5B24C

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
b'RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24C00
5CPJB 1P3IA 3NQUA 3LJAA 3AZGD 2AROD 3X1UC 4UUZA 4R8PA 2PYOC 3RELC 5DNND 1R4VA 3REHD 5AV5C 1P3LA 3AZKD 3R45A 1AOID 3AN2D 3X1VB 5G49B 2HIOD 3REJC 3AV2D 3AV1A 3O62B 3B6GC 2L5AA 5BNVB 1H3OA 4X23C 4J8UA 4WNNA 5E5AD 1M18D 2HUEC 5AVCC 3AZLD 1KX3C 3LZ0B 3AYWC 3WTPC 3MGPD 1P34C 3X1SB 1F66D 3WA9C 4QLCB 3REKA 3LJAD 4R8PD 4CAYA 4KUDA 3C1CB 3MGRA 3RELA 5F99D 1BH9A 1P3OA 4Z66A 4WU8B 4Z5TA 3X1VC 5CHLB 3AZFA 5B32G 1EQZA 3O62C 5GXQD 3AZGB 2AROB 3LZ0C 5DNNB 5B0ZD 3REHB 1P3PD 1KX3A 3X1SC 3AZKB 1KU5A 4QLCC 3WTPA 2BYKA 3WA9A 5GSUA 5CP6A 3AN2B 1AOIB 4KUDD 4H9NB 2HIOB 2BYMB 3AV2B 5CPJA 3MGRD 3AZIA 2CWEA 5E5AB 3C1CC 1M18B 3AZLB 2CV5A 3MGPB 1P3OD 2F8ND 1F66B 3UTBD 3AZHD 3B0DB 4WV4B 3NQUB 4WU8C 1S32A 1EQZD 3LJAB 4UUZB 4R8PB 1BH8A 5BT1D 3AZGC 2AROC 5BNVA 5DNNC 1M1AA 3REHC 1ID3A 3AZKC 5F99B 3R45B 1BFMA 5CP6D 4H9RA 1AOIC 3AN2C 5JA4B 4J8UB 3AZID 3AV2C 2F8NG 4WNNB 3MNNA 5GXQB 4ZUXA 2CV5D 4AWLB 5E5AC 1M18C 1TZYD 5B0ZB 3C1CA 3MGPC 3AZEA 1P3PB 1F66C 1S32D 3B0DC 3B6FA 3VH5W 4G91B 3LJAC 4KUDB 4H9OA 4R8PC 5B2JA 3MGQA 3MGRB 3AZNA 2NZDA 1M1AD 1BH9B 1P3KA 4Z66B 3KXBD 5F99C 1P3OB 2F8NB 3UTBB 3AZHB 3AZFB 3UT9D 3KUYA 3AZJA 5GT0D 3UTAA 1EQZB 4ZUXD 4J8UC 4NFTA 2HIOA 5GXQC 2BYMA 4AWLC 3WAAA 3AZED 1U35A 5BNXB 3W99A 5B0ZC 1M18A 3AZLA 1P3PC 3B6FD 5GSUB 5B32A 5CP6B 3MGPA 3LELD 5C3IB 4WU9A 4G91C 1KX5A 3MGQD 2YFVA 4KUDC 2FJ7A 3AZND 2NZDD 3AZIB 3MGRC 2CV5B 1P3KD 1TZYB 3NQJA 1P3OC 4Z66C 1WWSA 3KUYD 4J8WA 3UTBC 3AZHC 3AZJD 4Z5TC 3UTAD 3AZFC 5F99A 1S32B 3W98A 1EQZC 1BH8B 3X1TD 3WAAD 1U35D 5JA4A 5BT1C 3TU4A 3W99D 1M1AB 5GXQA 1ID3B 5B32D 4YS3D 4WU9D 4H9RB 3KXBB 5GSUC 1KX5D 5B0ZA 5CP6C 4LD9A 1P3PA 5C3IC 5AV9A 4WZSB 2FJ7D 3UT9B 5CPJC 5GT0B 3MNNB 4ZUXB 3AZIC 2IO5B 2CV5C 3AZEB 4J8WD 1TZYC 2JSSA 4Z2MG 3B6FB 3W98D 4ZBJB 1S32C 2F8NA 4H9OB 3UTBA 3AZHA 5B2JB 3MGQB 3TU4D 1N1JB 5B0YD 3AZNB 2NZDB 5KDMA 1M1AC 1P3KB 1ID3C 4LD9D 3AZMD 5BNXA 5AV9D 3KXBC 3KUYB 1ZLAD 3AZJB 3UTAB 5DNMA 4J8VA 3UT9C 5GT0C 3MNNC 4ZUXC 3X1TB 3WAAB 1U35B 2IO5C 5B33A 3W99B 3AZEC 5AY8D 2YFWA 5B32B 1F1EA 4YS3B 4WU9B 5GT3A 3B6FC 1TZYA 1KX5B 4ZBJC 2YFVB 4JJND 3VH6W 4YM6D 5B31D 3A6NA 3KWQA 5B2JC 2FJ7B 1M19A 3MGQC 1HQ3A 2F8NK 3AZNC 2NZDC 5JRGD 1A7WA 3W97A 3NQJB 1P3KC 2RVQD 4J8WB 5DNMD 4J8VD 3LZ1A 3W96A 3W98B 3KUYC 3AZJC 3B0CT 3KXBA 3UTAC 2HIOC 3TU4B 5B33D 3REIA 3WAAC 3UT9A 3X1TC 5GT0A 1U35C 3W99C 1KX4D 5B31G 3AZLC 5GT3D 4LD9B 5B32C 4YS3C 3AZMB 5AV9B 3KWQD 3A6ND 4DRAA 4WU9C 3VH5T 1KX5C 1M19D 4H9SA 1HQ3D 4EO5B 2FJ7C 3VH5A 3LELA 1P34D 3W97D 3MGSD 4KGCD 4XZQA 1N1JA 1P3MA 5AY8B 5CPKA 5B1MA 3LZ1D 3C1BD 4J8WC 2F8NH 3W96D 3W98C 5CPID 5B31B 4YM6B 3REID 3TU4C 5KDMB 5JRGB 3X1TA 4J8XA 5AVBD 4LD9C 5AV8D 3AZMC 4M6BA 3O62D 5AV9C 1P3BD 5DNMB 4YS3A 4J8VB 1P3FA 4DRBA 4EO5C 1JFIA 4NE5A 5AV6D 4XZQD 4KHAB 4QLCD 5B33B 1P3AD 1P3MD 5B1LA 5CPKD 5B1MD 2YFWB 1KX4B 3WKJA 5AY8C 5GT3B 4G92B 1B6WA 3A6NB 3KWQB 1M19B 1HQ3B 4XUJD 5B31C 4YM6C 1P34B 4J8XD 3MGSB 3W97B 5B40A 4KGCB 5B0YA 2NQBA 3MVDA 2RVQC 4H9PA 3LZ1B 1P3FD 3C1BB 3W96B 5B2ID 5DNMC 3AZMA 4J8VC 5CPIB 3REIB 1ZLAA 5B1LD 5B33C 3WKJD 4E45A 5AVBB 1KX4C 4CSRA 5GT3C 5AV8B 5AY8A 4G92C 3KWQC 3A6NC 1P3BB 1ULYA 1M19C 3WTPE 3LELB 1P3GA 1HQ3C 1HTAA 5B40D 5B24A 1Q9CA 5AV6B 4JJNA 4XZQB 5B31A 4YM6A 3W97C 3MGSC 2NQBD 5BS7A 3AFAA 4KGCC 1P3AB 1P3MB 3MVDD 1P3ID 5CPKB 5B1MB 5JRGA 3LZ1C 3W96C 3C1BC 1TAFA 5CPIC 1P3LD 4XUJB 3X1UA 2PYOA 3REIC 4Z2MH 4HGAB 1WWIA 3V9RA 4J8XB 5AV5A 4KHAA 5AVBC 3AV1D 2LY8A 4J8UD 5AV8C 1P3FB 1KX4A 4H9SC 5FUGB 1P3GD 3REJA 5B2IB 1P3BC 4NE6A 3VH6T 1JFIB 5B24D 3LELC 3B6GA 3VH6A 4X23A 3AFAD 5AV6C 5B1LB 4XZQC 5AVCA 3REKD 3AYWA 1P34A 1P3AC 1P3MC 3WKJB 3MGSA 5CPKC 5B1MC 4KGCA 4H9QB 3X1UD 3C1BA 2PYOD 5BO0B 3RELD 4XUJC 5B40B 5AV5D 5CPIA 4HGAC 4Z66D 4E44A 5B0YB 4J8XC 2NQBB 4Z5TD 3AZFD 3MVDB 1P3IB 4H9PB 3REJD 5AVBA 1P3FC 3X1VA 3B6GD 5G49A 5B2IC 4X23D 5AV8A 3KSYA 1ZLAB 3O62A 5AVCD 1KX3D 1P3BA 1P3LB 3B0BA 3AYWD 3WTPD 5B1LC 3LZ0A 5GSUD 4NE3A 3WA9D 5AV6A 3WKJC 3X1SA 4CSRB 4QLCA 1P3AA 5CPJD 3B0CW 3AV1B 1H3OB 1P3GB 5B24B 4JJNB 3AFAB 5B40C 4XUJA 5B0YC 3REKB 2NQBC 3MVDC 1P3IC 4CAYB 3X1VD 4WU8A 1TAFB 3X1UB 2PYOB 5FUGA 1ZLAC 5B2IA 3RELB 3AZGA 2AROA 3LZ0D 1B67A 1P3LC 3V9RB 1ID3D 5AV5B 3X1SD 5DNNA 3REHA 4Z5TB 3AZKA 3AV1C 3MNND 3REJB 1AOIA 3AN2A 4H9NA 1P3GC 3B6GB 4X23B 3AV2A 4H9QA 5B24C 3C1CD 2HUEB 5AVCB 4JJNC 1KX3B 5BO0A 3AYWB 5BS7C 3AFAC 3WTPB 5E5AA 2BYKB 3REKC 3WA9B 5JRGC 1F66A 4WU8D 5B2JD
