5B24C

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24C00
3W98A 5B33C 5CPKD 4J8WD 4YS3A 1P3BD 1P3MA 1F66C 5B40D 3REHB 2NQBA 3A6ND 2YFVA 5BT1C 4ZUXB 4H9NA 4ZBJB 3B6FA 3X1SC 5GXQC 1H3OB 3W97C 4Z66B 3AZGA 1AOIC 1P34D 1ID3B 1HQ3A 2LY8A 5B0ZD 1P3LC 3WKJA 3RELD 2IO5B 5GT0B 1KX3A 4X23B 4Z2MH 2HIOA 4XZQD 4G92B 1S32B 3WA9B 5CPJD 3AZNA 3B6GD 3X1VD 4KHAB 5DNNC 5AY8D 4QLCA 3MVDD 5KDMA 5AV5D 3C1CC 2HUEC 5BNXB 4J8UA 4WU9B 4EO5C 1M18B 1P3IC 3KUYC 4R8PB 2CV5B 3MGSB 3AZMB 1P3FD 5B1MC 2NZDA 4WU8B 5B31A 5B24D 3AV2B 1A7WA 5CP6B 1U35A 3AN2C 3NQUA 1ULYA 5AV9B 3AV1C 3AZLB 4J8VA 3MGRB 3LZ1C 5DNMB 1AOIA 1KX5B 5JRGD 4Z5TC 1P3LA 1B6WA 5B1LD 4KUDA 5B32G 2JSSA 1Q9CA 1P3AA 3W98D 4CAYA 3W97B 4YS3D 3X1UC 4E44A 4LD9D 4H9PA 3WAAC 1P3GB 3C1CA 3UTAC 3B6FD 4H9RB 3MVDC 5B0YC 1S32D 3C1BC 3REKB 3KUYA 3REJA 1P3IA 5GSUA 5E5AB 5B1MA 5F99B 3AZHC 4WNNA 3KWQB 2FJ7C 1P3BA 3WTPB 5B40A 4XUJC 3LELB 3AYWC 1P3OC 3AN2A 3WTPE 5B31G 1M18D 2AROB 4R8PD 3AV1A 3AZMD 3LJAC 2HIOD 1TAFB 4WU8D 5AV8B 5CP6D 3MGQD 3REHC 1P34A 3X1TD 4ZUXC 4ZBJC 5B0ZA 3RELA 4JJND 4Z66C 5B33D 3X1UA 1B67A 5CPJA 1ID3C 1F66D 3O62B 3B6GA 3X1VA 3WAAA 5BT1D 1BH8A 2IO5C 4Z2MG 3X1SD 5GXQD 5B0YA 5AV5A 3MVDA 3W97D 5GT0C 4X23C 4G92C 1S32C 3WA9C 4H9OA 1AOID 3AZHA 4J8XB 2FJ7A 1P3LD 4XUJA 2F8NB 5BNVA 4WU9C 4HGAB 1M18C 5E5AD 4R8PC 3MNNB 2CV5C 1KU5A 3MGSC 3AZMC 5DNND 3AZEB 3KXBB 3LELD 3TU4B 3AV2C 3VH5T 1BFMA 5CP6C 3C1CD 5JRGA 2AROD 2F8NK 3VH6T 5B1LA 5AV9C 3AZLC 1P3ID 3KUYD 5AV8D 3REIB 1BH9B 3B0DB 3MGRC 3AZKB 5B1MD 5DNMC 1KX5C 1ID3A 3AZJB 4LD9A 3AN2D 3AV1D 5AVBB 5GT0A 5G49B 4H9SC 3WA9A 1S32A 5B2IC 2PYOB 5B2JB 3LZ1D 4KHAA 4KGCB 4Z5TD 3MGPB 4JJNC 3UT9B 1P3GC 3B0CT 1M18A 3REKC 4YM6B 4R8PA 3AZMA 3X1UD 5E5AC 5F99C 4WU8A 3KWQC 3WAAD 1M1AB 2BYKB 3AV2A 5CP6A 3WTPC 3MGQA 3LELC 3UTAD 3X1TA 5B0YD 3B0BA 2AROC 3W96B 3C1BD 5AVCB 4CSRB 4JJNA 5AV8C 5B33A 5DNMA 3TU4D 3AZHD 2FJ7D 4XUJD 3AYWD 1P3OD 1F66A 2YFVB 3R45A 3LZ0B 4H9NB 5C3IB 3X1SA 3LJAD 5GXQA 3V9RA 4H9SA 3W97A 3AZJD 3O62C 3REHD 3AZGB 3AZIB 5CPIB 1HQ3B 5B32B 1P3GA 4ZUXD 4H9RA 3AZFB 3WKJB 3AFAB 4Z66D 5E5AA 5B2IB 1ID3D 4J8XC 5DNNA 1TZYB 5JA4B 4QLCB 3WTPA 3LELA 5BS7C 5KDMB 2AROA 5GT0D 1JFIB 4HGAC 4X23D 5AV6B 3WA9D 1TAFA 3MNNC 2BYMA 2L5AA 5AV8A 5GT3B 3AZEC 3KXBC 1P3PB 2NZDB 3TU4C 5B31B 4WU9D 1U35B 4DRAA 4NE5A 4WZSB 3REIC 1M19B 2CV5D 3MGSD 3B0DC 4J8VB 3AZKC 4M6BA 3VH5A 3LZ1A 3VH6A 3AZJC 3AV2D 3LZ0D 4Z5TA 4H9QB 4KUDB 5AV9D 5AVBC 3AZLD 1P3AB 3MGRD 2PYOC 5DNMD 5B2JC 1KX5D 3W99B 4KGCC 5FUGB 3MGPC 3AZFD 3NQJB 4H9PB 3UT9C 2F8NA 5CHLB 3UTAA 4NE6A 4YM6C 3MNNA 5B2ID 1P3KB 3C1BA 3REJB 5GSUB 3KXBA 3TU4A 1M1AC 3UTBB 2CWEA 4J8WB 5CPKB 1P3GD 1KX4B 1P3BB 4UUZA 3AYWA 5B40B 1P3OA 3VH5W 5AV6D 3W96C 3A6NB 3REKD 3VH6W 5AVCC 3REIA 1WWIA 1BH9A 3LJAA 1P3PD 5F99D 1N1JB 3KWQD 1P3MC 3AZJA 3WTPD 3REHA 3LZ0C 4ZUXA 5B0ZB 5G49A 5C3IC 3RELB 1H3OA 4Z66A 5B2JA 3AZGC 4XZQB 3AZIC 5CPJB 1R4VA 3MGPA 5CPIC 1HQ3C 5B32C 3X1VB 3B6GB 5AY8B 3AZFC 3WKJC 1BH8B 3AFAC 4WV4B 3B0CW 5AV5B 4YM6A 5BO0B 3W99D 4X23A 3KSYA 3O62D 1TZYC 1P3FB 2BYKA 4QLCC 3W96A 5B24B 1ZLAB 5BNVB 1P3KD 5BNXA 4WU9A 5AVCA 5AV6C 2CV5A 5GT3C 3MGSA 4J8XD 3UTBD 1KX4D 1P3PC 2NZDC 2F8ND 2YFWB 5B31C 5JRGB 3LZ0A 1U35C 1EQZB 5B1LB 1M19C 5AV9A 3MNND 3AZLA 4J8VC 3AZED 3KXBD 3MGRA 3W98B 3AZIA 1KX5A 4YS3B 4AWLB 5B32A 5CPIA 1P3MB 3AZFA 4LD9B 4KUDC 4G91B 2NQBB 3AFAA 3REID 2RVQC 3B6FB 1P3AC 3AZKD 5B2IA 3W99C 1TZYA 5JA4A 4E45A 5AVBD 1JFIA 5AV6A 1P3KC 2PYOD 3REKA 5B2JD 3REJC 1KX3B 5GSUC 5GT3A 4KGCD 2HIOB 2F8NH 1P3PA 5F99A 3MGPD 3AZNB 3UTBC 3KWQA 4J8WC 5CPKC 3UT9D 1KX4C 1P3BC 1ZLAD 3MGQB 5B40C 3X1TB 3A6NC 4YM6D 1M19A 4J8UB 4JJNB 5B33B 1M1AD 1P34C 1EQZD 4H9QA 1F66B 3W96D 5B0ZC 3R45B 5AVCD 3RELC 3NQUB 3X1SB 5GXQB 3V9RB 3W99A 4XZQC 1P3MD 5FUGA 5CPJC 3O62A 3B6GC 3NQJA 3X1VC 1AOIB 2NQBD 5AY8C 1P3LB 5AV5C 1P3KA 4CAYB 3AZGD 3AZID 5CPID 1HQ3D 5B32D 4J8WA 5DNNB 4J8XA 3UTBA 5CPKA 1P3FC 1KX4A 4NFTA 3WKJD 3AFAD 5BS7A 5B24C 1ZLAC 3A6NA 3C1CB 2HUEB 1KX3D 4EO5B 2BYMB 3AZND 1N1JA 3KUYB 1P3IB 1TZYD 3AZEA 4QLCD 5B1MB 4WNNB 5JRGC 4DRBA 1EQZC 4NE3A 4J8UD 5B1LC 3AN2B 3AV1B 5GT3D 3AZKA 3W98C 4XZQA 2NZDD 4YS3C 4AWLC 3LZ1B 5B31D 5AY8A 1U35D 4Z5TB 4G91C 1P34B 4LD9C 2NQBC 1M19D 3B6FC 5AVBA 5BO0A 4J8VD 2PYOA 1F1EA 1P3FA 4KGCA 3X1UB 4KUDD 3UT9A 3WAAB 5B24A 1ZLAA 1HTAA 2RVQD 3UTAB 1P3AD 2F8NG 3MVDB 5B0YB 1KX3C 3C1BB 2HIOC 4H9OB 3AZNC 4WU8C 3AZHB 1M1AA 2YFWA 2FJ7B 3MGQC 4UUZB 3X1TC 4XUJB 3AYWB 1P3OB 1WWSA 1EQZA 4J8UC 3REJD 4CSRA 5GSUD 3LJAB
