5B24D

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24D00
3AZGA 3AZLA 4J8UA 3X1TC 5B0ZD 3AN2B 1P3FB 3X1SA 1KX4D 3B0DB 2IO5B 1P34D 3LZ1A 4Z66C 5AVCA 2YFWB 4J8WD 5JRGD 3WAAC 2CV5D 4ZBJC 1TZYC 3UTAD 4WU9C 3X1TB 1M1AD 3WA9C 4H9QA 3RELC 4Z66B 4YS3A 4H9SA 1M18A 3WAAB 4ZBJB 4WU9B 3WA9B 5B1LD 3AZID 1BH9B 3KWQD 4KUDA 2JSSA 3AZNA 3RELB 3W98A 3REKA 3AV1D 5GT3A 1P3AC 1AOID 3AZLC 1TAFA 3O62A 4Z2MG 4QLCA 1P3IC 3LJAA 1P3PA 4X23C 3AZMA 3REJC 3B0BA 5CPKC 3MGSC 4R8PA 5B31C 5B1MA 1P3AB 5JA4A 3AZLB 5B33D 2NQBD 1P3OD 1P3IB 4X23B 3REJB 3W99A 4YS3C 5CPKB 3MGSB 5B31B 2F8NK 3TU4C 3UT9A 4G92C 5AV5A 5GXQD 2AROC 4KUDC 3AZHA 1H3OB 4YS3B 3W96C 1P3LA 4WU8D 1P3PC 2HUEC 4XZQC 2AROB 3AZMC 4KUDB 5BNVA 5DNMD 5F99C 2FJ7D 5GT3B 5B2JD 3W96B 3O62B 3C1BA 1ZLAA 3B6GD 4QLCB 2HUEB 4XZQB 1P3PB 3AV1A 3AZMB 5FUGB 5CP6D 3MVDA 5B0ZC 1BH8A 5CPJD 5F99B 5DNND 1P34C 1P3BA 4J8WC 3AZGD 5JRGC 3AZLD 4J8UD 2CV5C 3UTAC 1M1AC 4Z5TA 3AZJA 5B0ZB 4CSRB 4J8VA 3X1SD 3LZ1D 1P3LC 1P34B 5B24A 5GSUA 4KHAA 3AZEA 4LD9A 5AVCD 4J8WB 5JRGB 2CV5B 1M1AB 3UTAB 3WKJD 5B1LC 3AZIC 3KWQC 2F8NG 1P3LB 4YS3D 5B32A 3AV1C 1P3GA 1M18D 1AOIC 2CWEA 5B1LB 3AZIB 3KWQB 4KUDD 3AZND 1ZLAB 3W98D 3REKD 1KX3D 5GT3D 4E45A 3LELA 2BYKA 3AV1B 3O62D 1AOIB 1HQ3A 5B33C 2NQBC 3AZJC 2HIOD 1HTAA 4QLCD 3LJAD 5B2IA 1BH8B 1P3OC 3X1UA 1P3PD 3AZMD 3B0CT 4CAYB 2BYMA 4R8PD 3VH6W 5B1MD 4NE6A 4XUJA 1KX5A 3AYWA 1N1JB 5B33B 2NQBB 4Z5TB 5AV8A 3AZJB 1P3OB 5GXQC 3R45B 4UUZB 3W97A 3W99D 3V9RB 3REHA 3WTPE 3UT9D 4ZUXA 5AV5D 4WU8C 1EQZA 5GXQB 2F8NH 3AZHD 1ID3A 3WKJA 3VH6A 3MGRA 3VH5T 5DNMC 3AZFA 5B2JC 1P3LD 3NQUB 3B6GC 4WU8B 5B2IC 3REIA 5CPIA 3UTBA 5CP6C 5CPJC 1Q9CA 5DNMB 5DNNC 5B2JB 3C1BD 1S32A 1ZLAD 3B6GB 3LZ0A 5B2IB 1KX3A 3AZGC 5AV6A 4J8UC 3MVDD 5CP6B 2HIOA 3MNNA 5CPJB 5AV9A 3X1SC 5DNNB 3LZ1C 1F66A 2LY8A 5AVCC 1EQZC 2NZDA 5GT0A 3MGPA 1P3BD 3AZGB 4J8UB 4Z5TD 3WKJC 3AZJD 5CHLB 5B0YA 4J8VD 3KUYA 3X1SB 5B24D 3LZ1B 5GSUD 4LD9D 3AZED 5AVCB 1EQZB 4H9SC 1M18C 3A6NA 1JFIA 3WKJB 4J8XA 4H9QB 3AZNC 1U35A 1ULYA 4DRBA 3W98C 3REKC 1KX3C 5B32D 5GT3C 1P3GD 1M18B 3O62C 2PYOA 5G49A 2HIOC 4QLCC 3LJAC 1P3MA 3AZNB 4R8PC 3MGQD 4H9RA 5AVBD 5B1MC 1P3KA 3REKB 4M6BA 3LZ0B 4Z2MH 3LELD 1KX3B 3W98B 2NZDC 1HQ3D 1TAFB 4H9PA 2HIOB 5B2ID 3LJAB 3X1UD 5AY8A 4JJNA 5BO0A 4H9OA 3W99C 4R8PB 5B1MB 4XUJD 2NZDB 1KX5D 5JA4B 3AYWD 3UT9C 1B67A 2YFVA 3A6NC 5AV8D 5AV5C 4KGCA 3NQJA 3AZHC 3W97D 3W99B 3C1CD 3REHD 3X1VA 3UT9B 4ZUXD 4NFTA 3A6NB 5AV5B 1EQZD 3AV2A 3AZKA 1ID3D 3AZHB 3KXBA 5BS7A 3MGRD 3AZFD 4H9NA 3C1BC 1ZLAC 3B6FA 5AY8C 3REID 2RVQD 5CPID 3UTBD 3MVDC 4YM6A 5BNVB 3KSYA 1S32D 3C1BB 5B40A 5BNXA 3MGQA 5AVBA 5E5AA 3LZ0D 1M19A 3AN2A 5AY8B 3AFAA 1P3BC 1P3FA 5BO0B 5AV6D 4Z5TC 4H9OB 3MVDB 3MNND 2F8NA 4J8VC 4E44A 5AV9D 3X1VC 5B24C 3X1TA 5GSUC 4LD9C 4WV4B 3AZEC 1F66D 4NE5A 2NZDD 5GT0D 3MGPD 1P3BB 4Z66A 5B0YD 4J8VB 3KUYD 3X1VB 3WAAA 1TZYA 4WU9A 5B24B 3WA9A 5GSUB 4KHAB 3AZEB 3C1CA 4LD9B 1BH9A 5B32C 1P3GC 3A6ND 3B0CW 3RELA 4J8XD 1U35D 5B40C 5B31G 3MGQC 5AVBC 1M19C 5B32B 3AFAC 3LELC 1P3GB 1HQ3C 1WWSA 2PYOD 4EO5C 4YM6B 3X1UC 1P3MD 1F1EA 1P3AA 5B40B 5BNXB 3MGQB 5AVBB 5E5AB 4XUJC 1P3IA 1P3KD 1M19B 2L5AA 3AFAB 2BYKB 4X23A 3LELB 3AYWC 1HQ3B 1KX5C 3REJA 5AV8C 4EO5B 3MGSA 5CPKA 5AY8D 4JJND 5B31A 3X1UB 2F8NB 3VH5W 1BFMA 4HGAC 3W97C 2BYMB 5KDMA 3C1CC 3REHC 4XUJB 1KX5B 3AYWB 4ZUXC 1H3OA 5AV8B 4KGCD 1ID3C 3TU4A 4HGAB 3W97B 1TZYB 3MGRC 3C1CB 3REHB 3AZFC 2AROA 3X1VD 3WTPD 4ZUXB 3AV2D 3VH5A 3AZKD 3REIC 3KXBD 1ID3B 2RVQC 5CPIC 3W96A 3UTBC 3MGRB 4XZQA 3AZFB 1B6WA 5FUGA 1S32C 3LZ0C 3B6FD 5F99A 5AV6C 3REIB 5CPIB 3UTBB 2FJ7A 4YM6D 3MNNC 5AV9C 5BT1D 1S32B 5B40D 1F66C 1M19D 5E5AD 4NE3A 5B0ZA 4CSRA 5GT0C 3AFAD 3MGPC 3AN2D 1P3FD 4G91C 5AV6B 1KX4A 1P34A 4WNNA 2F8ND 5B0YC 5KDMB 3MNNB 3KUYC 5AV9B 4J8WA 5JRGA 2CV5A 1M1AA 3X1TD 3UTAA 1F66B 4DRAA 5GT0B 3MGPB 5C3IC 4G91B 3TU4B 4Z66D 4J8XC 4G92B 5B0YB 1KU5A 3KUYB 3WAAD 1TZYD 4WU9D 1U35C 3WA9D 5B1LA 3AZIA 3KWQA 1R4VA 4WZSB 3WTPA 5C3IB 2PYOC 2FJ7C 3RELD 1JFIB 4J8XB 4AWLC 1P3MC 1AOIA 1U35B 1A7WA 1P3KC 4CAYA 1KX4C 2PYOB 2FJ7B 5G49B 4JJNC 1WWIA 4AWLB 1P3MB 1P3AD 1N1JA 5B33A 2NQBA 1P3OA 4H9RB 1P3ID 5B32G 1P3KB 4X23D 3R45A 4UUZA 1KX4B 3REJD 4H9PB 4KGCC 4WNNB 3V9RA 3MGSD 5CPKD 5B31D 4JJNB 5GXQA 2YFWA 3WTPC 2YFVB 4KGCB 3AV2C 3NQJB 3AZKC 3KXBC 3TU4D 5BS7C 3NQUA 3VH6T 4WU8A 2AROD 3WTPB 3B6FC 3AV2B 5DNMA 3AZKB 3KXBB 3W96D 5B2JA 4YM6C 3B6GA 4XZQD 4H9NB 5BT1C 5CP6A 5E5AC 5CPJA 3AN2C 3B6FB 1P3FC 5F99D 3B0DC 2IO5C 5DNNA