chains in the Genus database with same CATH superfamily
5CPJB 1P3IA 2Y2QA 3NQUA 3LJAA 3AZGD 2AROD 3X1UC 4UUZA 4R8PA 2PYOC 3RELC 5DNND 1R4VA 3REHD 5AV5C 1P3LA 3AZKD 3R45A 1AOID 3AN2D 3X1VB 5G49B 2HIOD 3REJC 3AV2D 3AV1A 3O62B 3B6GC 2L5AA 5BNVB 1H3OA 4X23C 4J8UA 4WNNA 5E5AD 1M18D 2HUEC 5AVCC 3AZLD 1KX3C 3LZ0B 3AYWC 3WTPC 3MGPD 1P34C 3X1SB 1F66D 3WA9C 4QLCB 3REKA 3LJAD 4R8PD 4CAYA 4KUDA 2Y2NA 3C1CB 3MGRA 3RELA 2Y2KA 5F99D 1BH9A 1P3OA 4Z66A 3FDDA 4WU8B 4Z5TA 3X1VC 5CHLB 3AZFA 2VQRA 2ZY5A 5B32G 1EQZA 2Y2OA 3O62C 4WJ3C 5GXQD 3AZGB 2AROB 3H0RC 3LZ0C 5DNNB 5B0ZD 3REHB 1P3PD 1KX3A 3X1SC 3AZKB 1KU5A 4QLCC 3WTPA 2BYKA 3WA9A 5GSUA 3KFUG 5CP6A 3AN2B 1AOIB 4KUDD 4H9NB 2HIOB 3A1IA 2BYMB 3AV2B 5CPJA 3MGRD 3AZIA 2CWEA 5E5AB 3C1CC 1M18B 3AZLB 2CV5A 3MGPB 1P3OD 2F8ND 1F66B 3UTBD 3AZHD 3B0DB 4WV4B 3NQUB 4WU8C 1S32A 1EQZD 3LJAB 4UUZB 4R8PB 1BH8A 5BT1D 3AZGC 2AROC 5BNVA 2J8PA 5DNNC 1M1AA 3REHC 1ID3A 3AZKC 5F99B 3R45B 1BFMA 5CP6D 4H9RA 1AOIC 3AN2C 5JA4B 4J8UB 3AZID 3AV2C 2F8NG 4WNNB 3MNNA 5GXQB 4ZUXA 2CV5D 4AWLB 2JCHA 5E5AC 1M18C 1TZYD 5B0ZB 3C1CA 3MGPC 3AZEA 1P3PB 1F66C 1S32D 3B0DC 2Y2IA 3B6FA 3VH5W 4G91B 3LJAC 4KUDB 4H9OA 4R8PC 3F6TA 5B2JA 3MGQA 3MGRB 3AZNA 3A1KA 2NZDA 1M1AD 1BH9B 1P3KA 4Z66B 3KXBD 5F99C 1P3OB 2F8NB 3UTBB 3AZHB 3AZFB 3UT9D 3KUYA 3AZJA 5GT0D 3UTAA 1EQZB 4ZUXD 4J8UC 4NFTA 2HIOA 5GXQC 2BYMA 4AWLC 3WAAA 3AZED 1U35A 5BNXB 3W99A 5B0ZC 1M18A 3AZLA 1P3PC 3B6FD 5GSUB 5B32A 5CP6B 3MGPA 3LELD 5C3IB 4WU9A 4G91C 1KX5A 3MGQD 2YFVA 3H0MC 4KUDC 2FJ7A 3AZND 2NZDD 3AZIB 3MGRC 2CV5B 1P3KD 1TZYB 3NQJA 1P3OC 4Z66C 1WWSA 3KUYD 4J8WA 3UTBC 3AZHC 3AZJD 4Z5TC 3UTAD 3AZFC 5F99A 1S32B 3W98A 1EQZC 1BH8B 3X1TD 3WAAD 1U35D 5JA4A 5BT1C 3TU4A 3W99D 2ZY3A 1M1AB 2W8SA 5GXQA 1ID3B 5B32D 4YS3D 2Y2HA 4WU9D 4H9RB 3KXBB 5GSUC 1KX5D 5B0ZA 5CP6C 4LD9A 1P3PA 5C3IC 5AV9A 4WZSB 2FJ7D 3UT9B 5CPJC 5GT0B 3MNNB 4ZUXB 3AZIC 2IO5B 2CV5C 3AZEB 4J8WD 1TZYC 2DQNC 2JSSA 4Z2MG 3B6FB 3W98D 4ZBJB 1S32C 2F8NA 2Y2GA 4H9OB 3UTBA 3AZHA 5B2JB 2G5IC 1PZRA 3MGQB 3TU4D 1N1JB 5B0YD 3AZNB 2NZDB 5KDMA 1M1AC 3P5JB 1P3KB 1ID3C 4LD9D 3AZMD 5BNXA 5AV9D 3KXBC 3KUYB 1ZLAD 3AZJB 3UTAB 5DNMA 4J8VA 2XD5A 3UT9C 5GT0C 3MNNC 3H0LC 4ZUXC 3X1TB 3WAAB 1U35B 2IO5C 5B33A 3W99B 3AZEC 5AY8D 2YFWA 5B32B 1F1EA 4YS3B 4WU9B 5GT3A 3B6FC 1TZYA 1KX5B 4ZBJC 3AL0C 2YFVB 4JJND 3VH6W 5B31D 4YM6D 3A6NA 3KWQA 5B2JC 2FJ7B 1M19A 3MGQC 1HQ3A 2F8NK 3AZNC 2NZDC 5JRGD 1A7WA 3W97A 3NQJB 1P3KC 2RVQD 4J8WB 5DNMD 4J8VD 3LZ1A 3W96A 3W98B 3KUYC 3AZJC 3B0CT 3KXBA 3UTAC 2HIOC 3TU4B 5B33D 3REIA 3WAAC 3UT9A 3X1TC 2ZY4A 5GT0A 1U35C 3W99C 1KX4D 5B31G 3AZLC 5GT3D 4LD9B 5B32C 4YS3C 3AZMB 5AV9B 3KWQD 3A6ND 4DRAA 4WU9C 3VH5T 1KX5C 1M19D 4H9SA 1HQ3D 4EO5B 2FJ7C 3VH5A 3LELA 1P34D 3W97D 3MGSD 4KGCD 4XZQA 1N1JA 1P3MA 5AY8B 5CPKA 5B1MA 3LZ1D 3C1BD 4J8WC 2Y2JA 2F8NH 3W96D 2ZY2A 3W98C 5CPID 5B31B 4YM6B 3REID 3TU4C 5KDMB 5JRGB 3X1TA 4J8XA 5AVBD 4LD9C 5AV8D 3AZMC 4M6BA 3O62D 5AV9C 1P3BD 5DNMB 4YS3A 4J8VB 1P3FA 4DRBA 3EPJA 4EO5C 1JFIA 4NE5A 5AV6D 1T3UA 4XZQD 4KHAB 4QLCD 5B33B 1P3AD 1P3MD 5B1LA 5CPKD 5B1MD 2YFWB 1KX4B 3WKJA 5AY8C 3EPLA 5GT3B 4G92B 1B6WA 3A6NB 3KWQB 1M19B 1HQ3B 4XUJD 5B31C 4YM6C 2G5HC 1P34B 4J8XD 3MGSB 3W97B 5B40A 4KGCB 5B0YA 2NQBA 2UWXA 3MVDA 2RVQC 4H9PA 3LZ1B 1P3FD 3C1BB 3W96B 5B2ID 5DNMC 3AZMA 4J8VC 5CPIB 3REIB 1ZLAA 5B1LD 5B33C 3WKJD 4E45A 5AVBB 3EPHA 1KX4C 4CSRA 5GT3C 5AV8B 2FFFB 5AY8A 4G92C 3KWQC 3A6NC 1P3BB 1ULYA 1M19C 3WTPE 3LELB 1P3GA 1HQ3C 1HTAA 5B40D 5B24A 1Q9CA 5AV6B 4JJNA 4XZQB 5B31A 4YM6A 3W97C 3MGSC 2NQBD 5BS7A 3AFAA 4KGCC 1P3AB 1P3MB 3MVDD 1P3ID 5CPKB 5B1MB 5JRGA 1W2EA 3LZ1C 3W96C 3C1BC 2F2AC 1TAFA 5CPIC 1P3LD 4XUJB 3X1UA 2PYOA 3REIC 4Z2MH 4HGAB 1WWIA 3V9RA 4J8XB 5AV5A 4KHAA 5AVBC 3AV1D 2LY8A 2ZM5A 4J8UD 5AV8C 1P3FB 1KX4A 4H9SC 5FUGB 1P3GD 3REJA 5B2IB 1P3BC 4NE6A 3VH6T 1JFIB 5B24D 3LELC 3B6GA 3VH6A 4X23A 3AFAD 5AV6C 5B1LB 4XZQC 5AVCA 3REKD 3AYWA 1P34A 1P3AC 1P3MC 3WKJB 3MGSA 5CPKC 5B1MC 4KGCA 4DQYB 2XD1A 4H9QB 3X1UD 3C1BA 2PYOD 5BO0B 3RELD 4XUJC 5B40B 2Y2LA 5AV5D 2Y2MA 4HGAC 4Z66D 2DF4C 4E44A 5B0YB 5CPIA 4J8XC 2NQBB 4Z5TD 3AZFD 3MVDB 1P3IB 4H9PB 3EG5B 3REJD 5AVBA 1P3FC 3X1VA 3B6GD 5G49A 5B2IC 4X23D 5AV8A 3KSYA 1ZLAB 3O62A 5AVCD 1KX3D 1P3BA 1P3LB 3B0BA 3AYWD 3WTPD 3IP4C 5B1LC 3LZ0A 5GSUD 4NE3A 3WA9D 5AV6A 3WKJC 2BG1A 3X1SA 4CSRB 4QLCA 1P3AA 5CPJD 3B0CW 3AV1B 1H3OB 1P3GB 5B24B 4JJNB 3AFAB 5B40C 4XUJA 5B0YC 3REKB 2NQBC 1Z2CB 2JE5A 3MVDC 1P3IC 4CAYB 3X1VD 4UPKA 4WU8A 1TAFB 3X1UB 2PYOB 5FUGA 1ZLAC 5B2IA 3RELB 3AZGA 2AROA 2RIQA 1B67A 3LZ0D 3V9RB 1P3LC 1ID3D 5AV5B 3X1SD 5DNNA 3REHA 4Z5TB 3AZKA 3AV1C 3MNND 2Y2PA 3REJB 1AOIA 3AN2A 4H9NA 1P3GC 3B6GB 4X23B 3AV2A 4H9QA 5B24C 3C1CD 2HUEB 5AVCB 4JJNC 1KX3B 5BO0A 3AYWB 5BS7C 3AFAC 3WTPB 5E5AA 2BYKB 3REKC 3EPKA 3WA9B 5JRGC 1F66A 4WU8D 5B2JD