chains in the Genus database with same CATH superfamily
3W98A 5B33C 5CPKD 4J8WD 4YS3A 1P3BD 1P3MA 1F66C 5B40D 3REHB 2NQBA 3A6ND 2YFVA 5BT1C 4ZUXB 4H9NA 4ZBJB 3B6FA 3X1SC 5GXQC 1H3OB 3W97C 4Z66B 2ZY5A 1Z2CB 3AZGA 1AOIC 1P34D 1ID3B 1HQ3A 2LY8A 5B0ZD 1P3LC 3WKJA 3RELD 2IO5B 2Y2IA 5GT0B 1KX3A 4X23B 4Z2MH 2HIOA 4XZQD 4G92B 1S32B 3WA9B 2Y2KA 5CPJD 3AZNA 3B6GD 3X1VD 4KHAB 5DNNC 5AY8D 4QLCA 3MVDD 5KDMA 5AV5D 3C1CC 2HUEC 3IP4C 2ZM5A 5BNXB 4J8UA 4WU9B 4EO5C 1M18B 1P3IC 3KUYC 4R8PB 2CV5B 3MGSB 3AZMB 1P3FD 5B1MC 2NZDA 4WU8B 5B31A 5B24D 3AV2B 1A7WA 5CP6B 1U35A 3A1IA 3AN2C 3NQUA 1ULYA 5AV9B 3AV1C 3AZLB 4J8VA 3MGRB 3LZ1C 5DNMB 1AOIA 1KX5B 2Y2QA 5JRGD 4Z5TC 1P3LA 1B6WA 5B1LD 4KUDA 5B32G 2JSSA 1Q9CA 1P3AA 3W98D 4CAYA 3W97B 4YS3D 3X1UC 4E44A 4LD9D 4H9PA 3WAAC 3EPLA 1P3GB 3C1CA 3UTAC 3B6FD 4H9RB 3MVDC 5B0YC 1S32D 3C1BC 3REKB 3KUYA 3REJA 1P3IA 5GSUA 5E5AB 5B1MA 5F99B 3AZHC 4WNNA 3KWQB 2FJ7C 2ZY4A 1P3BA 3EPKA 3WTPB 5B40A 4XUJC 3LELB 1PZRA 3AYWC 1P3OC 3AN2A 3WTPE 5B31G 1M18D 2AROB 4R8PD 3AV1A 3AZMD 3LJAC 2HIOD 1TAFB 4WU8D 5AV8B 5CP6D 3MGQD 3REHC 1P34A 3X1TD 4ZUXC 2JE5A 4ZBJC 5B0ZA 3RELA 4JJND 4Z66C 5B33D 3X1UA 1B67A 5CPJA 1ID3C 1F66D 3O62B 3B6GA 3X1VA 3WAAA 5BT1D 1BH8A 2IO5C 4Z2MG 3X1SD 5GXQD 5AV5A 5B0YA 3MVDA 3W97D 5GT0C 4X23C 4G92C 1S32C 3WA9C 4H9OA 2Y2GA 1AOID 3AZHA 4J8XB 2FJ7A 1P3LD 4DQYB 4XUJA 2F8NB 5BNVA 4WU9C 2Y2PA 4HGAB 1M18C 5E5AD 4R8PC 3MNNB 2CV5C 1KU5A 3MGSC 3AZMC 5DNND 2DF4C 3AZEB 3KXBB 3LELD 3TU4B 3AV2C 3VH5T 1BFMA 5CP6C 3C1CD 5JRGA 2AROD 2F8NK 3VH6T 5B1LA 5AV9C 3AZLC 1P3ID 3KUYD 5AV8D 3REIB 1BH9B 3B0DB 3MGRC 3AZKB 2XD5A 5B1MD 5DNMC 1KX5C 1ID3A 3AZJB 4LD9A 3P5JB 3AN2D 3AV1D 5AVBB 2UWXA 5G49B 5GT0A 4H9SC 3WA9A 1S32A 5B2IC 2PYOB 2Y2NA 5B2JB 3LZ1D 4KHAA 2FFFB 4KGCB 4Z5TD 3MGPB 4JJNC 3UT9B 1P3GC 3B0CT 1M18A 3REKC 4WJ3C 4YM6B 4R8PA 3AZMA 2Y2OA 5E5AC 3X1UD 5F99C 4WU8A 3KWQC 3WAAD 1M1AB 2BYKB 3AV2A 5CP6A 3WTPC 3MGQA 3LELC 3UTAD 3X1TA 5B0YD 3B0BA 2AROC 3W96B 3AL0C 3C1BD 5AVCB 4CSRB 4JJNA 5AV8C 5B33A 5DNMA 3TU4D 3AZHD 2FJ7D 4XUJD 3AYWD 1P3OD 1F66A 2YFVB 3R45A 3LZ0B 4H9NB 5C3IB 3X1SA 3LJAD 5GXQA 3V9RA 4H9SA 3W97A 3AZJD 3O62C 3REHD 3AZGB 3AZIB 5CPIB 1HQ3B 5B32B 1P3GA 4ZUXD 4H9RA 3AZFB 3WKJB 3AFAB 4Z66D 5E5AA 5B2IB 1ID3D 4J8XC 5DNNA 1TZYB 5JA4B 4QLCB 1T3UA 3WTPA 3LELA 5BS7C 5KDMB 2AROA 5GT0D 1JFIB 4HGAC 4X23D 5AV6B 3WA9D 1TAFA 3MNNC 2BYMA 2L5AA 3A1KA 5AV8A 5GT3B 3AZEC 3KXBC 1P3PB 2NZDB 3TU4C 5B31B 4WU9D 1U35B 4DRAA 4NE5A 4WZSB 3REIC 1M19B 2CV5D 3MGSD 3B0DC 4J8VB 3AZKC 4M6BA 3VH5A 3LZ1A 3VH6A 3AZJC 3AV2D 3LZ0D 2G5IC 4Z5TA 4H9QB 4KUDB 5AV9D 5AVBC 3AZLD 1P3AB 3MGRD 2PYOC 5DNMD 5B2JC 4UPKA 1KX5D 3W99B 2F2AC 4KGCC 5FUGB 3MGPC 3AZFD 2Y2JA 3NQJB 4H9PB 3UT9C 2F8NA 3EG5B 5CHLB 3UTAA 4NE6A 4YM6C 3MNNA 5B2ID 1P3KB 3C1BA 3REJB 5GSUB 3KXBA 3TU4A 1M1AC 3UTBB 2CWEA 4J8WB 5CPKB 1P3GD 1KX4B 1P3BB 4UUZA 3AYWA 5B40B 1P3OA 3VH5W 5AV6D 3W96C 3A6NB 3REKD 3VH6W 5AVCC 3REIA 1WWIA 1BH9A 3LJAA 1P3PD 2W8SA 5F99D 1N1JB 3KWQD 1P3MC 3AZJA 3WTPD 3REHA 3LZ0C 4ZUXA 5B0ZB 5G49A 5C3IC 3RELB 2J8PA 1H3OA 4Z66A 5B2JA 3AZGC 4XZQB 3AZIC 5CPJB 1R4VA 3MGPA 5CPIC 1HQ3C 3H0RC 5B32C 3X1VB 3B6GB 5AY8B 3AZFC 3WKJC 1BH8B 3EPHA 3AFAC 4WV4B 3B0CW 5AV5B 4YM6A 5BO0B 3W99D 4X23A 3KSYA 3O62D 1TZYC 1P3FB 2BYKA 4QLCC 2Y2LA 3W96A 5B24B 1ZLAB 5BNVB 1P3KD 5BNXA 4WU9A 5AVCA 5AV6C 3EPJA 2CV5A 5GT3C 3MGSA 4J8XD 3UTBD 1KX4D 1P3PC 2RIQA 2NZDC 2F8ND 2YFWB 5B31C 5JRGB 3LZ0A 1U35C 1EQZB 5B1LB 1M19C 5AV9A 3MNND 3AZLA 4J8VC 3AZED 3KXBD 3MGRA 3W98B 3AZIA 1KX5A 4YS3B 4AWLB 5B32A 5CPIA 1P3MB 3AZFA 4LD9B 4KUDC 4G91B 2NQBB 3AFAA 3REID 2RVQC 3B6FB 1P3AC 3AZKD 5B2IA 3W99C 2XD1A 1TZYA 5JA4A 4E45A 3H0LC 5AVBD 1JFIA 5AV6A 1P3KC 2PYOD 3REKA 5B2JD 3REJC 1KX3B 5GSUC 5GT3A 4KGCD 2HIOB 2F8NH 1P3PA 5F99A 3MGPD 3AZNB 3UTBC 3KWQA 4J8WC 5CPKC 3UT9D 1KX4C 1P3BC 1ZLAD 2ZY2A 3MGQB 5B40C 3X1TB 3A6NC 4YM6D 1M19A 4J8UB 4JJNB 5B33B 1M1AD 1P34C 1EQZD 4H9QA 1F66B 3W96D 5B0ZC 3R45B 5AVCD 3RELC 3H0MC 3NQUB 3X1SB 5GXQB 3V9RB 3W99A 1W2EA 4XZQC 1P3MD 5FUGA 5CPJC 3O62A 3B6GC 3NQJA 3X1VC 1AOIB 2NQBD 5AY8C 2Y2HA 2JCHA 1P3LB 5AV5C 2Y2MA 1P3KA 2DQNC 4CAYB 3AZGD 3AZID 5CPID 1HQ3D 5B32D 4J8WA 5DNNB 4J8XA 3UTBA 5CPKA 1P3FC 1KX4A 4NFTA 3WKJD 3AFAD 5BS7A 5B24C 1ZLAC 3A6NA 3C1CB 2HUEB 1KX3D 4EO5B 2BYMB 3AZND 1N1JA 3KUYB 1P3IB 1TZYD 3AZEA 4QLCD 5B1MB 4WNNB 5JRGC 3KFUG 4DRBA 1EQZC 4NE3A 4J8UD 5B1LC 3AN2B 3AV1B 5GT3D 3AZKA 3W98C 4XZQA 2NZDD 4YS3C 4AWLC 3LZ1B 5B31D 5AY8A 1U35D 4Z5TB 4G91C 1P34B 4LD9C 2NQBC 2ZY3A 1M19D 3B6FC 5AVBA 5BO0A 4J8VD 2PYOA 1F1EA 1P3FA 4KGCA 3X1UB 2VQRA 3FDDA 4KUDD 3UT9A 3WAAB 5B24A 1ZLAA 1HTAA 2RVQD 3UTAB 2BG1A 1P3AD 2F8NG 3MVDB 5B0YB 2G5HC 1KX3C 3C1BB 2HIOC 4H9OB 3AZNC 4WU8C 3AZHB 1M1AA 2YFWA 2FJ7B 3MGQC 4UUZB 3X1TC 4XUJB 3AYWB 1P3OB 1WWSA 1EQZA 3F6TA 4J8UC 3REJD 4CSRA 5GSUD 3LJAB