chains in the Genus database with same CATH superfamily
3AZGA 3AZLA 4J8UA 3X1TC 5B0ZD 2BG1A 3AN2B 1P3FB 3X1SA 1KX4D 3B0DB 2IO5B 1P34D 3LZ1A 4Z66C 5AVCA 2YFWB 4J8WD 5JRGD 3WAAC 2CV5D 4ZBJC 1TZYC 3UTAD 4WU9C 3X1TB 1M1AD 3WA9C 4H9QA 3RELC 4Z66B 4YS3A 4H9SA 1M18A 3WAAB 4ZBJB 4WU9B 3WA9B 5B1LD 3AZID 1BH9B 3KWQD 4KUDA 2JSSA 3AZNA 3RELB 3W98A 3REKA 3AV1D 5GT3A 1P3AC 1AOID 3AZLC 1TAFA 3O62A 4Z2MG 4QLCA 2JE5A 3LJAA 1P3IC 1P3PA 4X23C 3AZMA 3REJC 3B0BA 5CPKC 3MGSC 4R8PA 5B31C 5B1MA 4WJ3C 1P3AB 5JA4A 3AZLB 5B33D 2NQBD 1P3OD 1P3IB 4X23B 2FFFB 3REJB 3W99A 4YS3C 5CPKB 3MGSB 5B31B 1T3UA 2F8NK 3TU4C 3UT9A 4G92C 5AV5A 5GXQD 2AROC 4KUDC 3AZHA 1H3OB 4YS3B 2VQRA 3W96C 1P3LA 4WU8D 1P3PC 2HUEC 4XZQC 2AROB 3AZMC 4KUDB 5BNVA 5DNMD 5F99C 2FJ7D 5GT3B 5B2JD 3W96B 3O62B 3C1BA 1ZLAA 3B6GD 4QLCB 2HUEB 4XZQB 1P3PB 3AV1A 3AZMB 5FUGB 5CP6D 3MVDA 5B0ZC 1BH8A 5CPJD 2JCHA 5F99B 5DNND 1P34C 1P3BA 4J8WC 3AZGD 5JRGC 3AZLD 4J8UD 2CV5C 3UTAC 1M1AC 4Z5TA 3AZJA 5B0ZB 3H0MC 4CSRB 4J8VA 3X1SD 3H0LC 3LZ1D 1P3LC 1P34B 5B24A 5GSUA 4KHAA 3AZEA 4LD9A 5AVCD 3A1KA 4J8WB 5JRGB 2CV5B 1M1AB 3UTAB 2Y2JA 3WKJD 5B1LC 3AZIC 3KWQC 2F8NG 1P3LB 4YS3D 2XD5A 5B32A 3AV1C 1P3GA 1M18D 1AOIC 2CWEA 5B1LB 3AZIB 3KWQB 4KUDD 3AZND 2ZY5A 1ZLAB 3W98D 3REKD 1KX3D 5GT3D 4E45A 3LELA 2BYKA 3AV1B 3O62D 1AOIB 1HQ3A 5B33C 2NQBC 3AZJC 2HIOD 1HTAA 4QLCD 3LJAD 5B2IA 1BH8B 1P3OC 3X1UA 1P3PD 3AZMD 3B0CT 4CAYB 2BYMA 4R8PD 3VH6W 5B1MD 4NE6A 4XUJA 1KX5A 3AYWA 1N1JB 5B33B 2NQBB 4Z5TB 5AV8A 3AZJB 1P3OB 5GXQC 2ZY2A 2Y2GA 3R45B 4UUZB 3W97A 3W99D 3V9RB 3REHA 3WTPE 3UT9D 4ZUXA 5AV5D 4WU8C 1EQZA 5GXQB 2F8NH 3AZHD 2ZY4A 1ID3A 3WKJA 3VH6A 3MGRA 3VH5T 5DNMC 3AZFA 5B2JC 2Y2OA 1P3LD 3NQUB 3B6GC 4WU8B 5B2IC 3REIA 5CPIA 3UTBA 5CP6C 5CPJC 1Q9CA 5DNMB 5DNNC 5B2JB 3C1BD 1S32A 1ZLAD 3B6GB 3LZ0A 5B2IB 1KX3A 3AZGC 5AV6A 4J8UC 3MVDD 5CP6B 2HIOA 3MNNA 2F2AC 5CPJB 5AV9A 3X1SC 1W2EA 5DNNB 3LZ1C 1F66A 2LY8A 5AVCC 1EQZC 2NZDA 5GT0A 3MGPA 1P3BD 3AZGB 4J8UB 4Z5TD 2RIQA 3AZJD 3WKJC 5CHLB 5B0YA 4J8VD 3KUYA 3X1SB 3F6TA 5B24D 3LZ1B 5GSUD 4LD9D 3AZED 5AVCB 1EQZB 4H9SC 1M18C 3A6NA 1JFIA 3WKJB 4J8XA 3EPJA 2Y2QA 4H9QB 3AZNC 1U35A 1ULYA 4DRBA 3W98C 3REKC 1KX3C 5B32D 5GT3C 1P3GD 1M18B 3O62C 2PYOA 5G49A 2HIOC 4QLCC 3LJAC 1P3MA 3AZNB 4R8PC 3MGQD 4H9RA 5AVBD 5B1MC 1P3KA 3REKB 4M6BA 3LZ0B 4Z2MH 3LELD 1KX3B 3W98B 2NZDC 2Y2PA 1HQ3D 1TAFB 2Y2NA 4H9PA 2HIOB 2XD1A 5B2ID 3LJAB 3X1UD 5AY8A 4JJNA 5BO0A 4H9OA 3W99C 4R8PB 5B1MB 4XUJD 2NZDB 1KX5D 5JA4B 3AYWD 3UT9C 1B67A 2YFVA 3A6NC 5AV8D 5AV5C 4KGCA 3NQJA 3AZHC 3W97D 3W99B 3C1CD 3REHD 3X1VA 3UT9B 4ZUXD 4NFTA 3A6NB 2G5IC 3FDDA 5AV5B 1EQZD 3AV2A 3AZKA 1ID3D 3AZHB 3KXBA 5BS7A 3MGRD 3AZFD 4H9NA 3C1BC 1ZLAC 2DF4C 3B6FA 5AY8C 3REID 2RVQD 5CPID 3UTBD 3MVDC 4YM6A 5BNVB 4UPKA 3KSYA 1S32D 3C1BB 5B40A 5BNXA 3MGQA 5AVBA 5E5AA 3LZ0D 1M19A 3AN2A 5AY8B 3AFAA 1P3BC 1P3FA 5BO0B 5AV6D 4Z5TC 4H9OB 3MVDB 3MNND 2F8NA 4J8VC 4E44A 5AV9D 3X1VC 5B24C 2ZY3A 5GSUC 3X1TA 4WV4B 3AZEC 1F66D 4LD9C 4NE5A 3EPHA 2NZDD 1PZRA 5GT0D 2Y2HA 3MGPD 1P3BB 4Z66A 5B0YD 4J8VB 3KUYD 3X1VB 3WAAA 1TZYA 3EG5B 5B24B 4WU9A 5GSUB 4KHAB 3AZEB 3C1CA 3WA9A 4LD9B 1BH9A 5B32C 1P3GC 3A6ND 3B0CW 3RELA 3H0RC 4J8XD 3AL0C 1U35D 5B40C 5B31G 3MGQC 5AVBC 1M19C 5B32B 3AFAC 3LELC 1P3GB 1HQ3C 1WWSA 2PYOD 4EO5C 4YM6B 3X1UC 1P3MD 1F1EA 1P3AA 3P5JB 5B40B 5BNXB 3MGQB 5AVBB 5E5AB 4XUJC 1P3IA 1P3KD 1M19B 2L5AA 3AFAB 2BYKB 4X23A 3LELB 3AYWC 1HQ3B 1KX5C 2Y2MA 3REJA 5AV8C 4EO5B 3MGSA 5CPKA 5AY8D 4JJND 5B31A 3X1UB 2F8NB 3VH5W 1BFMA 3A1IA 4HGAC 3W97C 2BYMB 5KDMA 3C1CC 3REHC 4XUJB 1KX5B 3AYWB 4ZUXC 1H3OA 5AV8B 4KGCD 2ZM5A 1ID3C 3TU4A 4HGAB 3W97B 1TZYB 3MGRC 3C1CB 3REHB 3AZFC 2AROA 3X1VD 3WTPD 2DQNC 4ZUXB 3AV2D 3VH5A 3AZKD 3REIC 3KXBD 1ID3B 2RVQC 5CPIC 3W96A 3UTBC 3MGRB 4XZQA 3AZFB 1B6WA 5FUGA 1S32C 3LZ0C 3B6FD 5F99A 5AV6C 3REIB 5CPIB 3UTBB 2FJ7A 4YM6D 3MNNC 2G5HC 2Y2IA 5AV9C 5BT1D 1S32B 5B40D 1F66C 1M19D 5E5AD 4NE3A 5B0ZA 4CSRA 5GT0C 3AFAD 3MGPC 3AN2D 1P3FD 4G91C 5AV6B 1KX4A 3IP4C 1P34A 4WNNA 2F8ND 5B0YC 5KDMB 3MNNB 3KUYC 5AV9B 4J8WA 5JRGA 2CV5A 1M1AA 3X1TD 3UTAA 1F66B 4DRAA 5GT0B 3MGPB 5C3IC 4G91B 3TU4B 4Z66D 4J8XC 4G92B 5B0YB 1KU5A 3KUYB 3WAAD 1TZYD 4WU9D 1U35C 3WA9D 5B1LA 3AZIA 3KWQA 1R4VA 4WZSB 3WTPA 5C3IB 2PYOC 2FJ7C 3RELD 1JFIB 4J8XB 4AWLC 1P3MC 1AOIA 1Z2CB 2Y2KA 1U35B 1A7WA 1P3KC 4CAYA 1KX4C 2PYOB 2FJ7B 5G49B 4JJNC 2UWXA 1WWIA 4AWLB 1P3MB 1P3AD 1N1JA 5B33A 2NQBA 2W8SA 1P3OA 4H9RB 1P3ID 5B32G 1P3KB 4X23D 3R45A 4UUZA 3EPKA 3REJD 1KX4B 4H9PB 3KFUG 4KGCC 4WNNB 3V9RA 3MGSD 5CPKD 5B31D 4JJNB 5GXQA 3EPLA 2YFWA 3WTPC 2Y2LA 2YFVB 4KGCB 3AV2C 3NQJB 3AZKC 3KXBC 3TU4D 4DQYB 5BS7C 3NQUA 3VH6T 4WU8A 2AROD 3WTPB 3B6FC 3AV2B 5DNMA 3AZKB 3KXBB 3W96D 5B2JA 4YM6C 3B6GA 4XZQD 4H9NB 5BT1C 2J8PA 5CP6A 5E5AC 5CPJA 3AN2C 3B6FB 1P3FC 5F99D 3B0DC 2IO5C 5DNNA