chains in the Genus database with same CATH topology
5CPJB 1P3IA 2Y2QA 3NQUA 3LJAA 3AZGD 2AROD 3X1UC 4UUZA 4R8PA 2PYOC 3RELC 5DNND 1R4VA 3REHD 5AV5C 1P3LA 3AZKD 3R45A 1AOID 3AN2D 3X1VB 5G49B 2HIOD 3REJC 3AV2D 3AV1A 3O62B 3B6GC 2L5AA 5BNVB 1H3OA 4X23C 4J8UA 4WNNA 5E5AD 1M18D 2HUEC 5AVCC 3AZLD 1KX3C 3LZ0B 3AYWC 3WTPC 3MGPD 1P34C 3X1SB 1F66D 3WA9C 4QLCB 3REKA 3LJAD 4R8PD 4CAYA 4KUDA 2Y2NA 3C1CB 3MGRA 3RELA 2Y2KA 5F99D 1BH9A 1P3OA 4Z66A 3FDDA 4WU8B 4Z5TA 3X1VC 5CHLB 3AZFA 2VQRA 2ZY5A 5B32G 1EQZA 2Y2OA 3O62C 4WJ3C 5GXQD 3AZGB 2AROB 3H0RC 3LZ0C 5DNNB 5B0ZD 3REHB 1P3PD 1KX3A 3X1SC 3AZKB 1KU5A 4QLCC 3WTPA 2BYKA 3WA9A 5GSUA 3KFUG 5CP6A 3AN2B 1AOIB 4KUDD 4H9NB 2HIOB 3A1IA 2BYMB 3AV2B 5CPJA 3MGRD 3AZIA 2CWEA 5E5AB 3C1CC 1M18B 3AZLB 2CV5A 3MGPB 1P3OD 2F8ND 1F66B 3UTBD 3AZHD 3B0DB 4WV4B 3NQUB 4WU8C 1S32A 1EQZD 3LJAB 4UUZB 4R8PB 1BH8A 5BT1D 3AZGC 2AROC 5BNVA 2J8PA 5DNNC 1M1AA 3REHC 1ID3A 3AZKC 5F99B 3R45B 1BFMA 5CP6D 4H9RA 1AOIC 3AN2C 5JA4B 4J8UB 3AZID 3AV2C 2F8NG 4WNNB 3MNNA 5GXQB 4ZUXA 2CV5D 4AWLB 2JCHA 5E5AC 1M18C 1TZYD 5B0ZB 3C1CA 3MGPC 3AZEA 1P3PB 1F66C 1S32D 3B0DC 2Y2IA 3B6FA 3VH5W 4G91B 3LJAC 4KUDB 4H9OA 4R8PC 3F6TA 5B2JA 3MGQA 3MGRB 3AZNA 3A1KA 2NZDA 1M1AD 1BH9B 1P3KA 4Z66B 3KXBD 5F99C 1P3OB 2F8NB 3UTBB 3AZHB 3AZFB 3UT9D 3KUYA 3AZJA 5GT0D 3UTAA 1EQZB 4ZUXD 4J8UC 4NFTA 2HIOA 5GXQC 2BYMA 4AWLC 3WAAA 3AZED 1U35A 5BNXB 3W99A 5B0ZC 1M18A 3AZLA 1P3PC 3B6FD 5GSUB 5B32A 5CP6B 3MGPA 3LELD 5C3IB 4WU9A 4G91C 1KX5A 3MGQD 2YFVA 3H0MC 4KUDC 2FJ7A 3AZND 2NZDD 3AZIB 3MGRC 2CV5B 1P3KD 1TZYB 3NQJA 1P3OC 4Z66C 1WWSA 3KUYD 4J8WA 3UTBC 3AZHC 3AZJD 4Z5TC 3UTAD 3AZFC 5F99A 1S32B 3W98A 1EQZC 1BH8B 3X1TD 3WAAD 1U35D 5JA4A 5BT1C 3TU4A 3W99D 2ZY3A 1M1AB 2W8SA 5GXQA 1ID3B 5B32D 4YS3D 2Y2HA 4WU9D 4H9RB 3KXBB 5GSUC 1KX5D 5B0ZA 5CP6C 4LD9A 1P3PA 5C3IC 5AV9A 4WZSB 2FJ7D 3UT9B 5CPJC 5GT0B 3MNNB 4ZUXB 3AZIC 2IO5B 2CV5C 3AZEB 4J8WD 1TZYC 2DQNC 2JSSA 4Z2MG 3B6FB 3W98D 4ZBJB 1S32C 2F8NA 2Y2GA 4H9OB 3UTBA 3AZHA 5B2JB 2G5IC 1PZRA 3MGQB 3TU4D 1N1JB 5B0YD 3AZNB 2NZDB 5KDMA 1M1AC 3P5JB 1P3KB 1ID3C 4LD9D 3AZMD 5BNXA 5AV9D 3KXBC 3KUYB 1ZLAD 3AZJB 3UTAB 5DNMA 4J8VA 2XD5A 3UT9C 5GT0C 3MNNC 3H0LC 4ZUXC 3X1TB 3WAAB 1U35B 2IO5C 5B33A 3W99B 3AZEC 5AY8D 2YFWA 5B32B 1F1EA 4YS3B 4WU9B 5GT3A 3B6FC 1TZYA 1KX5B 4ZBJC 3AL0C 2YFVB 4JJND 3VH6W 5B31D 4YM6D 3A6NA 3KWQA 5B2JC 2FJ7B 1M19A 3MGQC 1HQ3A 2F8NK 3AZNC 2NZDC 5JRGD 1A7WA 3W97A 3NQJB 1P3KC 2RVQD 4J8WB 5DNMD 4J8VD 3LZ1A 3W96A 3W98B 3KUYC 3AZJC 3B0CT 3KXBA 3UTAC 2HIOC 3TU4B 5B33D 3REIA 3WAAC 3UT9A 3X1TC 2ZY4A 5GT0A 1U35C 3W99C 1KX4D 5B31G 3AZLC 5GT3D 4LD9B 5B32C 4YS3C 3AZMB 5AV9B 3KWQD 3A6ND 4DRAA 4WU9C 3VH5T 1KX5C 1M19D 4H9SA 1HQ3D 4EO5B 2FJ7C 3VH5A 3LELA 1P34D 3W97D 3MGSD 4KGCD 4XZQA 1N1JA 1P3MA 5AY8B 5CPKA 5B1MA 3LZ1D 3C1BD 4J8WC 2Y2JA 2F8NH 3W96D 2ZY2A 3W98C 5CPID 5B31B 4YM6B 3REID 3TU4C 5KDMB 5JRGB 3X1TA 4J8XA 5AVBD 4LD9C 5AV8D 3AZMC 4M6BA 3O62D 5AV9C 1P3BD 5DNMB 4YS3A 4J8VB 1P3FA 4DRBA 3EPJA 4EO5C 1JFIA 4NE5A 5AV6D 1T3UA 4XZQD 4KHAB 4QLCD 5B33B 1P3AD 1P3MD 5B1LA 5CPKD 5B1MD 2YFWB 1KX4B 3WKJA 5AY8C 3EPLA 5GT3B 4G92B 1B6WA 3A6NB 3KWQB 1M19B 1HQ3B 4XUJD 5B31C 4YM6C 2G5HC 1P34B 4J8XD 3MGSB 3W97B 5B40A 4KGCB 5B0YA 2NQBA 2UWXA 3MVDA 2RVQC 4H9PA 3LZ1B 1P3FD 3C1BB 3W96B 5B2ID 5DNMC 3AZMA 4J8VC 5CPIB 3REIB 1ZLAA 5B1LD 5B33C 3WKJD 4E45A 5AVBB 3EPHA 1KX4C 4CSRA 5GT3C 5AV8B 2FFFB 5AY8A 4G92C 3KWQC 3A6NC 1P3BB 1ULYA 1M19C 3WTPE 3LELB 1P3GA 1HQ3C 1HTAA 5B40D 5B24A 1Q9CA 5AV6B 4JJNA 4XZQB 5B31A 4YM6A 3W97C 3MGSC 2NQBD 5BS7A 3AFAA 4KGCC 1P3AB 1P3MB 3MVDD 1P3ID 5CPKB 5B1MB 5JRGA 1W2EA 3LZ1C 3W96C 3C1BC 2F2AC 1TAFA 5CPIC 1P3LD 4XUJB 3X1UA 2PYOA 3REIC 4Z2MH 4HGAB 1WWIA 3V9RA 4J8XB 5AV5A 4KHAA 5AVBC 3AV1D 2LY8A 2ZM5A 4J8UD 5AV8C 1P3FB 1KX4A 4H9SC 5FUGB 1P3GD 3REJA 5B2IB 1P3BC 4NE6A 3VH6T 1JFIB 5B24D 3LELC 3B6GA 3VH6A 4X23A 