chains in the Genus database with same CATH topology
3W98A 5B33C 5CPKD 4J8WD 4YS3A 1P3BD 1P3MA 1F66C 5B40D 3REHB 2NQBA 3A6ND 2YFVA 5BT1C 4ZUXB 4H9NA 4ZBJB 3B6FA 3X1SC 5GXQC 1H3OB 3W97C 4Z66B 2ZY5A 1Z2CB 3AZGA 1AOIC 1P34D 1ID3B 1HQ3A 2LY8A 5B0ZD 1P3LC 3WKJA 3RELD 2IO5B 2Y2IA 5GT0B 1KX3A 4X23B 4Z2MH 2HIOA 4XZQD 4G92B 1S32B 3WA9B 2Y2KA 5CPJD 3AZNA 3B6GD 3X1VD 4KHAB 5DNNC 5AY8D 4QLCA 3MVDD 5KDMA 5AV5D 3C1CC 2HUEC 3IP4C 2ZM5A 5BNXB 4J8UA 4WU9B 4EO5C 1M18B 1P3IC 3KUYC 4R8PB 2CV5B 3MGSB 3AZMB 1P3FD 5B1MC 2NZDA 4WU8B 5B31A 5B24D 3AV2B 1A7WA 5CP6B 1U35A 3A1IA 3AN2C 3NQUA 1ULYA 5AV9B 3AV1C 3AZLB 4J8VA 3MGRB 3LZ1C 5DNMB 1AOIA 1KX5B 2Y2QA 5JRGD 4Z5TC 1P3LA 1B6WA 5B1LD 4KUDA 5B32G 2JSSA 1Q9CA 1P3AA 3W98D 4CAYA 3W97B 4YS3D 3X1UC 4E44A 4LD9D 4H9PA 3WAAC 3EPLA 1P3GB 3C1CA 3UTAC 3B6FD 4H9RB 3MVDC 5B0YC 1S32D 3C1BC 3REKB 3KUYA 3REJA 1P3IA 5GSUA 5E5AB 5B1MA 5F99B 3AZHC 4WNNA 3KWQB 2FJ7C 2ZY4A 1P3BA 3EPKA 3WTPB 5B40A 4XUJC 3LELB 1PZRA 3AYWC 1P3OC 3AN2A 3WTPE 5B31G 1M18D 2AROB 4R8PD 3AV1A 3AZMD 3LJAC 2HIOD 1TAFB 4WU8D 5AV8B 5CP6D 3MGQD 3REHC 1P34A 3X1TD 4ZUXC 2JE5A 4ZBJC 5B0ZA 3RELA 4JJND 4Z66C 5B33D 3X1UA 1B67A 5CPJA 1ID3C 1F66D 3O62B 3B6GA 3X1VA 3WAAA 5BT1D 1BH8A 2IO5C 4Z2MG 3X1SD 5GXQD 5AV5A 5B0YA 3MVDA 3W97D 5GT0C 4X23C 4G92C 1S32C 3WA9C 4H9OA 2Y2GA 1AOID 3AZHA 4J8XB 2FJ7A 1P3LD 4DQYB 4XUJA 2F8NB 5BNVA 4WU9C 2Y2PA 4HGAB 1M18C 5E5AD 4R8PC 3MNNB 2CV5C 1KU5A 3MGSC 3AZMC 5DNND 2DF4C 3AZEB 3KXBB 3LELD 3TU4B 3AV2C 3VH5T 1BFMA 5CP6C 3C1CD 5JRGA 2AROD 2F8NK 3VH6T 5B1LA 5AV9C 3AZLC 1P3ID 3KUYD 5AV8D 3REIB 1BH9B 3B0DB 3MGRC 3AZKB 2XD5A 5B1MD 5DNMC 1KX5C 1ID3A 3AZJB 4LD9A 3P5JB 3AN2D 3AV1D 5AVBB 2UWXA 5G49B 5GT0A 4H9SC 3WA9A 1S32A 5B2IC 2PYOB 2Y2NA 5B2JB 3LZ1D 4KHAA 2FFFB 4KGCB 4Z5TD 3MGPB 4JJNC 3UT9B 1P3GC 3B0CT 1M18A 3REKC 4WJ3C 4YM6B 4R8PA 3AZMA 2Y2OA 5E5AC 3X1UD 5F99C 4WU8A 3KWQC 3WAAD 1M1AB 2BYKB 3AV2A 5CP6A 3WTPC 3MGQA 3LELC 3UTAD 3X1TA 5B0YD 3B0BA 2AROC 3W96B 3AL0C 3C1BD 5AVCB 4CSRB 4JJNA 5AV8C 5B33A 5DNMA 3TU4D 3AZHD 2FJ7D 4XUJD 3AYWD 1P3OD 1F66A 2YFVB 3R45A 3LZ0B 4H9NB 5C3IB 3X1SA 3LJAD 5GXQA 3V9RA 4H9SA 3W97A 3AZJD 3O62C 3REHD 3AZGB 3AZIB 5CPIB 1HQ3B 5B32B 1P3GA 4ZUXD 4H9RA 3AZFB 3WKJB 3AFAB 4Z66D 5E5AA 5B2IB 1ID3D 4J8XC 5DNNA 1TZYB 5JA4B 4QLCB 1T3UA 3WTPA 3LELA 5BS7C 5KDMB 2AROA 5GT0D 1JFIB 4HGAC 4X23D 5AV6B 3WA9D 1TAFA 3MNNC 2BYMA 2L5AA 3A1KA 5AV8A 5GT3B 3AZEC 3KXBC 1P3PB 2NZDB 3TU4C 5B31B 4WU9D 1U35B 4DRAA 4NE5A 4WZSB 3REIC 1M19B 2CV5D 3MGSD 3B0DC 4J8VB 3AZKC 4M6BA 3VH5A 3LZ1A 3VH6A 3AZJC 3AV2D 3LZ0D 2G5IC 4Z5TA 4H9QB 4KUDB 5AV9D 5AVBC 3AZLD 1P3AB 3MGRD 2PYOC 5DNMD 5B2JC 4UPKA 1KX5D 3W99B 2F2AC 4KGCC 5FUGB 3MGPC 3AZFD 2Y2JA 3NQJB 4H9PB 3UT9C 2F8NA 3EG5B 5CHLB 3UTAA 4NE6A 4YM6C 3MNNA 5B2ID 1P3KB 3C1BA 3REJB 5GSUB 3KXBA 3TU4A 1M1AC 3UTBB 2CWEA 4J8WB 5CPKB 1P3GD 1KX4B 1P3BB 4UUZA 3AYWA 5B40B 1P3OA 3VH5W 5AV6D 3W96C 3A6NB 3REKD 3VH6W 5AVCC 3REIA 1WWIA 1BH9A 3LJAA 1P3PD 2W8SA 5F99D 1N1JB 3KWQD 1P3MC 3AZJA 3WTPD 3REHA 3LZ0C 4ZUXA 5B0ZB 5G49A 5C3IC 3RELB 2J8PA 1H3OA 4Z66A 5B2JA 3AZGC 4XZQB 3AZIC 5CPJB 1R4VA 3MGPA 5CPIC 1HQ3C 3H0RC 5B32C 3X1VB 3B6GB 5AY8B 3AZFC 3WKJC 1BH8B 3EPHA 3AFAC 4WV4B 3B0CW 5AV5B 4YM6A 5BO0B 3W99D 4X23A 3KSYA 3O62D 1TZYC 1P3FB 2BYKA 4QLCC 2Y2LA 3W96A 5B24B 1ZLAB 5BNVB 1P3KD 5BNXA 4WU9A 5AVCA 5AV6C 3EPJA 2CV5A 5GT3C 3MGSA 4J8XD 3UTBD 1KX4D 1P3PC 2RIQA 2NZDC 2F8ND 2YFWB 5B31C 5JRGB 3LZ0A 1U35C 1EQZB 5B1LB 1M19C 5AV9A 3MNND 3AZLA 4J8VC 3AZED 3KXBD 3MGRA 3W98B 3AZIA 1KX5A 4YS3B 4AWLB 5B32A 5CPIA 1P3MB 3AZFA 4LD9B 4KUDC 4G91B 2NQBB 3AFAA 3REID 2RVQC 3B6FB 1P3AC 3AZKD 5B2IA 3W99C 2XD1A 1TZYA 5JA4A 4E45A 3H0LC 5AVBD 1JFIA 5AV6A 1P3KC 2PYOD 3REKA 5B2JD 3REJC 1KX3B 5GSUC 5GT3A 4KGCD 2HIOB 2F8NH 1P3PA 5F99A 3MGPD 3AZNB 3UTBC 3KWQA 4J8WC 5CPKC 3UT9D 1KX4C 1P3BC 1ZLAD 2ZY2A 3MGQB 5B40C 3X1TB 3A6NC 4YM6D 1M19A 4J8UB 4JJNB 5B33B 1M1AD 1P34C 