chains in the Genus database with same CATH topology
3AZGA 3AZLA 4J8UA 3X1TC 5B0ZD 2BG1A 3AN2B 1P3FB 3X1SA 1KX4D 3B0DB 2IO5B 1P34D 3LZ1A 4Z66C 5AVCA 2YFWB 4J8WD 5JRGD 3WAAC 2CV5D 4ZBJC 1TZYC 3UTAD 4WU9C 3X1TB 1M1AD 3WA9C 4H9QA 3RELC 4Z66B 4YS3A 4H9SA 1M18A 3WAAB 4ZBJB 4WU9B 3WA9B 5B1LD 3AZID 1BH9B 3KWQD 4KUDA 2JSSA 3AZNA 3RELB 3W98A 3REKA 3AV1D 5GT3A 1P3AC 1AOID 3AZLC 1TAFA 3O62A 4Z2MG 4QLCA 2JE5A 3LJAA 1P3IC 1P3PA 4X23C 3AZMA 3REJC 3B0BA 5CPKC 3MGSC 4R8PA 5B31C 5B1MA 4WJ3C 1P3AB 5JA4A 3AZLB 5B33D 2NQBD 1P3OD 1P3IB 4X23B 2FFFB 3REJB 3W99A 4YS3C 5CPKB 3MGSB 5B31B 1T3UA 2F8NK 3TU4C 3UT9A 4G92C 5AV5A 5GXQD 2AROC 4KUDC 3AZHA 1H3OB 4YS3B 2VQRA 3W96C 1P3LA 4WU8D 1P3PC 2HUEC 4XZQC 2AROB 3AZMC 4KUDB 5BNVA 5DNMD 5F99C 2FJ7D 5GT3B 5B2JD 3W96B 3O62B 3C1BA 1ZLAA 3B6GD 4QLCB 2HUEB 4XZQB 1P3PB 3AV1A 3AZMB 5FUGB 5CP6D 3MVDA 5B0ZC 1BH8A 5CPJD 2JCHA 5F99B 5DNND 1P34C 1P3BA 4J8WC 3AZGD 5JRGC 3AZLD 4J8UD 2CV5C 3UTAC 1M1AC 4Z5TA 3AZJA 5B0ZB 3H0MC 4CSRB 4J8VA 3X1SD 3H0LC 3LZ1D 1P3LC 1P34B 5B24A 5GSUA 4KHAA 3AZEA 4LD9A 5AVCD 3A1KA 4J8WB 5JRGB 2CV5B 1M1AB 3UTAB 2Y2JA 3WKJD 5B1LC 3AZIC 3KWQC 2F8NG 1P3LB 4YS3D 2XD5A 5B32A 3AV1C 1P3GA 1M18D 1AOIC 2CWEA 5B1LB 3AZIB 3KWQB 4KUDD 3AZND 2ZY5A 1ZLAB 3W98D 3REKD 1KX3D 5GT3D 4E45A 3LELA 2BYKA 3AV1B 3O62D 1AOIB 1HQ3A 5B33C 2NQBC 3AZJC 2HIOD 1HTAA 4QLCD 3LJAD 5B2IA 1BH8B 1P3OC 3X1UA 1P3PD 3AZMD 3B0CT 4CAYB 2BYMA 4R8PD 3VH6W 5B1MD 4NE6A 4XUJA 1KX5A 3AYWA 1N1JB 5B33B 2NQBB 4Z5TB 5AV8A 3AZJB 1P3OB 5GXQC 2ZY2A 2Y2GA 3R45B 4UUZB 3W97A 3W99D 3V9RB 3REHA 3WTPE 3UT9D 4ZUXA 5AV5D 4WU8C 1EQZA 5GXQB 2F8NH 3AZHD 2ZY4A 1ID3A 3WKJA 3VH6A 3MGRA 3VH5T 5DNMC 3AZFA 5B2JC 2Y2OA 1P3LD 3NQUB 3B6GC 4WU8B 5B2IC 3REIA 5CPIA 3UTBA 5CP6C 5CPJC 1Q9CA 5DNMB 5DNNC 5B2JB 3C1BD 1S32A 1ZLAD 3B6GB 3LZ0A 5B2IB 1KX3A 3AZGC 5AV6A 4J8UC 3MVDD 5CP6B 2HIOA 3MNNA 2F2AC 5CPJB 5AV9A 3X1SC 1W2EA 5DNNB 3LZ1C 1F66A 2LY8A 5AVCC 1EQZC 2NZDA 5GT0A 3MGPA 1P3BD 3AZGB 4J8UB 4Z5TD 2RIQA 3AZJD 3WKJC 5CHLB 5B0YA 4J8VD 3KUYA 3X1SB 3F6TA 5B24D 3LZ1B 5GSUD 4LD9D 3AZED 5AVCB 1EQZB 4H9SC 1M18C 3A6NA 1JFIA 3WKJB 4J8XA 3EPJA 2Y2QA 4H9QB 3AZNC 1U35A 1ULYA 4DRBA 3W98C 3REKC 1KX3C 5B32D 5GT3C 1P3GD 1M18B 3O62C 2PYOA 5G49A 2HIOC 4QLCC 3LJAC 1P3MA 3AZNB 4R8PC 3MGQD 4H9RA 5AVBD 5B1MC 1P3KA 3REKB 4M6BA 3LZ0B 4Z2MH 3LELD 1KX3B 3W98B 2NZDC 2Y2PA 1HQ3D 1TAFB 2Y2NA 4H9PA 2HIOB 2XD1A 5B2ID 3LJAB 3X1UD 5AY8A 4JJNA 5BO0A 4H9OA 3W99C 4R8PB 5B1MB 4XUJD 2NZDB 1KX5D 5JA4B 3AYWD 3UT9C 1B67A 2YFVA 3A6NC 5AV8D 5AV5C 4KGCA 3NQJA 3AZHC 3W97D 3W99B 3C1CD 3REHD 3X1VA 3UT9B 4ZUXD 4NFTA 3A6NB 2G5IC 3FDDA 5AV5B 1EQZD 3AV2A 3AZKA 1ID3D 3AZHB 3KXBA 5BS7A 3MGRD 3AZFD 4H9NA 3C1BC 1ZLAC 2DF4C 3B6FA 5AY8C 3REID 2RVQD 5CPID 3UTBD 3MVDC 4YM6A 5BNVB 4UPKA 3KSYA 1S32D 3C1BB 5B40A 5BNXA 3MGQA 5AVBA 5E5AA 3LZ0D 1M19A 3AN2A 5AY8B 3AFAA 1P3BC 1P3FA 5BO0B 5AV6D 4Z5TC 4H9OB 3MVDB 3MNND 2F8NA 4J8VC 4E44A 5AV9D 3X1VC 5B24C 2ZY3A 5GSUC 3X1TA 4WV4B 3AZEC 1F66D 4LD9C 4NE5A 3EPHA 2NZDD 1PZRA 5GT0D 2Y2HA 3MGPD 1P3BB 4Z66A 5B0YD 4J8VB 3KUYD 3X1VB 3WAAA 1TZYA 3EG5B 5B24B 4WU9A 5GSUB 4KHAB 3AZEB 3C1CA 3WA9A 4LD9B 1BH9A 5B32C 1P3GC 3A6ND 3B0CW 3RELA 3H0RC 4J8XD 3AL0C 1U35D 5B40C 5B31G 3MGQC 5AVBC 1M19C 5B32B 3AFAC 3LELC 1P3GB 1HQ3C 1WWSA 2PYOD 4EO5C 4YM6B 3X1UC 1P3MD 1F1EA 1P3AA 3P5JB 5B40B 5BNXB 3MGQB 5AVBB 5E5AB 4XUJC 1P3IA 1P3KD 1M19B 2L5AA 3AFAB 2BYKB 4X23A 3LELB 3AYWC 1HQ3B 1KX5C 2Y2MA 3REJA 5AV8C 4EO5B 3MGSA 5CPKA 5AY8D 4JJND 5B31A 3X1UB 2F8NB 3VH5W 1BFMA 3A1IA 4HGAC 3W97C 2BYMB 5KDMA 3C1CC 3REHC 4XUJB 1KX5B 3AYWB 4ZUXC 1H3OA 5AV8B 4KGCD 2ZM5A 1ID3C 3TU4A 4HGAB 3W97B 1TZYB 3MGRC 3C1CB 3REHB 3AZFC 2AROA 3X1VD 3WTPD 2DQNC 4ZUXB 3AV2D 3VH5A 3AZKD 3REIC 3KXBD 1ID3B 2RVQC 5CPIC 3W96A 3UTBC 