3AFAD 5AV6C 5B1LB 4XZQC 5AVCA 3REKD 3AYWA 1P34A 1P3AC 1P3MC 3WKJB 3MGSA 5CPKC 5B1MC 4KGCA 4DQYB 2XD1A 4H9QB 3X1UD 3C1BA 2PYOD 5BO0B 3RELD 4XUJC 5B40B 2Y2LA 5AV5D 2Y2MA 4HGAC 4Z66D 2DF4C 4E44A 5B0YB 5CPIA 4J8XC 2NQBB 4Z5TD 3AZFD 3MVDB 1P3IB 4H9PB 3EG5B 3REJD 5AVBA 1P3FC 3X1VA 3B6GD 5G49A 5B2IC 4X23D 5AV8A 3KSYA 1ZLAB 3O62A 5AVCD 1KX3D 1P3BA 1P3LB 3B0BA 3AYWD 3WTPD 3IP4C 5B1LC 3LZ0A 5GSUD 4NE3A 3WA9D 5AV6A 3WKJC 2BG1A 3X1SA 4CSRB 4QLCA 1P3AA 5CPJD 3B0CW 3AV1B 1H3OB 1P3GB 5B24B 4JJNB 3AFAB 5B40C 4XUJA 5B0YC 3REKB 2NQBC 1Z2CB 2JE5A 3MVDC 1P3IC 4CAYB 3X1VD 4UPKA 4WU8A 1TAFB 3X1UB 2PYOB 5FUGA 1ZLAC 5B2IA 3RELB 3AZGA 2AROA 2RIQA 1B67A 3LZ0D 3V9RB 1P3LC 1ID3D 5AV5B 3X1SD 5DNNA 3REHA 4Z5TB 3AZKA 3AV1C 3MNND 2Y2PA 3REJB 1AOIA 3AN2A 4H9NA 1P3GC 3B6GB 4X23B 3AV2A 4H9QA 5B24C 3C1CD 2HUEB 5AVCB 4JJNC 1KX3B 5BO0A 3AYWB 5BS7C 3AFAC 3WTPB 5E5AA 2BYKB 3REKC 3EPKA 3WA9B 5JRGC 1F66A 4WU8D 5B2JD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ B;  1P3I A;  3NQU A;  3LJA A;  3AZG D;  2ARO D;  3X1U C;  4UUZ A;  4R8P A;  2PYO C;  3REL C;  5DNN D;  1R4V A;  3REH D;  5AV5 C;  1P3L A;  3AZK D;  3R45 A;  1AOI D;  3AN2 D;  3X1V B;  5G49 B;  2HIO D;  3REJ C;  3AV2 D;  3AV1 A;  3O62 B;  3B6G C;  2L5A A;  5BNV B;  1H3O A;  4X23 C;  4J8U A;  4WNN A;  5E5A D;  1M18 D;  2HUE C;  5AVC C;  3AZL D;  1KX3 C;  3LZ0 B;  3AYW C;  3WTP C;  3MGP D;  1P34 C;  3X1S B;  1F66 D;  3WA9 C;  4QLC B;  3REK A;  3LJA D;  4R8P D;  4CAY A;  4KUD A;  3C1C B;  3MGR A;  3REL A;  5F99 D;  1BH9 A;  1P3O A;  4Z66 A;  4WU8 B;  4Z5T A;  3X1V C;  5CHL B;  3AZF A;  5B32 G;  1EQZ A;  3O62 C;  5GXQ D;  3AZG B;  2ARO B;  3LZ0 C;  5DNN B;  5B0Z D;  3REH B;  1P3P D;  1KX3 A;  3X1S C;  3AZK B;  1KU5 A;  4QLC C;  3WTP A;  2BYK A;  3WA9 A;  5GSU A;  5CP6 A;  3AN2 B;  1AOI B;  4KUD D;  4H9N B;  2HIO B;  2BYM B;  3AV2 B;  5CPJ A;  3MGR D;  3AZI A;  2CWE A;  5E5A B;  3C1C C;  1M18 B;  3AZL B;  2CV5 A;  3MGP B;  1P3O D;  2F8N D;  1F66 B;  3UTB D;  3AZH D;  3B0D B;  4WV4 B;  3NQU B;  4WU8 C;  1S32 A;  1EQZ D;  3LJA B;  4UUZ B;  4R8P B;  1BH8 A;  5BT1 D;  3AZG C;  2ARO C;  5BNV A;  5DNN C;  1M1A A;  3REH C;  1ID3 A;  3AZK C;  5F99 B;  3R45 B;  1BFM A;  5CP6 D;  4H9R A;  1AOI C;  3AN2 C;  5JA4 B;  4J8U B;  3AZI D;  3AV2 C;  2F8N G;  4WNN B;  3MNN A;  5GXQ B;  4ZUX A;  2CV5 D;  4AWL B;  5E5A C;  1M18 C;  1TZY D;  5B0Z B;  3C1C A;  3MGP C;  3AZE A;  1P3P B;  1F66 C;  1S32 D;  3B0D C;  3B6F A;  3VH5 W;  4G91 B;  3LJA C;  4KUD B;  4H9O A;  4R8P C;  5B2J A;  3MGQ A;  3MGR B;  3AZN A;  2NZD A;  1M1A D;  1BH9 B;  1P3K A;  4Z66 B;  3KXB D;  5F99 C;  1P3O B;  2F8N B;  3UTB B;  3AZH B;  3AZF B;  3UT9 D;  3KUY A;  3AZJ A;  5GT0 D;  3UTA A;  1EQZ B;  4ZUX D;  4J8U C;  4NFT A;  2HIO A;  5GXQ C;  2BYM A;  4AWL C;  3WAA A;  3AZE D;  1U35 A;  5BNX B;  3W99 A;  5B0Z C;  1M18 A;  3AZL A;  1P3P C;  3B6F D;  5GSU B;  5B32 A;  5CP6 B;  3MGP A;  3LEL D;  5C3I B;  4WU9 A;  4G91 C;  1KX5 A;  3MGQ D;  2YFV A;  4KUD C;  2FJ7 A;  3AZN D;  2NZD D;  3AZI B;  3MGR C;  2CV5 B;  1P3K D;  1TZY B;  3NQJ A;  1P3O C;  4Z66 C;  1WWS A;  3KUY D;  4J8W A;  3UTB C;  3AZH C;  3AZJ D;  4Z5T C;  3UTA D;  3AZF C;  5F99 A;  1S32 B;  3W98 A;  1EQZ C;  1BH8 B;  3X1T D;  3WAA D;  1U35 D;  5JA4 A;  5BT1 C;  3TU4 A;  3W99 D;  1M1A B;  5GXQ A;  1ID3 B;  5B32 D;  4YS3 D;  4WU9 D;  4H9R B;  3KXB B;  5GSU C;  1KX5 D;  5B0Z A;  5CP6 C;  4LD9 A;  1P3P A;  5C3I C;  5AV9 A;  4WZS B;  2FJ7 D;  3UT9 B;  5CPJ C;  5GT0 B;  3MNN B;  4ZUX B;  3AZI C;  2IO5 B;  2CV5 C;  3AZE B;  4J8W D;  1TZY C;  2JSS A;  4Z2M G;  3B6F B;  3W98 D;  4ZBJ B;  1S32 C;  2F8N A;  4H9O B;  3UTB A;  3AZH A;  5B2J B;  3MGQ B;  3TU4 D;  1N1J B;  5B0Y D;  3AZN B;  2NZD B;  5KDM A;  1M1A C;  1P3K B;  1ID3 C;  4LD9 D;  3AZM D;  5BNX A;  5AV9 D;  3KXB C;  3KUY B;  1ZLA D;  3AZJ B;  3UTA B;  5DNM A;  4J8V A;  3UT9 C;  5GT0 C;  3MNN C;  4ZUX C;  3X1T B;  3WAA B;  1U35 B;  2IO5 C;  5B33 A;  3W99 B;  3AZE C;  5AY8 D;  2YFW A;  5B32 B;  1F1E A;  4YS3 B;  4WU9 B;  5GT3 A;  3B6F C;  1TZY A;  1KX5 B;  4ZBJ C;  2YFV B;  4JJN D;  3VH6 W;  4YM6 D;  5B31 D;  3A6N A;  3KWQ A;  5B2J C;  2FJ7 B;  1M19 A;  3MGQ C;  1HQ3 A;  2F8N K;  3AZN C;  2NZD C;  5JRG D;  1A7W A;  3W97 A;  3NQJ B;  1P3K C;  2RVQ D;  4J8W B;  5DNM D;  4J8V D;  3LZ1 A;  3W96 A;  3W98 B;  3KUY C;  3AZJ C;  3B0C