1EQZD 4H9QA 1F66B 3W96D 5B0ZC 3R45B 5AVCD 3RELC 3H0MC 3NQUB 3X1SB 5GXQB 3V9RB 3W99A 1W2EA 4XZQC 1P3MD 5FUGA 5CPJC 3O62A 3B6GC 3NQJA 3X1VC 1AOIB 2NQBD 5AY8C 2Y2HA 2JCHA 1P3LB 5AV5C 2Y2MA 1P3KA 2DQNC 4CAYB 3AZGD 3AZID 5CPID 1HQ3D 5B32D 4J8WA 5DNNB 4J8XA 3UTBA 5CPKA 1P3FC 1KX4A 4NFTA 3WKJD 3AFAD 5BS7A 5B24C 1ZLAC 3A6NA 3C1CB 2HUEB 1KX3D 4EO5B 2BYMB 3AZND 1N1JA 3KUYB 1P3IB 1TZYD 3AZEA 4QLCD 5B1MB 4WNNB 5JRGC 3KFUG 4DRBA 1EQZC 4NE3A 4J8UD 5B1LC 3AN2B 3AV1B 5GT3D 3AZKA 3W98C 4XZQA 2NZDD 4YS3C 4AWLC 3LZ1B 5B31D 5AY8A 1U35D 4Z5TB 4G91C 1P34B 4LD9C 2NQBC 2ZY3A 1M19D 3B6FC 5AVBA 5BO0A 4J8VD 2PYOA 1F1EA 1P3FA 4KGCA 3X1UB 2VQRA 3FDDA 4KUDD 3UT9A 3WAAB 5B24A 1ZLAA 1HTAA 2RVQD 3UTAB 2BG1A 1P3AD 2F8NG 3MVDB 5B0YB 2G5HC 1KX3C 3C1BB 2HIOC 4H9OB 3AZNC 4WU8C 3AZHB 1M1AA 2YFWA 2FJ7B 3MGQC 4UUZB 3X1TC 4XUJB 3AYWB 1P3OB 1WWSA 1EQZA 3F6TA 4J8UC 3REJD 4CSRA 5GSUD 3LJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 A;  5B33 C;  5CPK D;  4J8W D;  4YS3 A;  1P3B D;  1P3M A;  1F66 C;  5B40 D;  3REH B;  2NQB A;  3A6N D;  2YFV A;  5BT1 C;  4ZUX B;  4H9N A;  4ZBJ B;  3B6F A;  3X1S C;  5GXQ C;  1H3O B;  3W97 C;  4Z66 B;  3AZG A;  1AOI C;  1P34 D;  1ID3 B;  1HQ3 A;  2LY8 A;  5B0Z D;  1P3L C;  3WKJ A;  3REL D;  2IO5 B;  5GT0 B;  1KX3 A;  4X23 B;  4Z2M H;  2HIO A;  4XZQ D;  4G92 B;  1S32 B;  3WA9 B;  5CPJ D;  3AZN A;  3B6G D;  3X1V D;  4KHA B;  5DNN C;  5AY8 D;  4QLC A;  3MVD D;  5KDM A;  5AV5 D;  3C1C C;  2HUE C;  5BNX B;  4J8U A;  4WU9 B;  4EO5 C;  1M18 B;  1P3I C;  3KUY C;  4R8P B;  2CV5 B;  3MGS B;  3AZM B;  1P3F D;  5B1M C;  2NZD A;  4WU8 B;  5B31 A;  5B24 D;  3AV2 B;  1A7W A;  5CP6 B;  1U35 A;  3AN2 C;  3NQU A;  1ULY A;  5AV9 B;  3AV1 C;  3AZL B;  4J8V A;  3MGR B;  3LZ1 C;  5DNM B;  1AOI A;  1KX5 B;  5JRG D;  4Z5T C;  1P3L A;  1B6W A;  5B1L D;  4KUD A;  5B32 G;  2JSS A;  1Q9C A;  1P3A A;  3W98 D;  4CAY A;  3W97 B;  4YS3 D;  3X1U C;  4E44 A;  4LD9 D;  4H9P A;  3WAA C;  1P3G B;  3C1C A;  3UTA C;  3B6F D;  4H9R B;  3MVD C;  5B0Y C;  1S32 D;  3C1B C;  3REK B;  3KUY A;  3REJ A;  1P3I A;  5GSU A;  5E5A B;  5B1M A;  5F99 B;  3AZH C;  4WNN A;  3KWQ B;  2FJ7 C;  1P3B A;  3WTP B;  5B40 A;  4XUJ C;  3LEL B;  3AYW C;  1P3O C;  3AN2 A;  3WTP E;  5B31 G;  1M18 D;  2ARO B;  4R8P D;  3AV1 A;  3AZM D;  3LJA C;  2HIO D;  1TAF B;  4WU8 D;  5AV8 B;  5CP6 D;  3MGQ D;  3REH C;  1P34 A;  3X1T D;  4ZUX C;  4ZBJ C;  5B0Z A;  3REL A;  4JJN D;  4Z66 C;  5B33 D;  3X1U A;  1B67 A;  5CPJ A;  1ID3 C;  1F66 D;  3O62 B;  3B6G A;  3X1V A;  3WAA A;  5BT1 D;  1BH8 A;  2IO5 C;  4Z2M G;  3X1S D;  5GXQ D;  5B0Y A;  5AV5 A;  3MVD A;  3W97 D;  5GT0 C;  4X23 C;  4G92 C;  1S32 C;  3WA9 C;  4H9O A;  1AOI D;  3AZH A;  4J8X B;  2FJ7 A;  1P3L D;  4XUJ A;  2F8N B;  5BNV A;  4WU9 C;  4HGA B;  1M18 C;  5E5A D;  4R8P C;  3MNN B;  2CV5 C;  1KU5 A;  3MGS C;  3AZM C;  5DNN D;  3AZE B;  3KXB B;  3LEL D;  3TU4 B;  3AV2 C;  3VH5 T;  1BFM A;  5CP6 C;  3C1C D;  5JRG A;  2ARO D;  2F8N K;  3VH6 T;  5B1L A;  5AV9 C;  3AZL C;  1P3I D;  3KUY D;  5AV8 D;  3REI B;  1BH9 B;  3B0D B;  3MGR C;  3AZK B;  5B1M D;  5DNM C;  1KX5 C;  1ID3 A;  3AZJ B;  4LD9 A;  3AN2 D;  3AV1 D;  5AVB B;  5GT0 A;  5G49 B;  4H9S C;  3WA9 A;  1S32 A;  5B2I C;  2PYO B;  5B2J B;  3LZ1 D;  4KHA A;  4KGC B;  4Z5T D;  3MGP B;  4JJN C;  3UT9 B;  1P3G C;  3B0C T;  1M18 A;  3REK C;  4YM6 B;  4R8P A;  3AZM A;  3X1U D;  5E5A C;  5F99 C;  4WU8 A;  3KWQ C;  3WAA D;  1M1A B;  2BYK B;  3AV2 A;  5CP6 A;  3WTP C;  3MGQ A;  3LEL C;  3UTA D;  3X1T A;  5B0Y D;  3B0B A;  2ARO C;  3W96 B;  3C1B D;  5AVC B;  4CSR B;  4JJN A;  5AV8 C;  5B33 A;  5DNM A;  3TU4 D;  3AZH D;  2FJ7 D;  4XUJ D;  3AYW D;  1P3O D;  1F66 A;  2YFV B;  3R45 A;  3LZ0 B;  4H9N B;  5C3I B;  3X1S A;  3LJA D;  5GXQ A;  3V9R A;  4H9S A;  3W97 A;  3AZJ D;  3O62 C;  3REH D;  3AZG B;  3AZI B;  5CPI B;  1HQ3 B;  5B32 B;  1P3G A;  4ZUX D;  4H9R A;  3AZF B;  3WKJ B;  3AFA B;  4Z66 D;  5E5A A;  5B2I B;  1ID3 D;  4J8X C;  5DNN A;  1TZY B;  5JA4 B;  4QLC B;  3WTP A;  3LEL A;  5BS7 C;  5KDM B;  2ARO A;  5GT0 D;  1JFI B;  4HGA C;  4X23 D;  5AV6 B;  3WA9 D;  1TAF A;  3MNN C;  2BYM A;  2L5A A;  5AV8 A;  5GT3 B;  3AZE C;  3KXB C;  1P3P B;  2NZD B;  3TU4 C;  5B31 B;  4WU9 D;  1U35 B;  4DRA A;  4NE5 A;  4WZS B;  3REI C;  1M19 B;  2CV5 D;  3MGS D;  3B0D C;  4J8V B;  3AZK C;  4M6B