3MGRB 4XZQA 3AZFB 1B6WA 5FUGA 1S32C 3LZ0C 3B6FD 5F99A 5AV6C 3REIB 5CPIB 3UTBB 2FJ7A 4YM6D 3MNNC 2G5HC 2Y2IA 5AV9C 5BT1D 1S32B 5B40D 1F66C 1M19D 5E5AD 4NE3A 5B0ZA 4CSRA 5GT0C 3AFAD 3MGPC 3AN2D 1P3FD 4G91C 5AV6B 1KX4A 3IP4C 1P34A 4WNNA 2F8ND 5B0YC 5KDMB 3MNNB 3KUYC 5AV9B 4J8WA 5JRGA 2CV5A 1M1AA 3X1TD 3UTAA 1F66B 4DRAA 5GT0B 3MGPB 5C3IC 4G91B 3TU4B 4Z66D 4J8XC 4G92B 5B0YB 1KU5A 3KUYB 3WAAD 1TZYD 4WU9D 1U35C 3WA9D 5B1LA 3AZIA 3KWQA 1R4VA 4WZSB 3WTPA 5C3IB 2PYOC 2FJ7C 3RELD 1JFIB 4J8XB 4AWLC 1P3MC 1AOIA 1Z2CB 2Y2KA 1U35B 1A7WA 1P3KC 4CAYA 1KX4C 2PYOB 2FJ7B 5G49B 4JJNC 2UWXA 1WWIA 4AWLB 1P3MB 1P3AD 1N1JA 5B33A 2NQBA 2W8SA 1P3OA 4H9RB 1P3ID 5B32G 1P3KB 4X23D 3R45A 4UUZA 3EPKA 3REJD 1KX4B 4H9PB 3KFUG 4KGCC 4WNNB 3V9RA 3MGSD 5CPKD 5B31D 4JJNB 5GXQA 3EPLA 2YFWA 3WTPC 2Y2LA 2YFVB 4KGCB 3AV2C 3NQJB 3AZKC 3KXBC 3TU4D 4DQYB 5BS7C 3NQUA 3VH6T 4WU8A 2AROD 3WTPB 3B6FC 3AV2B 5DNMA 3AZKB 3KXBB 3W96D 5B2JA 4YM6C 3B6GA 4XZQD 4H9NB 5BT1C 2J8PA 5CP6A 5E5AC 5CPJA 3AN2C 3B6FB 1P3FC 5F99D 3B0DC 2IO5C 5DNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG A;  3AZL A;  4J8U A;  3X1T C;  5B0Z D;  3AN2 B;  1P3F B;  3X1S A;  1KX4 D;  3B0D B;  2IO5 B;  1P34 D;  3LZ1 A;  4Z66 C;  5AVC A;  2YFW B;  4J8W D;  5JRG D;  3WAA C;  2CV5 D;  4ZBJ C;  1TZY C;  3UTA D;  4WU9 C;  3X1T B;  1M1A D;  3WA9 C;  4H9Q A;  3REL C;  4Z66 B;  4YS3 A;  4H9S A;  1M18 A;  3WAA B;  4ZBJ B;  4WU9 B;  3WA9 B;  5B1L D;  3AZI D;  1BH9 B;  3KWQ D;  4KUD A;  2JSS A;  3AZN A;  3REL B;  3W98 A;  3REK A;  3AV1 D;  5GT3 A;  1P3A C;  1AOI D;  3AZL C;  1TAF A;  3O62 A;  4Z2M G;  4QLC A;  1P3I C;  3LJA A;  1P3P A;  4X23 C;  3AZM A;  3REJ C;  3B0B A;  5CPK C;  3MGS C;  4R8P A;  5B31 C;  5B1M A;  1P3A B;  5JA4 A;  3AZL B;  5B33 D;  2NQB D;  1P3O D;  1P3I B;  4X23 B;  3REJ B;  3W99 A;  4YS3 C;  5CPK B;  3MGS B;  5B31 B;  2F8N K;  3TU4 C;  3UT9 A;  4G92 C;  5AV5 A;  5GXQ D;  2ARO C;  4KUD C;  3AZH A;  1H3O B;  4YS3 B;  3W96 C;  1P3L A;  4WU8 D;  1P3P C;  2HUE C;  4XZQ C;  2ARO B;  3AZM C;  4KUD B;  5BNV A;  5DNM D;  5F99 C;  2FJ7 D;  5GT3 B;  5B2J D;  3W96 B;  3O62 B;  3C1B A;  1ZLA A;  3B6G D;  4QLC B;  2HUE B;  4XZQ B;  1P3P B;  3AV1 A;  3AZM B;  5FUG B;  5CP6 D;  3MVD A;  5B0Z C;  1BH8 A;  5CPJ D;  5F99 B;  5DNN D;  1P34 C;  1P3B A;  4J8W C;  3AZG D;  5JRG C;  3AZL D;  4J8U D;  2CV5 C;  3UTA C;  1M1A C;  4Z5T A;  3AZJ A;  5B0Z B;  4CSR B;  4J8V A;  3X1S D;  3LZ1 D;  1P3L C;  1P34 B;  5B24 A;  5GSU A;  4KHA A;  3AZE A;  4LD9 A;  5AVC D;  4J8W B;  5JRG B;  2CV5 B;  1M1A B;  3UTA B;  3WKJ D;  5B1L C;  3AZI C;  3KWQ C;  2F8N G;  1P3L B;  4YS3 D;  5B32 A;  3AV1 C;  1P3G A;  1M18 D;  1AOI C;  2CWE A;  5B1L B;  3AZI B;  3KWQ B;  4KUD D;  3AZN D;  1ZLA B;  3W98 D;  3REK D;  1KX3 D;  5GT3 D;  4E45 A;  3LEL A;  2BYK A;  3AV1 B;  3O62 D;  1AOI B;  1HQ3 A;  5B33 C;  2NQB C;  3AZJ C;  2HIO D;  1HTA A;  4QLC D;  3LJA D;  5B2I A;  1BH8 B;  1P3O C;  3X1U A;  1P3P D;  3AZM D;  3B0C T;  4CAY B;  2BYM A;  4R8P D;  3VH6 W;  5B1M D;  4NE6 A;  4XUJ A;  1KX5 A;  3AYW A;  1N1J B;  5B33 B;  2NQB B;  4Z5T B;  5AV8 A;  3AZJ B;  1P3O B;  5GXQ C;  3R45 B;  4UUZ B;  3W97 A;  3W99 D;  3V9R B;  3REH A;  3WTP E;  3UT9 D;  4ZUX A;  5AV5 D;  4WU8 C;  1EQZ A;  5GXQ B;  2F8N H;  3AZH D;  1ID3 A;  3WKJ A;  3VH6 A;  3MGR A;  3VH5 T;  5DNM C;  3AZF A;  5B2J C;  1P3L D;  3NQU B;  3B6G C;  4WU8 B;  5B2I C;  3REI A;  5CPI A;  3UTB A;  5CP6 C;  5CPJ C;  1Q9C A;  5DNM B;  5DNN C;  5B2J B;  3C1B D;  1S32 A;  1ZLA D;  3B6G B;  3LZ0 A;  5B2I B;  1KX3 A;  3AZG C;  5AV6 A;  4J8U C;  3MVD D;  5CP6 B;  2HIO A;  3MNN A;  5CPJ B;  5AV9 A;  3X1S C;  5DNN B;  3LZ1 C;  1F66 A;  2LY8 A;  5AVC C;  1EQZ C;  2NZD A;  5GT0 A;  3MGP A;  1P3B D;  3AZG B;  4J8U B;  4Z5T D;  3WKJ C;  3AZJ D;  5CHL B;  5B0Y A;  4J8V D;  3KUY A;  3X1S B;  5B24 D;  3LZ1 B;  5GSU D;  4LD9 D;  3AZE D;  5AVC B;  1EQZ B;  4H9S C;  1M18 C;  3A6N A;  1JFI A;  3WKJ B;  4J8X A;  4H9Q B;  3AZN C;  1U35 A;  1ULY A;  4DRB A;  3W98 C;  3REK C;  1KX3 C;  5B32 D;  5GT3 C;  1P3G D;  1M18 B;  3O62 C;  2PYO A;  5G49 A;  2HIO C;  4QLC C;  3LJA C;  1P3M A;  3AZN B;  4R8P C;  3MGQ D;  4H9R A;  5AVB D;  5B1M C;  1P3K A;  3REK B;  4M6B A;  3LZ0 B;  4Z2M H;  3LEL D;  1KX3 B;  3W98 B;  2NZD C;  1HQ3 D;  1TAF B;  4H9P