1WWI A;  2VQR A;  3AZM A;  4CAY B;  3WTP C;  1TAF B;  3WTP D;  3W98 C;  3W98 D;  3AZF D;  3P5J B;  3W97 A;  3AL0 C;  4X23 C;  3MVD C;  4X23 D;  3MVD D;  4H9N A;  5GT3 A;  5F99 C;  5CPJ C;  1P3M C;  5CPJ D;  1P3M D;  5B1M C;  3AZE B;  1B6W A;  5B40 C;  4H9Q B;  4Z5T B;  5B40 D;  3VH6 T;  4AWL C;  3AZN A;  1P3I C;  1P3I D;  4WNN A;  5B31 C;  5JRG C;  2CWE A;  5JRG D;  5B31 D;  4KGC C;  5DNN C;  4KGC D;  5DNN D;  2G5I C;  2UWX A;  4ZUX C;  4ZUX D;  3KUY B;  4EO5 C;  3AYW C;  5AY8 C;  3AYW D;  5AY8 D;  3LZ0 B;  3REK A;  5CP6 B;  3UTB C;  2YFW B;  5CPI C;  3W99 A;  5CPI D;  4KUD C;  5DNM C;  4KUD D;  2NQB C;  5DNM D;  2NQB D;  4CAY A;  5B0Y C;  1TAF A;  3UT9 C;  1AOI B;  3UT9 D;  3AFA B;  3X1V C;  3AZI C;  1M19 C;  3AZI D;  3NQU B;  3X1V D;  3VH6 W;  1M19 D;  2HIO C;  2HIO D;  3IP4 C;  1P3P C;  5B2I C;  1P3P D;  5B2I D;  3AZE A;  5CPK B;  4H9Q A;  4Z5T A;  1H3O B;  1U35 B;  3REJ C;  3C1B B;  3REJ D;  5AV8 B;  1A7W A;  1TZY C;  3EPL A;  1TZY D;  3KUY A;  3AZF B;  3TU4 B;  3LZ0 A;  1KX5 C;  5CP6 A;  1KX5 D;  3KFU G;  3MNN C;  3MNN D;  2PYO A;  2YFW A;  3B6G C;  1M18 C;  2L5A A;  5B24 C;  1M18 D;  3B6G D;  1P3M B;  3W96 C;  3LEL B;  1AOI A;  3X1S B;  3AFA A;  3O62 C;  3O62 D;  3NQU A;  1P3O C;  5B32 B;  1P3L C;  1P3O D;  4G91 B;  1P3L D;  5B31 B;  3AZH B;  5BNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...