A;  3VH5 A;  3LZ1 A;  3VH6 A;  3AZJ C;  3AV2 D;  3LZ0 D;  4Z5T A;  4H9Q B;  4KUD B;  5AV9 D;  5AVB C;  3AZL D;  1P3A B;  3MGR D;  2PYO C;  5DNM D;  5B2J C;  1KX5 D;  3W99 B;  4KGC C;  5FUG B;  3MGP C;  3AZF D;  3NQJ B;  4H9P B;  3UT9 C;  2F8N A;  5CHL B;  3UTA A;  4NE6 A;  4YM6 C;  3MNN A;  5B2I D;  1P3K B;  3C1B A;  3REJ B;  5GSU B;  3KXB A;  3TU4 A;  1M1A C;  3UTB B;  2CWE A;  4J8W B;  5CPK B;  1P3G D;  1KX4 B;  1P3B B;  4UUZ A;  3AYW A;  5B40 B;  1P3O A;  3VH5 W;  5AV6 D;  3W96 C;  3A6N B;  3REK D;  3VH6 W;  5AVC C;  3REI A;  1WWI A;  1BH9 A;  3LJA A;  1P3P D;  5F99 D;  1N1J B;  3KWQ D;  1P3M C;  3AZJ A;  3WTP D;  3REH A;  3LZ0 C;  4ZUX A;  5B0Z B;  5G49 A;  5C3I C;  3REL B;  1H3O A;  4Z66 A;  5B2J A;  3AZG C;  4XZQ B;  3AZI C;  5CPJ B;  1R4V A;  3MGP A;  5CPI C;  1HQ3 C;  5B32 C;  3X1V B;  3B6G B;  5AY8 B;  3AZF C;  3WKJ C;  1BH8 B;  3AFA C;  4WV4 B;  3B0C W;  5AV5 B;  4YM6 A;  5BO0 B;  3W99 D;  4X23 A;  3KSY A;  3O62 D;  1TZY C;  1P3F B;  2BYK A;  4QLC C;  3W96 A;  5B24 B;  1ZLA B;  5BNV B;  1P3K D;  5BNX A;  4WU9 A;  5AVC A;  5AV6 C;  2CV5 A;  5GT3 C;  3MGS A;  4J8X D;  3UTB D;  1KX4 D;  1P3P C;  2NZD C;  2F8N D;  2YFW B;  5B31 C;  5JRG B;  3LZ0 A;  1U35 C;  1EQZ B;  5B1L B;  1M19 C;  5AV9 A;  3MNN D;  3AZL A;  4J8V C;  3AZE D;  3KXB D;  3MGR A;  3W98 B;  3AZI A;  1KX5 A;  4YS3 B;  4AWL B;  5B32 A;  5CPI A;  1P3M B;  3AZF A;  4LD9 B;  4KUD C;  4G91 B;  2NQB B;  3AFA A;  3REI D;  2RVQ C;  3B6F B;  1P3A C;  3AZK D;  5B2I A;  3W99 C;  1TZY A;  5JA4 A;  4E45 A;  5AVB D;  1JFI A;  5AV6 A;  1P3K C;  2PYO D;  3REK A;  5B2J D;  3REJ C;  1KX3 B;  5GSU C;  5GT3 A;  4KGC D;  2HIO B;  2F8N H;  1P3P A;  5F99 A;  3MGP D;  3AZN B;  3UTB C;  3KWQ A;  4J8W C;  5CPK C;  3UT9 D;  1KX4 C;  1P3B C;  1ZLA D;  3MGQ B;  5B40 C;  3X1T B;  3A6N C;  4YM6 D;  1M19 A;  4J8U B;  4JJN B;  5B33 B;  1M1A D;  1P34 C;  1EQZ D;  4H9Q A;  1F66 B;  3W96 D;  5B0Z C;  3R45 B;  5AVC D;  3REL C;  3NQU B;  3X1S B;  5GXQ B;  3V9R B;  3W99 A;  4XZQ C;  1P3M D;  5FUG A;  5CPJ C;  3O62 A;  3B6G C;  3NQJ A;  3X1V C;  1AOI B;  2NQB D;  5AY8 C;  1P3L B;  5AV5 C;  1P3K A;  4CAY B;  3AZG D;  3AZI D;  5CPI D;  1HQ3 D;  5B32 D;  4J8W A;  5DNN B;  4J8X A;  3UTB A;  5CPK A;  1P3F C;  1KX4 A;  4NFT A;  3WKJ D;  3AFA D;  5BS7 A;  5B24 C;  1ZLA C;  3A6N A;  3C1C B;  2HUE B;  1KX3 D;  4EO5 B;  2BYM B;  3AZN D;  1N1J A;  3KUY B;  1P3I B;  1TZY D;  3AZE A;  4QLC D;  5B1M B;  4WNN B;  5JRG C;  4DRB A;  1EQZ C;  4NE3 A;  4J8U D;  5B1L C;  3AN2 B;  3AV1 B;  5GT3 D;  3AZK A;  3W98 C;  4XZQ A;  2NZD D;  4YS3 C;  4AWL C;  3LZ1 B;  5B31 D;  5AY8 A;  1U35 D;  4Z5T B;  4G91 C;  1P34 B;  4LD9 C;  2NQB C;  1M19 D;  3B6F C;  5AVB A;  5BO0 A;  4J8V D;  2PYO A;  1F1E A;  1P3F A;  4KGC A;  3X1U B;  4KUD D;  3UT9 A;  3WAA B;  5B24 A;  1ZLA A;  1HTA A;  2RVQ D;  3UTA B;  1P3A D;  2F8N G;  3MVD B;  5B0Y B;  1KX3 C;  3C1B B;  2HIO C;  4H9O B;  3AZN C;  4WU8 C;  3AZH B;  1M1A A;  2YFW A;  2FJ7 B;  3MGQ C;  4UUZ B;  3X1T C;  4XUJ B;  3AYW B;  1P3O B;  1WWS A;  1EQZ A;  4J8U C;  3REJ D;  4CSR A;  5GSU D;  3LJA B; 
#chains in the Genus database with same CATH topology
 3W98 A;  5B33 C;  5CPK D;  4J8W D;  4YS3 A;  1P3B D;  1P3M A;  1F66 C;  5B40 D;  3REH B;  2NQB A;  3A6N D;  2YFV A;  5BT1 C;  4ZUX B;  4H9N A;  4ZBJ B;  3B6F A;  3X1S C;  5GXQ C;  1H3O B;  3W97 C;  4Z66 B;  2ZY5 A;  1Z2C B;  3AZG A;  1AOI C;  1P34 D;  1ID3 B;  1HQ3 A;  2LY8 A;  5B0Z D;  1P3L C;  3WKJ A;  3REL D;  2IO5 B;  2Y2I A;  5GT0 B;  1KX3 A;  4X23 B;  4Z2M H;  2HIO A;  4XZQ D;  4G92 B;  1S32 B;  3WA9 B;  2Y2K A;  5CPJ D;  3AZN A;  3B6G D;  3X1V D;  4KHA B;  5DNN C;  5AY8 D;  4QLC A;  3MVD D;  5KDM A;  5AV5 D;  3C1C C;  2HUE C;  3IP4 C;  2ZM5 A;  5BNX B;  4J8U A;  4WU9 B;  4EO5 C;  1M18 B;  1P3I C;  3KUY C;  4R8P B;  2CV5 B;  3MGS B;  3AZM B;  1P3F D;  5B1M C;  2NZD A;  4WU8 B;  5B31 A;  5B24 D;  3AV2 B;  1A7W A;  5CP6 B;  1U35 A;  3A1I A;  3AN2 C;  3NQU A;  1ULY A;  5AV9 B;  3AV1 C;  3AZL B;  4J8V A;  3MGR B;  3LZ1 C;  5DNM B;  1AOI A;  1KX5 B;  2Y2Q A;  5JRG D;  4Z5T C;  1P3L A;  1B6W A;  5B1L D;  4KUD A;  5B32 G;  2JSS A;  1Q9C A;  1P3A A;  3W98 D;  4CAY A;  3W97 B;  4YS3 D;  3X1U C;  4E44 A;  4LD9 D;  4H9P A;  3WAA C;  3EPL A;  1P3G B;  3C1C A;  3UTA C;  3B6F D;  4H9R B;  3MVD C;  5B0Y C;  