A;  2HIO B;  5B2I D;  3LJA B;  3X1U D;  5AY8 A;  4JJN A;  5BO0 A;  4H9O A;  3W99 C;  4R8P B;  5B1M B;  4XUJ D;  2NZD B;  1KX5 D;  5JA4 B;  3AYW D;  3UT9 C;  1B67 A;  2YFV A;  3A6N C;  5AV8 D;  5AV5 C;  4KGC A;  3NQJ A;  3AZH C;  3W97 D;  3W99 B;  3C1C D;  3REH D;  3X1V A;  3UT9 B;  4ZUX D;  4NFT A;  3A6N B;  5AV5 B;  1EQZ D;  3AV2 A;  3AZK A;  1ID3 D;  3AZH B;  3KXB A;  5BS7 A;  3MGR D;  3AZF D;  4H9N A;  3C1B C;  1ZLA C;  3B6F A;  5AY8 C;  3REI D;  2RVQ D;  5CPI D;  3UTB D;  3MVD C;  4YM6 A;  5BNV B;  3KSY A;  1S32 D;  3C1B B;  5B40 A;  5BNX A;  3MGQ A;  5AVB A;  5E5A A;  3LZ0 D;  1M19 A;  3AN2 A;  5AY8 B;  3AFA A;  1P3B C;  1P3F A;  5BO0 B;  5AV6 D;  4Z5T C;  4H9O B;  3MVD B;  3MNN D;  2F8N A;  4J8V C;  4E44 A;  5AV9 D;  3X1V C;  5B24 C;  3X1T A;  5GSU C;  4LD9 C;  4WV4 B;  3AZE C;  1F66 D;  4NE5 A;  2NZD D;  5GT0 D;  3MGP D;  1P3B B;  4Z66 A;  5B0Y D;  4J8V B;  3KUY D;  3X1V B;  3WAA A;  1TZY A;  4WU9 A;  5B24 B;  3WA9 A;  5GSU B;  4KHA B;  3AZE B;  3C1C A;  4LD9 B;  1BH9 A;  5B32 C;  1P3G C;  3A6N D;  3B0C W;  3REL A;  4J8X D;  1U35 D;  5B40 C;  5B31 G;  3MGQ C;  5AVB C;  1M19 C;  5B32 B;  3AFA C;  3LEL C;  1P3G B;  1HQ3 C;  1WWS A;  2PYO D;  4EO5 C;  4YM6 B;  3X1U C;  1P3M D;  1F1E A;  1P3A A;  5B40 B;  5BNX B;  3MGQ B;  5AVB B;  5E5A B;  4XUJ C;  1P3I A;  1P3K D;  1M19 B;  2L5A A;  3AFA B;  2BYK B;  4X23 A;  3LEL B;  3AYW C;  1HQ3 B;  1KX5 C;  3REJ A;  5AV8 C;  4EO5 B;  3MGS A;  5CPK A;  5AY8 D;  4JJN D;  5B31 A;  3X1U B;  2F8N B;  3VH5 W;  1BFM A;  4HGA C;  3W97 C;  2BYM B;  5KDM A;  3C1C C;  3REH C;  4XUJ B;  1KX5 B;  3AYW B;  4ZUX C;  1H3O A;  5AV8 B;  4KGC D;  1ID3 C;  3TU4 A;  4HGA B;  3W97 B;  1TZY B;  3MGR C;  3C1C B;  3REH B;  3AZF C;  2ARO A;  3X1V D;  3WTP D;  4ZUX B;  3AV2 D;  3VH5 A;  3AZK D;  3REI C;  3KXB D;  1ID3 B;  2RVQ C;  5CPI C;  3W96 A;  3UTB C;  3MGR B;  4XZQ A;  3AZF B;  1B6W A;  5FUG A;  1S32 C;  3LZ0 C;  3B6F D;  5F99 A;  5AV6 C;  3REI B;  5CPI B;  3UTB B;  2FJ7 A;  4YM6 D;  3MNN C;  5AV9 C;  5BT1 D;  1S32 B;  5B40 D;  1F66 C;  1M19 D;  5E5A D;  4NE3 A;  5B0Z A;  4CSR A;  5GT0 C;  3AFA D;  3MGP C;  3AN2 D;  1P3F D;  4G91 C;  5AV6 B;  1KX4 A;  1P34 A;  4WNN A;  2F8N D;  5B0Y C;  5KDM B;  3MNN B;  3KUY C;  5AV9 B;  4J8W A;  5JRG A;  2CV5 A;  1M1A A;  3X1T D;  3UTA A;  1F66 B;  4DRA A;  5GT0 B;  3MGP B;  5C3I C;  4G91 B;  3TU4 B;  4Z66 D;  4J8X C;  4G92 B;  5B0Y B;  1KU5 A;  3KUY B;  3WAA D;  1TZY D;  4WU9 D;  1U35 C;  3WA9 D;  5B1L A;  3AZI A;  3KWQ A;  1R4V A;  4WZS B;  3WTP A;  5C3I B;  2PYO C;  2FJ7 C;  3REL D;  1JFI B;  4J8X B;  4AWL C;  1P3M C;  1AOI A;  1U35 B;  1A7W A;  1P3K C;  4CAY A;  1KX4 C;  2PYO B;  2FJ7 B;  5G49 B;  4JJN C;  1WWI A;  4AWL B;  1P3M B;  1P3A D;  1N1J A;  5B33 A;  2NQB A;  1P3O A;  4H9R B;  1P3I D;  5B32 G;  1P3K B;  4X23 D;  3R45 A;  4UUZ A;  1KX4 B;  3REJ D;  4H9P B;  4KGC C;  4WNN B;  3V9R A;  3MGS D;  5CPK D;  5B31 D;  4JJN B;  5GXQ A;  2YFW A;  3WTP C;  2YFV B;  4KGC B;  3AV2 C;  3NQJ B;  3AZK C;  3KXB C;  3TU4 D;  5BS7 C;  3NQU A;  3VH6 T;  4WU8 A;  2ARO D;  3WTP B;  3B6F C;  3AV2 B;  5DNM A;  3AZK B;  3KXB B;  3W96 D;  5B2J A;  4YM6 C;  3B6G A;  4XZQ D;  4H9N B;  5BT1 C;  5CP6 A;  5E5A C;  5CPJ A;  3AN2 C;  3B6F B;  1P3F C;  5F99 D;  3B0D C;  2IO5 C;  5DNN A; 
#chains in the Genus database with same CATH topology
 3AZG A;  3AZL A;  4J8U A;  3X1T C;  5B0Z D;  2BG1 A;  3AN2 B;  1P3F B;  3X1S A;  1KX4 D;  3B0D B;  2IO5 B;  1P34 D;  3LZ1 A;  4Z66 C;  5AVC A;  2YFW B;  4J8W D;  5JRG D;  3WAA C;  2CV5 D;  4ZBJ C;  1TZY C;  3UTA D;  4WU9 C;  3X1T B;  1M1A D;  3WA9 C;  4H9Q A;  3REL C;  4Z66 B;  4YS3 A;  4H9S A;  1M18 A;  3WAA B;  4ZBJ B;  4WU9 B;  3WA9 B;  5B1L D;  3AZI D;  1BH9 B;  3KWQ D;  4KUD A;  2JSS A;  3AZN A;  3REL B;  3W98 A;  3REK A;  3AV1 D;  5GT3 A;  1P3A C;  1AOI D;  3AZL C;  1TAF A;  3O62 A;  4Z2M G;  4QLC A;  2JE5 A;  3LJA A;  1P3I C;  1P3P A;  4X23 C;  3AZM A;  3REJ C;  3B0B A;  5CPK C;  3MGS C;  4R8P A;  5B31 C;  5B1M A;  4WJ3 C;  1P3A B;  5JA4 A;  3AZL B;  5B33 D;  2NQB D;  1P3O D;  1P3I B;  4X23 B;  2FFF B;  3REJ B;  3W99 A;  4YS3 C;  5CPK B;  3MGS B;  5B31 B;  1T3U A;  2F8N K;  3TU4 C;  3UT9 A;  4G92 C;  5AV5 A;  5GXQ D;  2ARO C;  4KUD C;  3AZH A;  1H3O B;  4YS3 