T;  3KXB A;  3UTA C;  2HIO C;  3TU4 B;  5B33 D;  3REI A;  3WAA C;  3UT9 A;  3X1T C;  5GT0 A;  1U35 C;  3W99 C;  1KX4 D;  5B31 G;  3AZL C;  5GT3 D;  4LD9 B;  5B32 C;  4YS3 C;  3AZM B;  5AV9 B;  3KWQ D;  3A6N D;  4DRA A;  4WU9 C;  3VH5 T;  1KX5 C;  1M19 D;  4H9S A;  1HQ3 D;  4EO5 B;  2FJ7 C;  3VH5 A;  3LEL A;  1P34 D;  3W97 D;  3MGS D;  4KGC D;  4XZQ A;  1N1J A;  1P3M A;  5AY8 B;  5CPK A;  5B1M A;  3LZ1 D;  3C1B D;  4J8W C;  2F8N H;  3W96 D;  3W98 C;  5CPI D;  5B31 B;  4YM6 B;  3REI D;  3TU4 C;  5KDM B;  5JRG B;  3X1T A;  4J8X A;  5AVB D;  4LD9 C;  5AV8 D;  3AZM C;  4M6B A;  3O62 D;  5AV9 C;  1P3B D;  5DNM B;  4YS3 A;  4J8V B;  1P3F A;  4DRB A;  4EO5 C;  1JFI A;  4NE5 A;  5AV6 D;  4XZQ D;  4KHA B;  4QLC D;  5B33 B;  1P3A D;  1P3M D;  5B1L A;  5CPK D;  5B1M D;  2YFW B;  1KX4 B;  3WKJ A;  5AY8 C;  5GT3 B;  4G92 B;  1B6W A;  3A6N B;  3KWQ B;  1M19 B;  1HQ3 B;  4XUJ D;  5B31 C;  4YM6 C;  1P34 B;  4J8X D;  3MGS B;  3W97 B;  5B40 A;  4KGC B;  5B0Y A;  2NQB A;  3MVD A;  2RVQ C;  4H9P A;  3LZ1 B;  1P3F D;  3C1B B;  3W96 B;  5B2I D;  5DNM C;  3AZM A;  4J8V C;  5CPI B;  3REI B;  1ZLA A;  5B1L D;  5B33 C;  3WKJ D;  4E45 A;  5AVB B;  1KX4 C;  4CSR A;  5GT3 C;  5AV8 B;  5AY8 A;  4G92 C;  3KWQ C;  3A6N C;  1P3B B;  1ULY A;  1M19 C;  3WTP E;  3LEL B;  1P3G A;  1HQ3 C;  1HTA A;  5B40 D;  5B24 A;  1Q9C A;  5AV6 B;  4JJN A;  4XZQ B;  5B31 A;  4YM6 A;  3W97 C;  3MGS C;  2NQB D;  5BS7 A;  3AFA A;  4KGC C;  1P3A B;  1P3M B;  3MVD D;  1P3I D;  5CPK B;  5B1M B;  5JRG A;  3LZ1 C;  3W96 C;  3C1B C;  1TAF A;  5CPI C;  1P3L D;  4XUJ B;  3X1U A;  2PYO A;  3REI C;  4Z2M H;  4HGA B;  1WWI A;  3V9R A;  4J8X B;  5AV5 A;  4KHA A;  5AVB C;  3AV1 D;  2LY8 A;  4J8U D;  5AV8 C;  1P3F B;  1KX4 A;  4H9S C;  5FUG B;  1P3G D;  3REJ A;  5B2I B;  1P3B C;  4NE6 A;  3VH6 T;  1JFI B;  5B24 D;  3LEL C;  3B6G A;  3VH6 A;  4X23 A;  3AFA D;  5AV6 C;  5B1L B;  4XZQ C;  5AVC A;  3REK D;  3AYW A;  1P34 A;  1P3A C;  1P3M C;  3WKJ B;  3MGS A;  5CPK C;  5B1M C;  4KGC A;  4H9Q B;  3X1U D;  3C1B A;  2PYO D;  5BO0 B;  3REL D;  4XUJ C;  5B40 B;  5AV5 D;  5CPI A;  4HGA C;  4Z66 D;  4E44 A;  5B0Y B;  4J8X C;  2NQB B;  4Z5T D;  3AZF D;  3MVD B;  1P3I B;  4H9P B;  3REJ D;  5AVB A;  1P3F C;  3X1V A;  3B6G D;  5G49 A;  5B2I C;  4X23 D;  5AV8 A;  3KSY A;  1ZLA B;  3O62 A;  5AVC D;  1KX3 D;  1P3B A;  1P3L B;  3B0B A;  3AYW D;  3WTP D;  5B1L C;  3LZ0 A;  5GSU D;  4NE3 A;  3WA9 D;  5AV6 A;  3WKJ C;  3X1S A;  4CSR B;  4QLC A;  1P3A A;  5CPJ D;  3B0C W;  3AV1 B;  1H3O B;  1P3G B;  5B24 B;  4JJN B;  3AFA B;  5B40 C;  4XUJ A;  5B0Y C;  3REK B;  2NQB C;  3MVD C;  1P3I C;  4CAY B;  3X1V D;  4WU8 A;  1TAF B;  3X1U B;  2PYO B;  5FUG A;  1ZLA C;  5B2I A;  3REL B;  3AZG A;  2ARO A;  3LZ0 D;  1B67 A;  1P3L C;  3V9R B;  1ID3 D;  5AV5 B;  3X1S D;  5DNN A;  3REH A;  4Z5T B;  3AZK A;  3AV1 C;  3MNN D;  3REJ B;  1AOI A;  3AN2 A;  4H9N A;  1P3G C;  3B6G B;  4X23 B;  3AV2 A;  4H9Q A;  5B24 C;  3C1C D;  2HUE B;  5AVC B;  4JJN C;  1KX3 B;  5BO0 A;  3AYW B;  5BS7 C;  3AFA C;  3WTP B;  5E5A A;  2BYK B;  3REK C;  3WA9 B;  5JRG C;  1F66 A;  4WU8 D;  5B2J D; 
#chains in the Genus database with same CATH topology
 5CPJ B;  1P3I A;  2Y2Q A;  3NQU A;  3LJA A;  3AZG D;  2ARO D;  3X1U C;  4UUZ A;  4R8P A;  2PYO C;  3REL C;  5DNN D;  1R4V A;  3REH D;  5AV5 C;  1P3L A;  3AZK D;  3R45 A;  1AOI D;  3AN2 D;  3X1V B;  5G49 B;  2HIO D;  3REJ C;  3AV2 D;  3AV1 A;  3O62 B;  3B6G C;  2L5A A;  5BNV B;  1H3O A;  4X23 C;  4J8U A;  4WNN A;  5E5A D;  1M18 D;  2HUE C;  5AVC C;  3AZL D;  1KX3 C;  3LZ0 B;  3AYW C;  3WTP C;  3MGP D;  1P34 C;  3X1S B;  1F66 D;  3WA9 C;  4QLC B;  3REK A;  3LJA D;  4R8P D;  4CAY A;  4KUD A;  2Y2N A;  3C1C B;  3MGR A;  3REL A;  2Y2K A;  5F99 D;  1BH9 A;  1P3O A;  4Z66 A;  3FDD A;  4WU8 B;  4Z5T A;  3X1V C;  5CHL B;  3AZF A;  2VQR A;  2ZY5 A;  5B32 G;  1EQZ A;  2Y2O A;  3O62 C;  4WJ3 C;  5GXQ D;  3AZG B;  2ARO B;  3H0R C;  3LZ0 C;  5DNN B;  5B0Z D;  3REH B;  1P3P D;  1KX3 A;  3X1S C;  3AZK B;  1KU5 A;  4QLC C;  3WTP A;  2BYK A;  3WA9 A;  5GSU A;  3KFU G;  5CP6 A;  3AN2 B;  1AOI B;  4KUD D;  4H9N B;  2HIO B;  3A1I A;  2BYM B;  3AV2 B;  5CPJ A;  3MGR D;  3AZI A;  2CWE A;  5E5A B;  3C1C C;  1M18 B;  3AZL B;  2CV5 A;  3MGP B;  1P3O D;  2F8N D;  1F66 B;  3UTB D;  3AZH D;  3B0D B;  4WV4 