1S32 D;  3C1B C;  3REK B;  3KUY A;  3REJ A;  1P3I A;  5GSU A;  5E5A B;  5B1M A;  5F99 B;  3AZH C;  4WNN A;  3KWQ B;  2FJ7 C;  2ZY4 A;  1P3B A;  3EPK A;  3WTP B;  5B40 A;  4XUJ C;  3LEL B;  1PZR A;  3AYW C;  1P3O C;  3AN2 A;  3WTP E;  5B31 G;  1M18 D;  2ARO B;  4R8P D;  3AV1 A;  3AZM D;  3LJA C;  2HIO D;  1TAF B;  4WU8 D;  5AV8 B;  5CP6 D;  3MGQ D;  3REH C;  1P34 A;  3X1T D;  4ZUX C;  2JE5 A;  4ZBJ C;  5B0Z A;  3REL A;  4JJN D;  4Z66 C;  5B33 D;  3X1U A;  1B67 A;  5CPJ A;  1ID3 C;  1F66 D;  3O62 B;  3B6G A;  3X1V A;  3WAA A;  5BT1 D;  1BH8 A;  2IO5 C;  4Z2M G;  3X1S D;  5GXQ D;  5AV5 A;  5B0Y A;  3MVD A;  3W97 D;  5GT0 C;  4X23 C;  4G92 C;  1S32 C;  3WA9 C;  4H9O A;  2Y2G A;  1AOI D;  3AZH A;  4J8X B;  2FJ7 A;  1P3L D;  4DQY B;  4XUJ A;  2F8N B;  5BNV A;  4WU9 C;  2Y2P A;  4HGA B;  1M18 C;  5E5A D;  4R8P C;  3MNN B;  2CV5 C;  1KU5 A;  3MGS C;  3AZM C;  5DNN D;  2DF4 C;  3AZE B;  3KXB B;  3LEL D;  3TU4 B;  3AV2 C;  3VH5 T;  1BFM A;  5CP6 C;  3C1C D;  5JRG A;  2ARO D;  2F8N K;  3VH6 T;  5B1L A;  5AV9 C;  3AZL C;  1P3I D;  3KUY D;  5AV8 D;  3REI B;  1BH9 B;  3B0D B;  3MGR C;  3AZK B;  2XD5 A;  5B1M D;  5DNM C;  1KX5 C;  1ID3 A;  3AZJ B;  4LD9 A;  3P5J B;  3AN2 D;  3AV1 D;  5AVB B;  2UWX A;  5G49 B;  5GT0 A;  4H9S C;  3WA9 A;  1S32 A;  5B2I C;  2PYO B;  2Y2N A;  5B2J B;  3LZ1 D;  4KHA A;  2FFF B;  4KGC B;  4Z5T D;  3MGP B;  4JJN C;  3UT9 B;  1P3G C;  3B0C T;  1M18 A;  3REK C;  4WJ3 C;  4YM6 B;  4R8P A;  3AZM A;  2Y2O A;  5E5A C;  3X1U D;  5F99 C;  4WU8 A;  3KWQ C;  3WAA D;  1M1A B;  2BYK B;  3AV2 A;  5CP6 A;  3WTP C;  3MGQ A;  3LEL C;  3UTA D;  3X1T A;  5B0Y D;  3B0B A;  2ARO C;  3W96 B;  3AL0 C;  3C1B D;  5AVC B;  4CSR B;  4JJN A;  5AV8 C;  5B33 A;  5DNM A;  3TU4 D;  3AZH D;  2FJ7 D;  4XUJ D;  3AYW D;  1P3O D;  1F66 A;  2YFV B;  3R45 A;  3LZ0 B;  4H9N B;  5C3I B;  3X1S A;  3LJA D;  5GXQ A;  3V9R A;  4H9S A;  3W97 A;  3AZJ D;  3O62 C;  3REH D;  3AZG B;  3AZI B;  5CPI B;  1HQ3 B;  5B32 B;  1P3G A;  4ZUX D;  4H9R A;  3AZF B;  3WKJ B;  3AFA B;  4Z66 D;  5E5A A;  5B2I B;  1ID3 D;  4J8X C;  5DNN A;  1TZY B;  5JA4 B;  4QLC B;  1T3U A;  3WTP A;  3LEL A;  5BS7 C;  5KDM B;  2ARO A;  5GT0 D;  1JFI B;  4HGA C;  4X23 D;  5AV6 B;  3WA9 D;  1TAF A;  3MNN C;  2BYM A;  2L5A A;  3A1K A;  5AV8 A;  5GT3 B;  3AZE C;  3KXB C;  1P3P B;  2NZD B;  3TU4 C;  5B31 B;  4WU9 D;  1U35 B;  4DRA A;  4NE5 A;  4WZS B;  3REI C;  1M19 B;  2CV5 D;  3MGS D;  3B0D C;  4J8V B;  3AZK C;  4M6B A;  3VH5 A;  3LZ1 A;  3VH6 A;  3AZJ C;  3AV2 D;  3LZ0 D;  2G5I C;  4Z5T A;  4H9Q B;  4KUD B;  5AV9 D;  5AVB C;  3AZL D;  1P3A B;  3MGR D;  2PYO C;  5DNM D;  5B2J C;  4UPK A;  1KX5 D;  3W99 B;  2F2A C;  4KGC C;  5FUG B;  3MGP C;  3AZF D;  2Y2J A;  3NQJ B;  4H9P B;  3UT9 C;  2F8N A;  3EG5 B;  5CHL B;  3UTA A;  4NE6 A;  4YM6 C;  3MNN A;  5B2I D;  1P3K B;  3C1B A;  3REJ B;  5GSU B;  3KXB A;  3TU4 A;  1M1A C;  3UTB B;  2CWE A;  4J8W B;  5CPK B;  1P3G D;  1KX4 B;  1P3B B;  4UUZ A;  3AYW A;  5B40 B;  1P3O A;  3VH5 W;  5AV6 D;  3W96 C;  3A6N B;  3REK D;  3VH6 W;  5AVC C;  3REI A;  1WWI A;  1BH9 A;  3LJA A;  1P3P D;  2W8S A;  5F99 D;  1N1J B;  3KWQ D;  1P3M C;  3AZJ A;  3WTP D;  3REH A;  3LZ0 C;  4ZUX A;  5B0Z B;  5G49 A;  5C3I C;  3REL B;  2J8P A;  1H3O A;  4Z66 A;  5B2J A;  3AZG C;  4XZQ B;  3AZI C;  5CPJ B;  1R4V A;  3MGP A;  5CPI C;  1HQ3 C;  3H0R C;  5B32 C;  3X1V B;  3B6G B;  5AY8 B;  3AZF C;  3WKJ C;  1BH8 B;  3EPH A;  3AFA C;  4WV4 B;  3B0C W;  5AV5 B;  4YM6 A;  5BO0 B;  3W99 D;  4X23 A;  3KSY A;  3O62 D;  1TZY C;  1P3F B;  2BYK A;  4QLC C;  2Y2L A;  3W96 A;  5B24 B;  1ZLA B;  5BNV B;  1P3K D;  5BNX A;  4WU9 A;  5AVC A;  5AV6 C;  3EPJ A;  2CV5 A;  5GT3 C;  3MGS A;  4J8X D;  3UTB D;  1KX4 D;  1P3P C;  2RIQ A;  2NZD C;  2F8N D;  2YFW B;  5B31 C;  5JRG B;  3LZ0 A;  1U35 C;  1EQZ B;  5B1L B;  1M19 C;  5AV9 A;  3MNN D;  3AZL A;  4J8V C;  3AZE D;  3KXB D;  3MGR A;  3W98 B;  3AZI A;  1KX5 A;  4YS3 B;  4AWL B;  5B32 A;  5CPI A;  1P3M B;  3AZF A;  4LD9 B;  4KUD C;  4G91 B;  2NQB B;  3AFA A;  3REI D;  2RVQ C;  3B6F B;  1P3A C;  3AZK D;  5B2I A;  3W99 C;  2XD1 A;  1TZY A;  5JA4 A;  4E45 A;  3H0L C;  5AVB D;  1JFI A;  5AV6 A;  1P3K C;  2PYO D;  3REK A;  5B2J D;  3REJ C;  1KX3 B;  5GSU C;  5GT3 A;  4KGC D;  2HIO B;  2F8N H;  1P3P A;  5F99 A;  3MGP D;  3AZN