B;  2VQR A;  3W96 C;  1P3L A;  4WU8 D;  1P3P C;  2HUE C;  4XZQ C;  2ARO B;  3AZM C;  4KUD B;  5BNV A;  5DNM D;  5F99 C;  2FJ7 D;  5GT3 B;  5B2J D;  3W96 B;  3O62 B;  3C1B A;  1ZLA A;  3B6G D;  4QLC B;  2HUE B;  4XZQ B;  1P3P B;  3AV1 A;  3AZM B;  5FUG B;  5CP6 D;  3MVD A;  5B0Z C;  1BH8 A;  5CPJ D;  2JCH A;  5F99 B;  5DNN D;  1P34 C;  1P3B A;  4J8W C;  3AZG D;  5JRG C;  3AZL D;  4J8U D;  2CV5 C;  3UTA C;  1M1A C;  4Z5T A;  3AZJ A;  5B0Z B;  3H0M C;  4CSR B;  4J8V A;  3X1S D;  3H0L C;  3LZ1 D;  1P3L C;  1P34 B;  5B24 A;  5GSU A;  4KHA A;  3AZE A;  4LD9 A;  5AVC D;  3A1K A;  4J8W B;  5JRG B;  2CV5 B;  1M1A B;  3UTA B;  2Y2J A;  3WKJ D;  5B1L C;  3AZI C;  3KWQ C;  2F8N G;  1P3L B;  4YS3 D;  2XD5 A;  5B32 A;  3AV1 C;  1P3G A;  1M18 D;  1AOI C;  2CWE A;  5B1L B;  3AZI B;  3KWQ B;  4KUD D;  3AZN D;  2ZY5 A;  1ZLA B;  3W98 D;  3REK D;  1KX3 D;  5GT3 D;  4E45 A;  3LEL A;  2BYK A;  3AV1 B;  3O62 D;  1AOI B;  1HQ3 A;  5B33 C;  2NQB C;  3AZJ C;  2HIO D;  1HTA A;  4QLC D;  3LJA D;  5B2I A;  1BH8 B;  1P3O C;  3X1U A;  1P3P D;  3AZM D;  3B0C T;  4CAY B;  2BYM A;  4R8P D;  3VH6 W;  5B1M D;  4NE6 A;  4XUJ A;  1KX5 A;  3AYW A;  1N1J B;  5B33 B;  2NQB B;  4Z5T B;  5AV8 A;  3AZJ B;  1P3O B;  5GXQ C;  2ZY2 A;  2Y2G A;  3R45 B;  4UUZ B;  3W97 A;  3W99 D;  3V9R B;  3REH A;  3WTP E;  3UT9 D;  4ZUX A;  5AV5 D;  4WU8 C;  1EQZ A;  5GXQ B;  2F8N H;  3AZH D;  2ZY4 A;  1ID3 A;  3WKJ A;  3VH6 A;  3MGR A;  3VH5 T;  5DNM C;  3AZF A;  5B2J C;  2Y2O A;  1P3L D;  3NQU B;  3B6G C;  4WU8 B;  5B2I C;  3REI A;  5CPI A;  3UTB A;  5CP6 C;  5CPJ C;  1Q9C A;  5DNM B;  5DNN C;  5B2J B;  3C1B D;  1S32 A;  1ZLA D;  3B6G B;  3LZ0 A;  5B2I B;  1KX3 A;  3AZG C;  5AV6 A;  4J8U C;  3MVD D;  5CP6 B;  2HIO A;  3MNN A;  2F2A C;  5CPJ B;  5AV9 A;  3X1S C;  1W2E A;  5DNN B;  3LZ1 C;  1F66 A;  2LY8 A;  5AVC C;  1EQZ C;  2NZD A;  5GT0 A;  3MGP A;  1P3B D;  3AZG B;  4J8U B;  4Z5T D;  2RIQ A;  3AZJ D;  3WKJ C;  5CHL B;  5B0Y A;  4J8V D;  3KUY A;  3X1S B;  3F6T A;  5B24 D;  3LZ1 B;  5GSU D;  4LD9 D;  3AZE D;  5AVC B;  1EQZ B;  4H9S C;  1M18 C;  3A6N A;  1JFI A;  3WKJ B;  4J8X A;  3EPJ A;  2Y2Q A;  4H9Q B;  3AZN C;  1U35 A;  1ULY A;  4DRB A;  3W98 C;  3REK C;  1KX3 C;  5B32 D;  5GT3 C;  1P3G D;  1M18 B;  3O62 C;  2PYO A;  5G49 A;  2HIO C;  4QLC C;  3LJA C;  1P3M A;  3AZN B;  4R8P C;  3MGQ D;  4H9R A;  5AVB D;  5B1M C;  1P3K A;  3REK B;  4M6B A;  3LZ0 B;  4Z2M H;  3LEL D;  1KX3 B;  3W98 B;  2NZD C;  2Y2P A;  1HQ3 D;  1TAF B;  2Y2N A;  4H9P A;  2HIO B;  2XD1 A;  5B2I D;  3LJA B;  3X1U D;  5AY8 A;  4JJN A;  5BO0 A;  4H9O A;  3W99 C;  4R8P B;  5B1M B;  4XUJ D;  2NZD B;  1KX5 D;  5JA4 B;  3AYW D;  3UT9 C;  1B67 A;  2YFV A;  3A6N C;  5AV8 D;  5AV5 C;  4KGC A;  3NQJ A;  3AZH C;  3W97 D;  3W99 B;  3C1C D;  3REH D;  3X1V A;  3UT9 B;  4ZUX D;  4NFT A;  3A6N B;  2G5I C;  3FDD A;  5AV5 B;  1EQZ D;  3AV2 A;  3AZK A;  1ID3 D;  3AZH B;  3KXB A;  5BS7 A;  3MGR D;  3AZF D;  4H9N A;  3C1B C;  1ZLA C;  2DF4 C;  3B6F A;  5AY8 C;  3REI D;  2RVQ D;  5CPI D;  3UTB D;  3MVD C;  4YM6 A;  5BNV B;  4UPK A;  3KSY A;  1S32 D;  3C1B B;  5B40 A;  5BNX A;  3MGQ A;  5AVB A;  5E5A A;  3LZ0 D;  1M19 A;  3AN2 A;  5AY8 B;  3AFA A;  1P3B C;  1P3F A;  5BO0 B;  5AV6 D;  4Z5T C;  4H9O B;  3MVD B;  3MNN D;  2F8N A;  4J8V C;  4E44 A;  5AV9 D;  3X1V C;  5B24 C;  2ZY3 A;  5GSU C;  3X1T A;  4WV4 B;  3AZE C;  1F66 D;  4LD9 C;  4NE5 A;  3EPH A;  2NZD D;  1PZR A;  5GT0 D;  2Y2H A;  3MGP D;  1P3B B;  4Z66 A;  5B0Y D;  4J8V B;  3KUY D;  3X1V B;  3WAA A;  1TZY A;  3EG5 B;  5B24 B;  4WU9 A;  5GSU B;  4KHA B;  3AZE B;  3C1C A;  3WA9 A;  4LD9 B;  1BH9 A;  5B32 C;  1P3G C;  3A6N D;  3B0C W;  3REL A;  3H0R C;  4J8X D;  3AL0 C;  1U35 D;  5B40 C;  5B31 G;  3MGQ C;  5AVB C;  1M19 C;  5B32 B;  3AFA C;  3LEL C;  1P3G B;  1HQ3 C;  1WWS A;  2PYO D;  4EO5 C;  4YM6 B;  3X1U C;  1P3M D;  1F1E A;  1P3A A;  3P5J B;  5B40 B;  5BNX B;  3MGQ B;  5AVB B;  5E5A B;  4XUJ C;  1P3I A;  1P3K D;  1M19 B;  2L5A A;  3AFA B;  2BYK B;  4X23 A;  3LEL B;  3AYW C;  1HQ3 B;  1KX5 C;  2Y2M A;  3REJ A;  5AV8 C;  4EO5 B;  3MGS A;  5CPK A;  5AY8 D;  4JJN D;  5B31 A;  3X1U B;  2F8N B;  3VH5 W;  1BFM A;  3A1I A;  4HGA C;  3W97 C;  2BYM B;  5KDM A;  3C1C C;  3REH C;  4XUJ B;  1KX5 B;  3AYW B;  