B;  3NQU B;  4WU8 C;  1S32 A;  1EQZ D;  3LJA B;  4UUZ B;  4R8P B;  1BH8 A;  5BT1 D;  3AZG C;  2ARO C;  5BNV A;  2J8P A;  5DNN C;  1M1A A;  3REH C;  1ID3 A;  3AZK C;  5F99 B;  3R45 B;  1BFM A;  5CP6 D;  4H9R A;  1AOI C;  3AN2 C;  5JA4 B;  4J8U B;  3AZI D;  3AV2 C;  2F8N G;  4WNN B;  3MNN A;  5GXQ B;  4ZUX A;  2CV5 D;  4AWL B;  2JCH A;  5E5A C;  1M18 C;  1TZY D;  5B0Z B;  3C1C A;  3MGP C;  3AZE A;  1P3P B;  1F66 C;  1S32 D;  3B0D C;  2Y2I A;  3B6F A;  3VH5 W;  4G91 B;  3LJA C;  4KUD B;  4H9O A;  4R8P C;  3F6T A;  5B2J A;  3MGQ A;  3MGR B;  3AZN A;  3A1K A;  2NZD A;  1M1A D;  1BH9 B;  1P3K A;  4Z66 B;  3KXB D;  5F99 C;  1P3O B;  2F8N B;  3UTB B;  3AZH B;  3AZF B;  3UT9 D;  3KUY A;  3AZJ A;  5GT0 D;  3UTA A;  1EQZ B;  4ZUX D;  4J8U C;  4NFT A;  2HIO A;  5GXQ C;  2BYM A;  4AWL C;  3WAA A;  3AZE D;  1U35 A;  5BNX B;  3W99 A;  5B0Z C;  1M18 A;  3AZL A;  1P3P C;  3B6F D;  5GSU B;  5B32 A;  5CP6 B;  3MGP A;  3LEL D;  5C3I B;  4WU9 A;  4G91 C;  1KX5 A;  3MGQ D;  2YFV A;  3H0M C;  4KUD C;  2FJ7 A;  3AZN D;  2NZD D;  3AZI B;  3MGR C;  2CV5 B;  1P3K D;  1TZY B;  3NQJ A;  1P3O C;  4Z66 C;  1WWS A;  3KUY D;  4J8W A;  3UTB C;  3AZH C;  3AZJ D;  4Z5T C;  3UTA D;  3AZF C;  5F99 A;  1S32 B;  3W98 A;  1EQZ C;  1BH8 B;  3X1T D;  3WAA D;  1U35 D;  5JA4 A;  5BT1 C;  3TU4 A;  3W99 D;  2ZY3 A;  1M1A B;  2W8S A;  5GXQ A;  1ID3 B;  5B32 D;  4YS3 D;  2Y2H A;  4WU9 D;  4H9R B;  3KXB B;  5GSU C;  1KX5 D;  5B0Z A;  5CP6 C;  4LD9 A;  1P3P A;  5C3I C;  5AV9 A;  4WZS B;  2FJ7 D;  3UT9 B;  5CPJ C;  5GT0 B;  3MNN B;  4ZUX B;  3AZI C;  2IO5 B;  2CV5 C;  3AZE B;  4J8W D;  1TZY C;  2DQN C;  2JSS A;  4Z2M G;  3B6F B;  3W98 D;  4ZBJ B;  1S32 C;  2F8N A;  2Y2G A;  4H9O B;  3UTB A;  3AZH A;  5B2J B;  2G5I C;  1PZR A;  3MGQ B;  3TU4 D;  1N1J B;  5B0Y D;  3AZN B;  2NZD B;  5KDM A;  1M1A C;  3P5J B;  1P3K B;  1ID3 C;  4LD9 D;  3AZM D;  5BNX A;  5AV9 D;  3KXB C;  3KUY B;  1ZLA D;  3AZJ B;  3UTA B;  5DNM A;  4J8V A;  2XD5 A;  3UT9 C;  5GT0 C;  3MNN C;  3H0L C;  4ZUX C;  3X1T B;  3WAA B;  1U35 B;  2IO5 C;  5B33 A;  3W99 B;  3AZE C;  5AY8 D;  2YFW A;  5B32 B;  1F1E A;  4YS3 B;  4WU9 B;  5GT3 A;  3B6F C;  1TZY A;  1KX5 B;  4ZBJ C;  3AL0 C;  2YFV B;  4JJN D;  3VH6 W;  5B31 D;  4YM6 D;  3A6N A;  3KWQ A;  5B2J C;  2FJ7 B;  1M19 A;  3MGQ C;  1HQ3 A;  2F8N K;  3AZN C;  2NZD C;  5JRG D;  1A7W A;  3W97 A;  3NQJ B;  1P3K C;  2RVQ D;  4J8W B;  5DNM D;  4J8V D;  3LZ1 A;  3W96 A;  3W98 B;  3KUY C;  3AZJ C;  3B0C T;  3KXB A;  3UTA C;  2HIO C;  3TU4 B;  5B33 D;  3REI A;  3WAA C;  3UT9 A;  3X1T C;  2ZY4 A;  5GT0 A;  1U35 C;  3W99 C;  1KX4 D;  5B31 G;  3AZL C;  5GT3 D;  4LD9 B;  5B32 C;  4YS3 C;  3AZM B;  5AV9 B;  3KWQ D;  3A6N D;  4DRA A;  4WU9 C;  3VH5 T;  1KX5 C;  1M19 D;  4H9S A;  1HQ3 D;  4EO5 B;  2FJ7 C;  3VH5 A;  3LEL A;  1P34 D;  3W97 D;  3MGS D;  4KGC D;  4XZQ A;  1N1J A;  1P3M A;  5AY8 B;  5CPK A;  5B1M A;  3LZ1 D;  3C1B D;  4J8W C;  2Y2J A;  2F8N H;  3W96 D;  2ZY2 A;  3W98 C;  5CPI D;  5B31 B;  4YM6 B;  3REI D;  3TU4 C;  5KDM B;  5JRG B;  3X1T A;  4J8X A;  5AVB D;  4LD9 C;  5AV8 D;  3AZM C;  4M6B A;  3O62 D;  5AV9 C;  1P3B D;  5DNM B;  4YS3 A;  4J8V B;  1P3F A;  4DRB A;  3EPJ A;  4EO5 C;  1JFI A;  4NE5 A;  5AV6 D;  1T3U A;  4XZQ D;  4KHA B;  4QLC D;  5B33 B;  1P3A D;  1P3M D;  5B1L A;  5CPK D;  5B1M D;  2YFW B;  1KX4 B;  3WKJ A;  5AY8 C;  3EPL A;  5GT3 B;  4G92 B;  1B6W A;  3A6N B;  3KWQ B;  1M19 B;  1HQ3 B;  4XUJ D;  5B31 C;  4YM6 C;  2G5H C;  1P34 B;  4J8X D;  3MGS B;  3W97 B;  5B40 A;  4KGC B;  5B0Y A;  2NQB A;  2UWX A;  3MVD A;  2RVQ C;  4H9P A;  3LZ1 B;  1P3F D;  3C1B B;  3W96 B;  5B2I D;  5DNM C;  3AZM A;  4J8V C;  5CPI B;  3REI B;  1ZLA A;  5B1L D;  5B33 C;  3WKJ D;  4E45 A;  5AVB B;  3EPH A;  1KX4 C;  4CSR A;  5GT3 C;  5AV8 B;  2FFF B;  5AY8 A;  4G92 C;  3KWQ C;  3A6N C;  1P3B B;  1ULY A;  1M19 C;  3WTP E;  3LEL B;  1P3G A;  1HQ3 C;  1HTA A;  5B40 D;  5B24 A;  1Q9C A;  5AV6 B;  4JJN A;  4XZQ B;  5B31 A;  4YM6 A;  3W97 C;  3MGS C;  2NQB D;  5BS7 A;  3AFA A;  4KGC C;  1P3A B;  1P3M B;  3MVD D;  1P3I D;  5CPK B;  5B1M B;  5JRG A;  1W2E A;  3LZ1 C;  3W96 C;  3C1B C;  2F2A C;  1TAF A;  5CPI C;  1P3L D;  4XUJ B;  3X1U A;  2PYO A;  3REI C;  4Z2M H;  4HGA B;  1WWI A;  3V9R A;  4J8X B;  5AV5 A;  4KHA A;  5AVB C;  3AV1 D;  2LY8 A;  2ZM5 A;  4J8U D;  