B;  3UTB C;  3KWQ A;  4J8W C;  5CPK C;  3UT9 D;  1KX4 C;  1P3B C;  1ZLA D;  2ZY2 A;  3MGQ B;  5B40 C;  3X1T B;  3A6N C;  4YM6 D;  1M19 A;  4J8U B;  4JJN B;  5B33 B;  1M1A D;  1P34 C;  1EQZ D;  4H9Q A;  1F66 B;  3W96 D;  5B0Z C;  3R45 B;  5AVC D;  3REL C;  3H0M C;  3NQU B;  3X1S B;  5GXQ B;  3V9R B;  3W99 A;  1W2E A;  4XZQ C;  1P3M D;  5FUG A;  5CPJ C;  3O62 A;  3B6G C;  3NQJ A;  3X1V C;  1AOI B;  2NQB D;  5AY8 C;  2Y2H A;  2JCH A;  1P3L B;  5AV5 C;  2Y2M A;  1P3K A;  2DQN C;  4CAY B;  3AZG D;  3AZI D;  5CPI D;  1HQ3 D;  5B32 D;  4J8W A;  5DNN B;  4J8X A;  3UTB A;  5CPK A;  1P3F C;  1KX4 A;  4NFT A;  3WKJ D;  3AFA D;  5BS7 A;  5B24 C;  1ZLA C;  3A6N A;  3C1C B;  2HUE B;  1KX3 D;  4EO5 B;  2BYM B;  3AZN D;  1N1J A;  3KUY B;  1P3I B;  1TZY D;  3AZE A;  4QLC D;  5B1M B;  4WNN B;  5JRG C;  3KFU G;  4DRB A;  1EQZ C;  4NE3 A;  4J8U D;  5B1L C;  3AN2 B;  3AV1 B;  5GT3 D;  3AZK A;  3W98 C;  4XZQ A;  2NZD D;  4YS3 C;  4AWL C;  3LZ1 B;  5B31 D;  5AY8 A;  1U35 D;  4Z5T B;  4G91 C;  1P34 B;  4LD9 C;  2NQB C;  2ZY3 A;  1M19 D;  3B6F C;  5AVB A;  5BO0 A;  4J8V D;  2PYO A;  1F1E A;  1P3F A;  4KGC A;  3X1U B;  2VQR A;  3FDD A;  4KUD D;  3UT9 A;  3WAA B;  5B24 A;  1ZLA A;  1HTA A;  2RVQ D;  3UTA B;  2BG1 A;  1P3A D;  2F8N G;  3MVD B;  5B0Y B;  2G5H C;  1KX3 C;  3C1B B;  2HIO C;  4H9O B;  3AZN C;  4WU8 C;  3AZH B;  1M1A A;  2YFW A;  2FJ7 B;  3MGQ C;  4UUZ B;  3X1T C;  4XUJ B;  3AYW B;  1P3O B;  1WWS A;  1EQZ A;  3F6T A;  4J8U C;  3REJ D;  4CSR A;  5GSU D;  3LJA B; 
#chains in the Genus database with same CATH homology
 3W98 A;  5B33 C;  5CPK D;  4J8W D;  4YS3 A;  1P3B D;  1P3M A;  1F66 C;  5B40 D;  3REH B;  2NQB A;  3A6N D;  2YFV A;  5BT1 C;  4ZUX B;  4H9N A;  4ZBJ B;  3B6F A;  3X1S C;  5GXQ C;  1H3O B;  3W97 C;  4Z66 B;  2ZY5 A;  1Z2C B;  3AZG A;  1AOI C;  1P34 D;  1ID3 B;  1HQ3 A;  2LY8 A;  5B0Z D;  1P3L C;  3WKJ A;  3REL D;  2IO5 B;  2Y2I A;  5GT0 B;  1KX3 A;  4X23 B;  4Z2M H;  2HIO A;  4XZQ D;  4G92 B;  1S32 B;  3WA9 B;  2Y2K A;  5CPJ D;  3AZN A;  3B6G D;  3X1V D;  4KHA B;  5DNN C;  5AY8 D;  4QLC A;  3MVD D;  5KDM A;  5AV5 D;  3C1C C;  2HUE C;  3IP4 C;  2ZM5 A;  5BNX B;  4J8U A;  4WU9 B;  4EO5 C;  1M18 B;  1P3I C;  3KUY C;  4R8P B;  2CV5 B;  3MGS B;  3AZM B;  1P3F D;  5B1M C;  2NZD A;  4WU8 B;  5B31 A;  5B24 D;  3AV2 B;  1A7W A;  5CP6 B;  1U35 A;  3A1I A;  3AN2 C;  3NQU A;  1ULY A;  5AV9 B;  3AV1 C;  3AZL B;  4J8V A;  3MGR B;  3LZ1 C;  5DNM B;  1AOI A;  1KX5 B;  2Y2Q A;  5JRG D;  4Z5T C;  1P3L A;  1B6W A;  5B1L D;  4KUD A;  5B32 G;  2JSS A;  1Q9C A;  1P3A A;  3W98 D;  4CAY A;  3W97 B;  4YS3 D;  3X1U C;  4E44 A;  4LD9 D;  4H9P A;  3WAA C;  3EPL A;  1P3G B;  3C1C A;  3UTA C;  3B6F D;  4H9R B;  3MVD C;  5B0Y C;  1S32 D;  3C1B C;  3REK B;  3KUY A;  3REJ A;  1P3I A;  5GSU A;  5E5A B;  5B1M A;  5F99 B;  3AZH C;  4WNN A;  3KWQ B;  2FJ7 C;  2ZY4 A;  1P3B A;  3EPK A;  3WTP B;  5B40 A;  4XUJ C;  3LEL B;  1PZR A;  3AYW C;  1P3O C;  3AN2 A;  3WTP E;  5B31 G;  1M18 D;  2ARO B;  4R8P D;  3AV1 A;  3AZM D;  3LJA C;  2HIO D;  1TAF B;  4WU8 D;  5AV8 B;  5CP6 D;  3MGQ D;  3REH C;  1P34 A;  3X1T D;  4ZUX C;  2JE5 A;  4ZBJ C;  5B0Z A;  3REL A;  4JJN D;  4Z66 C;  5B33 D;  3X1U A;  1B67 A;  5CPJ A;  1ID3 C;  1F66 D;  3O62 B;  3B6G A;  3X1V A;  3WAA A;  5BT1 D;  1BH8 A;  2IO5 C;  4Z2M G;  3X1S D;  5GXQ D;  5AV5 A;  5B0Y A;  3MVD A;  3W97 D;  5GT0 C;  4X23 C;  4G92 C;  1S32 C;  3WA9 C;  4H9O A;  2Y2G A;  1AOI D;  3AZH A;  4J8X B;  2FJ7 A;  1P3L D;  4DQY B;  4XUJ A;  2F8N B;  5BNV A;  4WU9 C;  2Y2P A;  4HGA B;  1M18 C;  5E5A D;  4R8P C;  3MNN B;  2CV5 C;  1KU5 A;  3MGS C;  3AZM C;  5DNN D;  2DF4 C;  3AZE B;  3KXB B;  3LEL D;  3TU4 B;  3AV2 C;  3VH5 T;  1BFM A;  5CP6 C;  3C1C D;  5JRG A;  2ARO D;  2F8N K;  3VH6 T;  5B1L A;  5AV9 C;  3AZL C;  1P3I D;  3KUY D;  5AV8 D;  3REI B;  1BH9 B;  3B0D B;  3MGR C;  3AZK B;  2XD5 A;  5B1M D;  5DNM C;  1KX5 C;  1ID3 A;  3AZJ B;  4LD9 A;  3P5J B;  3AN2 D;  3AV1 D;  5AVB B;  2UWX A;  5G49 B;  5GT0 A;  4H9S C;  3WA9 A;  1S32 A;  5B2I C;  2PYO B;  2Y2N A;  5B2J B;  3LZ1 D;  4KHA A;  2FFF B;  4KGC B;  4Z5T D;  3MGP B;  4JJN C;  3UT9 B;  1P3G C;  3B0C T;  1M18 A;  3REK C;  4WJ3 C;  4YM6 B;  4R8P A;  3AZM A;  2Y2O A;  5E5A C;  3X1U D;  5F99 C;  4WU8 A;  3KWQ C;  3WAA D;  1M1A B;  2BYK B;  3AV2 A;  