4ZUX C;  1H3O A;  5AV8 B;  4KGC D;  2ZM5 A;  1ID3 C;  3TU4 A;  4HGA B;  3W97 B;  1TZY B;  3MGR C;  3C1C B;  3REH B;  3AZF C;  2ARO A;  3X1V D;  3WTP D;  2DQN C;  4ZUX B;  3AV2 D;  3VH5 A;  3AZK D;  3REI C;  3KXB D;  1ID3 B;  2RVQ C;  5CPI C;  3W96 A;  3UTB C;  3MGR B;  4XZQ A;  3AZF B;  1B6W A;  5FUG A;  1S32 C;  3LZ0 C;  3B6F D;  5F99 A;  5AV6 C;  3REI B;  5CPI B;  3UTB B;  2FJ7 A;  4YM6 D;  3MNN C;  2G5H C;  2Y2I A;  5AV9 C;  5BT1 D;  1S32 B;  5B40 D;  1F66 C;  1M19 D;  5E5A D;  4NE3 A;  5B0Z A;  4CSR A;  5GT0 C;  3AFA D;  3MGP C;  3AN2 D;  1P3F D;  4G91 C;  5AV6 B;  1KX4 A;  3IP4 C;  1P34 A;  4WNN A;  2F8N D;  5B0Y C;  5KDM B;  3MNN B;  3KUY C;  5AV9 B;  4J8W A;  5JRG A;  2CV5 A;  1M1A A;  3X1T D;  3UTA A;  1F66 B;  4DRA A;  5GT0 B;  3MGP B;  5C3I C;  4G91 B;  3TU4 B;  4Z66 D;  4J8X C;  4G92 B;  5B0Y B;  1KU5 A;  3KUY B;  3WAA D;  1TZY D;  4WU9 D;  1U35 C;  3WA9 D;  5B1L A;  3AZI A;  3KWQ A;  1R4V A;  4WZS B;  3WTP A;  5C3I B;  2PYO C;  2FJ7 C;  3REL D;  1JFI B;  4J8X B;  4AWL C;  1P3M C;  1AOI A;  1Z2C B;  2Y2K A;  1U35 B;  1A7W A;  1P3K C;  4CAY A;  1KX4 C;  2PYO B;  2FJ7 B;  5G49 B;  4JJN C;  2UWX A;  1WWI A;  4AWL B;  1P3M B;  1P3A D;  1N1J A;  5B33 A;  2NQB A;  2W8S A;  1P3O A;  4H9R B;  1P3I D;  5B32 G;  1P3K B;  4X23 D;  3R45 A;  4UUZ A;  3EPK A;  3REJ D;  1KX4 B;  4H9P B;  3KFU G;  4KGC C;  4WNN B;  3V9R A;  3MGS D;  5CPK D;  5B31 D;  4JJN B;  5GXQ A;  3EPL A;  2YFW A;  3WTP C;  2Y2L A;  2YFV B;  4KGC B;  3AV2 C;  3NQJ B;  3AZK C;  3KXB C;  3TU4 D;  4DQY B;  5BS7 C;  3NQU A;  3VH6 T;  4WU8 A;  2ARO D;  3WTP B;  3B6F C;  3AV2 B;  5DNM A;  3AZK B;  3KXB B;  3W96 D;  5B2J A;  4YM6 C;  3B6G A;  4XZQ D;  4H9N B;  5BT1 C;  2J8P A;  5CP6 A;  5E5A C;  5CPJ A;  3AN2 C;  3B6F B;  1P3F C;  5F99 D;  3B0D C;  2IO5 C;  5DNN A; 
#chains in the Genus database with same CATH homology
 3AZG A;  3AZL A;  4J8U A;  3X1T C;  5B0Z D;  2BG1 A;  3AN2 B;  1P3F B;  3X1S A;  1KX4 D;  3B0D B;  2IO5 B;  1P34 D;  3LZ1 A;  4Z66 C;  5AVC A;  2YFW B;  4J8W D;  5JRG D;  3WAA C;  2CV5 D;  4ZBJ C;  1TZY C;  3UTA D;  4WU9 C;  3X1T B;  1M1A D;  3WA9 C;  4H9Q A;  3REL C;  4Z66 B;  4YS3 A;  4H9S A;  1M18 A;  3WAA B;  4ZBJ B;  4WU9 B;  3WA9 B;  5B1L D;  3AZI D;  1BH9 B;  3KWQ D;  4KUD A;  2JSS A;  3AZN A;  3REL B;  3W98 A;  3REK A;  3AV1 D;  5GT3 A;  1P3A C;  1AOI D;  3AZL C;  1TAF A;  3O62 A;  4Z2M G;  4QLC A;  2JE5 A;  3LJA A;  1P3I C;  1P3P A;  4X23 C;  3AZM A;  3REJ C;  3B0B A;  5CPK C;  3MGS C;  4R8P A;  5B31 C;  5B1M A;  4WJ3 C;  1P3A B;  5JA4 A;  3AZL B;  5B33 D;  2NQB D;  1P3O D;  1P3I B;  4X23 B;  2FFF B;  3REJ B;  3W99 A;  4YS3 C;  5CPK B;  3MGS B;  5B31 B;  1T3U A;  2F8N K;  3TU4 C;  3UT9 A;  4G92 C;  5AV5 A;  5GXQ D;  2ARO C;  4KUD C;  3AZH A;  1H3O B;  4YS3 B;  2VQR A;  3W96 C;  1P3L A;  4WU8 D;  1P3P C;  2HUE C;  4XZQ C;  2ARO B;  3AZM C;  4KUD B;  5BNV A;  5DNM D;  5F99 C;  2FJ7 D;  5GT3 B;  5B2J D;  3W96 B;  3O62 B;  3C1B A;  1ZLA A;  3B6G D;  4QLC B;  2HUE B;  4XZQ B;  1P3P B;  3AV1 A;  3AZM B;  5FUG B;  5CP6 D;  3MVD A;  5B0Z C;  1BH8 A;  5CPJ D;  2JCH A;  5F99 B;  5DNN D;  1P34 C;  1P3B A;  4J8W C;  3AZG D;  5JRG C;  3AZL D;  4J8U D;  2CV5 C;  3UTA C;  1M1A C;  4Z5T A;  3AZJ A;  5B0Z B;  3H0M C;  4CSR B;  4J8V A;  3X1S D;  3H0L C;  3LZ1 D;  1P3L C;  1P34 B;  5B24 A;  5GSU A;  4KHA A;  3AZE A;  4LD9 A;  5AVC D;  3A1K A;  4J8W B;  5JRG B;  2CV5 B;  1M1A B;  3UTA B;  2Y2J A;  3WKJ D;  5B1L C;  3AZI C;  3KWQ C;  2F8N G;  1P3L B;  4YS3 D;  2XD5 A;  5B32 A;  3AV1 C;  1P3G A;  1M18 D;  1AOI C;  2CWE A;  5B1L B;  3AZI B;  3KWQ B;  4KUD D;  3AZN D;  2ZY5 A;  1ZLA B;  3W98 D;  3REK D;  1KX3 D;  5GT3 D;  4E45 A;  3LEL A;  2BYK A;  3AV1 B;  3O62 D;  1AOI B;  1HQ3 A;  5B33 C;  2NQB C;  3AZJ C;  2HIO D;  1HTA A;  4QLC D;  3LJA D;  5B2I A;  1BH8 B;  1P3O C;  3X1U A;  1P3P D;  3AZM D;  3B0C T;  4CAY B;  2BYM A;  4R8P D;  3VH6 W;  5B1M D;  4NE6 A;  4XUJ A;  1KX5 A;  3AYW A;  1N1J B;  5B33 B;  2NQB B;  4Z5T B;  5AV8 A;  3AZJ B;  1P3O B;  5GXQ C;  2ZY2 A;  2Y2G A;  3R45 B;  4UUZ B;  3W97 A;  3W99 D;  3V9R B;  3REH A;  3WTP E;  3UT9 D;  4ZUX A;  5AV5 D;  4WU8 C;  1EQZ A;  5GXQ B;  2F8N H;  3AZH D;  2ZY4 A;  1ID3 A;  3WKJ A;  3VH6 A;  3MGR A;  3VH5 T;  5DNM C;  3AZF A;  5B2J