5AV8 C;  1P3F B;  1KX4 A;  4H9S C;  5FUG B;  1P3G D;  3REJ A;  5B2I B;  1P3B C;  4NE6 A;  3VH6 T;  1JFI B;  5B24 D;  3LEL C;  3B6G A;  3VH6 A;  4X23 A;  3AFA D;  5AV6 C;  5B1L B;  4XZQ C;  5AVC A;  3REK D;  3AYW A;  1P34 A;  1P3A C;  1P3M C;  3WKJ B;  3MGS A;  5CPK C;  5B1M C;  4KGC A;  4DQY B;  2XD1 A;  4H9Q B;  3X1U D;  3C1B A;  2PYO D;  5BO0 B;  3REL D;  4XUJ C;  5B40 B;  2Y2L A;  5AV5 D;  2Y2M A;  4HGA C;  4Z66 D;  2DF4 C;  4E44 A;  5B0Y B;  5CPI A;  4J8X C;  2NQB B;  4Z5T D;  3AZF D;  3MVD B;  1P3I B;  4H9P B;  3EG5 B;  3REJ D;  5AVB A;  1P3F C;  3X1V A;  3B6G D;  5G49 A;  5B2I C;  4X23 D;  5AV8 A;  3KSY A;  1ZLA B;  3O62 A;  5AVC D;  1KX3 D;  1P3B A;  1P3L B;  3B0B A;  3AYW D;  3WTP D;  3IP4 C;  5B1L C;  3LZ0 A;  5GSU D;  4NE3 A;  3WA9 D;  5AV6 A;  3WKJ C;  2BG1 A;  3X1S A;  4CSR B;  4QLC A;  1P3A A;  5CPJ D;  3B0C W;  3AV1 B;  1H3O B;  1P3G B;  5B24 B;  4JJN B;  3AFA B;  5B40 C;  4XUJ A;  5B0Y C;  3REK B;  2NQB C;  1Z2C B;  2JE5 A;  3MVD C;  1P3I C;  4CAY B;  3X1V D;  4UPK A;  4WU8 A;  1TAF B;  3X1U B;  2PYO B;  5FUG A;  1ZLA C;  5B2I A;  3REL B;  3AZG A;  2ARO A;  2RIQ A;  1B67 A;  3LZ0 D;  3V9R B;  1P3L C;  1ID3 D;  5AV5 B;  3X1S D;  5DNN A;  3REH A;  4Z5T B;  3AZK A;  3AV1 C;  3MNN D;  2Y2P A;  3REJ B;  1AOI A;  3AN2 A;  4H9N A;  1P3G C;  3B6G B;  4X23 B;  3AV2 A;  4H9Q A;  5B24 C;  3C1C D;  2HUE B;  5AVC B;  4JJN C;  1KX3 B;  5BO0 A;  3AYW B;  5BS7 C;  3AFA C;  3WTP B;  5E5A A;  2BYK B;  3REK C;  3EPK A;  3WA9 B;  5JRG C;  1F66 A;  4WU8 D;  5B2J D; 
#chains in the Genus database with same CATH homology
 5CPJ B;  1P3I A;  2Y2Q A;  3NQU A;  3LJA A;  3AZG D;  2ARO D;  3X1U C;  4UUZ A;  4R8P A;  2PYO C;  3REL C;  5DNN D;  1R4V A;  3REH D;  5AV5 C;  1P3L A;  3AZK D;  3R45 A;  1AOI D;  3AN2 D;  3X1V B;  5G49 B;  2HIO D;  3REJ C;  3AV2 D;  3AV1 A;  3O62 B;  3B6G C;  2L5A A;  5BNV B;  1H3O A;  4X23 C;  4J8U A;  4WNN A;  5E5A D;  1M18 D;  2HUE C;  5AVC C;  3AZL D;  1KX3 C;  3LZ0 B;  3AYW C;  3WTP C;  3MGP D;  1P34 C;  3X1S B;  1F66 D;  3WA9 C;  4QLC B;  3REK A;  3LJA D;  4R8P D;  4CAY A;  4KUD A;  2Y2N A;  3C1C B;  3MGR A;  3REL A;  2Y2K A;  5F99 D;  1BH9 A;  1P3O A;  4Z66 A;  3FDD A;  4WU8 B;  4Z5T A;  3X1V C;  5CHL B;  3AZF A;  2VQR A;  2ZY5 A;  5B32 G;  1EQZ A;  2Y2O A;  3O62 C;  4WJ3 C;  5GXQ D;  3AZG B;  2ARO B;  3H0R C;  3LZ0 C;  5DNN B;  5B0Z D;  3REH B;  1P3P D;  1KX3 A;  3X1S C;  3AZK B;  1KU5 A;  4QLC C;  3WTP A;  2BYK A;  3WA9 A;  5GSU A;  3KFU G;  5CP6 A;  3AN2 B;  1AOI B;  4KUD D;  4H9N B;  2HIO B;  3A1I A;  2BYM B;  3AV2 B;  5CPJ A;  3MGR D;  3AZI A;  2CWE A;  5E5A B;  3C1C C;  1M18 B;  3AZL B;  2CV5 A;  3MGP B;  1P3O D;  2F8N D;  1F66 B;  3UTB D;  3AZH D;  3B0D B;  4WV4 B;  3NQU B;  4WU8 C;  1S32 A;  1EQZ D;  3LJA B;  4UUZ B;  4R8P B;  1BH8 A;  5BT1 D;  3AZG C;  2ARO C;  5BNV A;  2J8P A;  5DNN C;  1M1A A;  3REH C;  1ID3 A;  3AZK C;  5F99 B;  3R45 B;  1BFM A;  5CP6 D;  4H9R A;  1AOI C;  3AN2 C;  5JA4 B;  4J8U B;  3AZI D;  3AV2 C;  2F8N G;  4WNN B;  3MNN A;  5GXQ B;  4ZUX A;  2CV5 D;  4AWL B;  2JCH A;  5E5A C;  1M18 C;  1TZY D;  5B0Z B;  3C1C A;  3MGP C;  3AZE A;  1P3P B;  1F66 C;  1S32 D;  3B0D C;  2Y2I A;  3B6F A;  3VH5 W;  4G91 B;  3LJA C;  4KUD B;  4H9O A;  4R8P C;  3F6T A;  5B2J A;  3MGQ A;  3MGR B;  3AZN A;  3A1K A;  2NZD A;  1M1A D;  1BH9 B;  1P3K A;  4Z66 B;  3KXB D;  5F99 C;  1P3O B;  2F8N B;  3UTB B;  3AZH B;  3AZF B;  3UT9 D;  3KUY A;  3AZJ A;  5GT0 D;  3UTA A;  1EQZ B;  4ZUX D;  4J8U C;  4NFT A;  2HIO A;  5GXQ C;  2BYM A;  4AWL C;  3WAA A;  3AZE D;  1U35 A;  5BNX B;  3W99 A;  5B0Z C;  1M18 A;  3AZL A;  1P3P C;  3B6F D;  5GSU B;  5B32 A;  5CP6 B;  3MGP A;  3LEL D;  5C3I B;  4WU9 A;  4G91 C;  1KX5 A;  3MGQ D;  2YFV A;  3H0M C;  4KUD C;  2FJ7 A;  3AZN D;  2NZD D;  3AZI B;  3MGR C;  2CV5 B;  1P3K D;  1TZY B;  3NQJ A;  1P3O C;  4Z66 C;  1WWS A;  3KUY D;  4J8W A;  3UTB C;  3AZH C;  3AZJ D;  4Z5T C;  3UTA D;  3AZF C;  5F99 A;  1S32 B;  3W98 A;  1EQZ C;  1BH8 B;  3X1T D;  3WAA D;  1U35 D;  5JA4 A;  5BT1 C;  3TU4 A;  3W99 D;  2ZY3 A;  1M1A B;  2W8S A;  5GXQ A;  1ID3 B;  5B32 D;  4YS3 D;  2Y2H A;  4WU9 D;  4H9R B;  3KXB B;  5GSU C;  1KX5 D;  5B0Z A;  5CP6 C;  4LD9 A;  1P3P A;  5C3I C;  5AV9 A;  4WZS B;  2FJ7 D;  3UT9 B;  5CPJ C;  5GT0 B;  3MNN B;  4ZUX B;  3AZI C;  2IO5 B;  2CV5 