5CP6 A;  3WTP C;  3MGQ A;  3LEL C;  3UTA D;  3X1T A;  5B0Y D;  3B0B A;  2ARO C;  3W96 B;  3AL0 C;  3C1B D;  5AVC B;  4CSR B;  4JJN A;  5AV8 C;  5B33 A;  5DNM A;  3TU4 D;  3AZH D;  2FJ7 D;  4XUJ D;  3AYW D;  1P3O D;  1F66 A;  2YFV B;  3R45 A;  3LZ0 B;  4H9N B;  5C3I B;  3X1S A;  3LJA D;  5GXQ A;  3V9R A;  4H9S A;  3W97 A;  3AZJ D;  3O62 C;  3REH D;  3AZG B;  3AZI B;  5CPI B;  1HQ3 B;  5B32 B;  1P3G A;  4ZUX D;  4H9R A;  3AZF B;  3WKJ B;  3AFA B;  4Z66 D;  5E5A A;  5B2I B;  1ID3 D;  4J8X C;  5DNN A;  1TZY B;  5JA4 B;  4QLC B;  1T3U A;  3WTP A;  3LEL A;  5BS7 C;  5KDM B;  2ARO A;  5GT0 D;  1JFI B;  4HGA C;  4X23 D;  5AV6 B;  3WA9 D;  1TAF A;  3MNN C;  2BYM A;  2L5A A;  3A1K A;  5AV8 A;  5GT3 B;  3AZE C;  3KXB C;  1P3P B;  2NZD B;  3TU4 C;  5B31 B;  4WU9 D;  1U35 B;  4DRA A;  4NE5 A;  4WZS B;  3REI C;  1M19 B;  2CV5 D;  3MGS D;  3B0D C;  4J8V B;  3AZK C;  4M6B A;  3VH5 A;  3LZ1 A;  3VH6 A;  3AZJ C;  3AV2 D;  3LZ0 D;  2G5I C;  4Z5T A;  4H9Q B;  4KUD B;  5AV9 D;  5AVB C;  3AZL D;  1P3A B;  3MGR D;  2PYO C;  5DNM D;  5B2J C;  4UPK A;  1KX5 D;  3W99 B;  2F2A C;  4KGC C;  5FUG B;  3MGP C;  3AZF D;  2Y2J A;  3NQJ B;  4H9P B;  3UT9 C;  2F8N A;  3EG5 B;  5CHL B;  3UTA A;  4NE6 A;  4YM6 C;  3MNN A;  5B2I D;  1P3K B;  3C1B A;  3REJ B;  5GSU B;  3KXB A;  3TU4 A;  1M1A C;  3UTB B;  2CWE A;  4J8W B;  5CPK B;  1P3G D;  1KX4 B;  1P3B B;  4UUZ A;  3AYW A;  5B40 B;  1P3O A;  3VH5 W;  5AV6 D;  3W96 C;  3A6N B;  3REK D;  3VH6 W;  5AVC C;  3REI A;  1WWI A;  1BH9 A;  3LJA A;  1P3P D;  2W8S A;  5F99 D;  1N1J B;  3KWQ D;  1P3M C;  3AZJ A;  3WTP D;  3REH A;  3LZ0 C;  4ZUX A;  5B0Z B;  5G49 A;  5C3I C;  3REL B;  2J8P A;  1H3O A;  4Z66 A;  5B2J A;  3AZG C;  4XZQ B;  3AZI C;  5CPJ B;  1R4V A;  3MGP A;  5CPI C;  1HQ3 C;  3H0R C;  5B32 C;  3X1V B;  3B6G B;  5AY8 B;  3AZF C;  3WKJ C;  1BH8 B;  3EPH A;  3AFA C;  4WV4 B;  3B0C W;  5AV5 B;  4YM6 A;  5BO0 B;  3W99 D;  4X23 A;  3KSY A;  3O62 D;  1TZY C;  1P3F B;  2BYK A;  4QLC C;  2Y2L A;  3W96 A;  5B24 B;  1ZLA B;  5BNV B;  1P3K D;  5BNX A;  4WU9 A;  5AVC A;  5AV6 C;  3EPJ A;  2CV5 A;  5GT3 C;  3MGS A;  4J8X D;  3UTB D;  1KX4 D;  1P3P C;  2RIQ A;  2NZD C;  2F8N D;  2YFW B;  5B31 C;  5JRG B;  3LZ0 A;  1U35 C;  1EQZ B;  5B1L B;  1M19 C;  5AV9 A;  3MNN D;  3AZL A;  4J8V C;  3AZE D;  3KXB D;  3MGR A;  3W98 B;  3AZI A;  1KX5 A;  4YS3 B;  4AWL B;  5B32 A;  5CPI A;  1P3M B;  3AZF A;  4LD9 B;  4KUD C;  4G91 B;  2NQB B;  3AFA A;  3REI D;  2RVQ C;  3B6F B;  1P3A C;  3AZK D;  5B2I A;  3W99 C;  2XD1 A;  1TZY A;  5JA4 A;  4E45 A;  3H0L C;  5AVB D;  1JFI A;  5AV6 A;  1P3K C;  2PYO D;  3REK A;  5B2J D;  3REJ C;  1KX3 B;  5GSU C;  5GT3 A;  4KGC D;  2HIO B;  2F8N H;  1P3P A;  5F99 A;  3MGP D;  3AZN B;  3UTB C;  3KWQ A;  4J8W C;  5CPK C;  3UT9 D;  1KX4 C;  1P3B C;  1ZLA D;  2ZY2 A;  3MGQ B;  5B40 C;  3X1T B;  3A6N C;  4YM6 D;  1M19 A;  4J8U B;  4JJN B;  5B33 B;  1M1A D;  1P34 C;  1EQZ D;  4H9Q A;  1F66 B;  3W96 D;  5B0Z C;  3R45 B;  5AVC D;  3REL C;  3H0M C;  3NQU B;  3X1S B;  5GXQ B;  3V9R B;  3W99 A;  1W2E A;  4XZQ C;  1P3M D;  5FUG A;  5CPJ C;  3O62 A;  3B6G C;  3NQJ A;  3X1V C;  1AOI B;  2NQB D;  5AY8 C;  2Y2H A;  2JCH A;  1P3L B;  5AV5 C;  2Y2M A;  1P3K A;  2DQN C;  4CAY B;  3AZG D;  3AZI D;  5CPI D;  1HQ3 D;  5B32 D;  4J8W A;  5DNN B;  4J8X A;  3UTB A;  5CPK A;  1P3F C;  1KX4 A;  4NFT A;  3WKJ D;  3AFA D;  5BS7 A;  5B24 C;  1ZLA C;  3A6N A;  3C1C B;  2HUE B;  1KX3 D;  4EO5 B;  2BYM B;  3AZN D;  1N1J A;  3KUY B;  1P3I B;  1TZY D;  3AZE A;  4QLC D;  5B1M B;  4WNN B;  5JRG C;  3KFU G;  4DRB A;  1EQZ C;  4NE3 A;  4J8U D;  5B1L C;  3AN2 B;  3AV1 B;  5GT3 D;  3AZK A;  3W98 C;  4XZQ A;  2NZD D;  4YS3 C;  4AWL C;  3LZ1 B;  5B31 D;  5AY8 A;  1U35 D;  4Z5T B;  4G91 C;  1P34 B;  4LD9 C;  2NQB C;  2ZY3 A;  1M19 D;  3B6F C;  5AVB A;  5BO0 A;  4J8V D;  2PYO A;  1F1E A;  1P3F A;  4KGC A;  3X1U B;  2VQR A;  3FDD A;  4KUD D;  3UT9 A;  3WAA B;  5B24 A;  1ZLA A;  1HTA A;  2RVQ D;  3UTA B;  2BG1 A;  1P3A D;  2F8N G;  3MVD B;  5B0Y B;  2G5H C;  1KX3 C;  3C1B B;  2HIO C;  4H9O B;  3AZN C;  4WU8 C;  3AZH B;  1M1A A;  2YFW A;  2FJ7 B;  3MGQ C;  4UUZ B;  3X1T C;  4XUJ B;  3AYW B;  1P3O B;  1WWS A;  1EQZ A;  3F6T A;  4J8U C;  3REJ D;  4CSR A;  5GSU D;  3LJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...