C;  3AZE B;  4J8W D;  1TZY C;  2DQN C;  2JSS A;  4Z2M G;  3B6F B;  3W98 D;  4ZBJ B;  1S32 C;  2F8N A;  2Y2G A;  4H9O B;  3UTB A;  3AZH A;  5B2J B;  2G5I C;  1PZR A;  3MGQ B;  3TU4 D;  1N1J B;  5B0Y D;  3AZN B;  2NZD B;  5KDM A;  1M1A C;  3P5J B;  1P3K B;  1ID3 C;  4LD9 D;  3AZM D;  5BNX A;  5AV9 D;  3KXB C;  3KUY B;  1ZLA D;  3AZJ B;  3UTA B;  5DNM A;  4J8V A;  2XD5 A;  3UT9 C;  5GT0 C;  3MNN C;  3H0L C;  4ZUX C;  3X1T B;  3WAA B;  1U35 B;  2IO5 C;  5B33 A;  3W99 B;  3AZE C;  5AY8 D;  2YFW A;  5B32 B;  1F1E A;  4YS3 B;  4WU9 B;  5GT3 A;  3B6F C;  1TZY A;  1KX5 B;  4ZBJ C;  3AL0 C;  2YFV B;  4JJN D;  3VH6 W;  5B31 D;  4YM6 D;  3A6N A;  3KWQ A;  5B2J C;  2FJ7 B;  1M19 A;  3MGQ C;  1HQ3 A;  2F8N K;  3AZN C;  2NZD C;  5JRG D;  1A7W A;  3W97 A;  3NQJ B;  1P3K C;  2RVQ D;  4J8W B;  5DNM D;  4J8V D;  3LZ1 A;  3W96 A;  3W98 B;  3KUY C;  3AZJ C;  3B0C T;  3KXB A;  3UTA C;  2HIO C;  3TU4 B;  5B33 D;  3REI A;  3WAA C;  3UT9 A;  3X1T C;  2ZY4 A;  5GT0 A;  1U35 C;  3W99 C;  1KX4 D;  5B31 G;  3AZL C;  5GT3 D;  4LD9 B;  5B32 C;  4YS3 C;  3AZM B;  5AV9 B;  3KWQ D;  3A6N D;  4DRA A;  4WU9 C;  3VH5 T;  1KX5 C;  1M19 D;  4H9S A;  1HQ3 D;  4EO5 B;  2FJ7 C;  3VH5 A;  3LEL A;  1P34 D;  3W97 D;  3MGS D;  4KGC D;  4XZQ A;  1N1J A;  1P3M A;  5AY8 B;  5CPK A;  5B1M A;  3LZ1 D;  3C1B D;  4J8W C;  2Y2J A;  2F8N H;  3W96 D;  2ZY2 A;  3W98 C;  5CPI D;  5B31 B;  4YM6 B;  3REI D;  3TU4 C;  5KDM B;  5JRG B;  3X1T A;  4J8X A;  5AVB D;  4LD9 C;  5AV8 D;  3AZM C;  4M6B A;  3O62 D;  5AV9 C;  1P3B D;  5DNM B;  4YS3 A;  4J8V B;  1P3F A;  4DRB A;  3EPJ A;  4EO5 C;  1JFI A;  4NE5 A;  5AV6 D;  1T3U A;  4XZQ D;  4KHA B;  4QLC D;  5B33 B;  1P3A D;  1P3M D;  5B1L A;  5CPK D;  5B1M D;  2YFW B;  1KX4 B;  3WKJ A;  5AY8 C;  3EPL A;  5GT3 B;  4G92 B;  1B6W A;  3A6N B;  3KWQ B;  1M19 B;  1HQ3 B;  4XUJ D;  5B31 C;  4YM6 C;  2G5H C;  1P34 B;  4J8X D;  3MGS B;  3W97 B;  5B40 A;  4KGC B;  5B0Y A;  2NQB A;  2UWX A;  3MVD A;  2RVQ C;  4H9P A;  3LZ1 B;  1P3F D;  3C1B B;  3W96 B;  5B2I D;  5DNM C;  3AZM A;  4J8V C;  5CPI B;  3REI B;  1ZLA A;  5B1L D;  5B33 C;  3WKJ D;  4E45 A;  5AVB B;  3EPH A;  1KX4 C;  4CSR A;  5GT3 C;  5AV8 B;  2FFF B;  5AY8 A;  4G92 C;  3KWQ C;  3A6N C;  1P3B B;  1ULY A;  1M19 C;  3WTP E;  3LEL B;  1P3G A;  1HQ3 C;  1HTA A;  5B40 D;  5B24 A;  1Q9C A;  5AV6 B;  4JJN A;  4XZQ B;  5B31 A;  4YM6 A;  3W97 C;  3MGS C;  2NQB D;  5BS7 A;  3AFA A;  4KGC C;  1P3A B;  1P3M B;  3MVD D;  1P3I D;  5CPK B;  5B1M B;  5JRG A;  1W2E A;  3LZ1 C;  3W96 C;  3C1B C;  2F2A C;  1TAF A;  5CPI C;  1P3L D;  4XUJ B;  3X1U A;  2PYO A;  3REI C;  4Z2M H;  4HGA B;  1WWI A;  3V9R A;  4J8X B;  5AV5 A;  4KHA A;  5AVB C;  3AV1 D;  2LY8 A;  2ZM5 A;  4J8U D;  5AV8 C;  1P3F B;  1KX4 A;  4H9S C;  5FUG B;  1P3G D;  3REJ A;  5B2I B;  1P3B C;  4NE6 A;  3VH6 T;  1JFI B;  5B24 D;  3LEL C;  3B6G A;  3VH6 A;  4X23 A;  3AFA D;  5AV6 C;  5B1L B;  4XZQ C;  5AVC A;  3REK D;  3AYW A;  1P34 A;  1P3A C;  1P3M C;  3WKJ B;  3MGS A;  5CPK C;  5B1M C;  4KGC A;  4DQY B;  2XD1 A;  4H9Q B;  3X1U D;  3C1B A;  2PYO D;  5BO0 B;  3REL D;  4XUJ C;  5B40 B;  2Y2L A;  5AV5 D;  2Y2M A;  4HGA C;  4Z66 D;  2DF4 C;  4E44 A;  5B0Y B;  5CPI A;  4J8X C;  2NQB B;  4Z5T D;  3AZF D;  3MVD B;  1P3I B;  4H9P B;  3EG5 B;  3REJ D;  5AVB A;  1P3F C;  3X1V A;  3B6G D;  5G49 A;  5B2I C;  4X23 D;  5AV8 A;  3KSY A;  1ZLA B;  3O62 A;  5AVC D;  1KX3 D;  1P3B A;  1P3L B;  3B0B A;  3AYW D;  3WTP D;  3IP4 C;  5B1L C;  3LZ0 A;  5GSU D;  4NE3 A;  3WA9 D;  5AV6 A;  3WKJ C;  2BG1 A;  3X1S A;  4CSR B;  4QLC A;  1P3A A;  5CPJ D;  3B0C W;  3AV1 B;  1H3O B;  1P3G B;  5B24 B;  4JJN B;  3AFA B;  5B40 C;  4XUJ A;  5B0Y C;  3REK B;  2NQB C;  1Z2C B;  2JE5 A;  3MVD C;  1P3I C;  4CAY B;  3X1V D;  4UPK A;  4WU8 A;  1TAF B;  3X1U B;  2PYO B;  5FUG A;  1ZLA C;  5B2I A;  3REL B;  3AZG A;  2ARO A;  2RIQ A;  1B67 A;  3LZ0 D;  3V9R B;  1P3L C;  1ID3 D;  5AV5 B;  3X1S D;  5DNN A;  3REH A;  4Z5T B;  3AZK A;  3AV1 C;  3MNN D;  2Y2P A;  3REJ B;  1AOI A;  3AN2 A;  4H9N A;  1P3G C;  3B6G B;  4X23 B;  3AV2 A;  4H9Q A;  5B24 C;  3C1C D;  2HUE B;  5AVC B;  4JJN C;  1KX3 B;  5BO0 A;  3AYW B;  5BS7 C;  3AFA C;  3WTP B;  5E5A A;  2BYK B;  3REK C;  3EPK A;  3WA9 B;  5JRG C;  1F66 A;  4WU8 D;  5B2J D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...