C;  2Y2O A;  1P3L D;  3NQU B;  3B6G C;  4WU8 B;  5B2I C;  3REI A;  5CPI A;  3UTB A;  5CP6 C;  5CPJ C;  1Q9C A;  5DNM B;  5DNN C;  5B2J B;  3C1B D;  1S32 A;  1ZLA D;  3B6G B;  3LZ0 A;  5B2I B;  1KX3 A;  3AZG C;  5AV6 A;  4J8U C;  3MVD D;  5CP6 B;  2HIO A;  3MNN A;  2F2A C;  5CPJ B;  5AV9 A;  3X1S C;  1W2E A;  5DNN B;  3LZ1 C;  1F66 A;  2LY8 A;  5AVC C;  1EQZ C;  2NZD A;  5GT0 A;  3MGP A;  1P3B D;  3AZG B;  4J8U B;  4Z5T D;  2RIQ A;  3AZJ D;  3WKJ C;  5CHL B;  5B0Y A;  4J8V D;  3KUY A;  3X1S B;  3F6T A;  5B24 D;  3LZ1 B;  5GSU D;  4LD9 D;  3AZE D;  5AVC B;  1EQZ B;  4H9S C;  1M18 C;  3A6N A;  1JFI A;  3WKJ B;  4J8X A;  3EPJ A;  2Y2Q A;  4H9Q B;  3AZN C;  1U35 A;  1ULY A;  4DRB A;  3W98 C;  3REK C;  1KX3 C;  5B32 D;  5GT3 C;  1P3G D;  1M18 B;  3O62 C;  2PYO A;  5G49 A;  2HIO C;  4QLC C;  3LJA C;  1P3M A;  3AZN B;  4R8P C;  3MGQ D;  4H9R A;  5AVB D;  5B1M C;  1P3K A;  3REK B;  4M6B A;  3LZ0 B;  4Z2M H;  3LEL D;  1KX3 B;  3W98 B;  2NZD C;  2Y2P A;  1HQ3 D;  1TAF B;  2Y2N A;  4H9P A;  2HIO B;  2XD1 A;  5B2I D;  3LJA B;  3X1U D;  5AY8 A;  4JJN A;  5BO0 A;  4H9O A;  3W99 C;  4R8P B;  5B1M B;  4XUJ D;  2NZD B;  1KX5 D;  5JA4 B;  3AYW D;  3UT9 C;  1B67 A;  2YFV A;  3A6N C;  5AV8 D;  5AV5 C;  4KGC A;  3NQJ A;  3AZH C;  3W97 D;  3W99 B;  3C1C D;  3REH D;  3X1V A;  3UT9 B;  4ZUX D;  4NFT A;  3A6N B;  2G5I C;  3FDD A;  5AV5 B;  1EQZ D;  3AV2 A;  3AZK A;  1ID3 D;  3AZH B;  3KXB A;  5BS7 A;  3MGR D;  3AZF D;  4H9N A;  3C1B C;  1ZLA C;  2DF4 C;  3B6F A;  5AY8 C;  3REI D;  2RVQ D;  5CPI D;  3UTB D;  3MVD C;  4YM6 A;  5BNV B;  4UPK A;  3KSY A;  1S32 D;  3C1B B;  5B40 A;  5BNX A;  3MGQ A;  5AVB A;  5E5A A;  3LZ0 D;  1M19 A;  3AN2 A;  5AY8 B;  3AFA A;  1P3B C;  1P3F A;  5BO0 B;  5AV6 D;  4Z5T C;  4H9O B;  3MVD B;  3MNN D;  2F8N A;  4J8V C;  4E44 A;  5AV9 D;  3X1V C;  5B24 C;  2ZY3 A;  5GSU C;  3X1T A;  4WV4 B;  3AZE C;  1F66 D;  4LD9 C;  4NE5 A;  3EPH A;  2NZD D;  1PZR A;  5GT0 D;  2Y2H A;  3MGP D;  1P3B B;  4Z66 A;  5B0Y D;  4J8V B;  3KUY D;  3X1V B;  3WAA A;  1TZY A;  3EG5 B;  5B24 B;  4WU9 A;  5GSU B;  4KHA B;  3AZE B;  3C1C A;  3WA9 A;  4LD9 B;  1BH9 A;  5B32 C;  1P3G C;  3A6N D;  3B0C W;  3REL A;  3H0R C;  4J8X D;  3AL0 C;  1U35 D;  5B40 C;  5B31 G;  3MGQ C;  5AVB C;  1M19 C;  5B32 B;  3AFA C;  3LEL C;  1P3G B;  1HQ3 C;  1WWS A;  2PYO D;  4EO5 C;  4YM6 B;  3X1U C;  1P3M D;  1F1E A;  1P3A A;  3P5J B;  5B40 B;  5BNX B;  3MGQ B;  5AVB B;  5E5A B;  4XUJ C;  1P3I A;  1P3K D;  1M19 B;  2L5A A;  3AFA B;  2BYK B;  4X23 A;  3LEL B;  3AYW C;  1HQ3 B;  1KX5 C;  2Y2M A;  3REJ A;  5AV8 C;  4EO5 B;  3MGS A;  5CPK A;  5AY8 D;  4JJN D;  5B31 A;  3X1U B;  2F8N B;  3VH5 W;  1BFM A;  3A1I A;  4HGA C;  3W97 C;  2BYM B;  5KDM A;  3C1C C;  3REH C;  4XUJ B;  1KX5 B;  3AYW B;  4ZUX C;  1H3O A;  5AV8 B;  4KGC D;  2ZM5 A;  1ID3 C;  3TU4 A;  4HGA B;  3W97 B;  1TZY B;  3MGR C;  3C1C B;  3REH B;  3AZF C;  2ARO A;  3X1V D;  3WTP D;  2DQN C;  4ZUX B;  3AV2 D;  3VH5 A;  3AZK D;  3REI C;  3KXB D;  1ID3 B;  2RVQ C;  5CPI C;  3W96 A;  3UTB C;  3MGR B;  4XZQ A;  3AZF B;  1B6W A;  5FUG A;  1S32 C;  3LZ0 C;  3B6F D;  5F99 A;  5AV6 C;  3REI B;  5CPI B;  3UTB B;  2FJ7 A;  4YM6 D;  3MNN C;  2G5H C;  2Y2I A;  5AV9 C;  5BT1 D;  1S32 B;  5B40 D;  1F66 C;  1M19 D;  5E5A D;  4NE3 A;  5B0Z A;  4CSR A;  5GT0 C;  3AFA D;  3MGP C;  3AN2 D;  1P3F D;  4G91 C;  5AV6 B;  1KX4 A;  3IP4 C;  1P34 A;  4WNN A;  2F8N D;  5B0Y C;  5KDM B;  3MNN B;  3KUY C;  5AV9 B;  4J8W A;  5JRG A;  2CV5 A;  1M1A A;  3X1T D;  3UTA A;  1F66 B;  4DRA A;  5GT0 B;  3MGP B;  5C3I C;  4G91 B;  3TU4 B;  4Z66 D;  4J8X C;  4G92 B;  5B0Y B;  1KU5 A;  3KUY B;  3WAA D;  1TZY D;  4WU9 D;  1U35 C;  3WA9 D;  5B1L A;  3AZI A;  3KWQ A;  1R4V A;  4WZS B;  3WTP A;  5C3I B;  2PYO C;  2FJ7 C;  3REL D;  1JFI B;  4J8X B;  4AWL C;  1P3M C;  1AOI A;  1Z2C B;  2Y2K A;  1U35 B;  1A7W A;  1P3K C;  4CAY A;  1KX4 C;  2PYO B;  2FJ7 B;  5G49 B;  4JJN C;  2UWX A;  1WWI A;  4AWL B;  1P3M B;  1P3A D;  1N1J A;  5B33 A;  2NQB A;  2W8S A;  1P3O A;  4H9R B;  1P3I D;  5B32 G;  1P3K B;  4X23 D;  3R45 A;  4UUZ A;  3EPK A;  3REJ D;  1KX4 B;  4H9P B;  3KFU G;  4KGC C;  4WNN B;  3V9R A;  3MGS D;  5CPK D;  5B31 D;  4JJN B;  5GXQ A;  3EPL A;  2YFW A;  3WTP C;  2Y2L A;  2YFV B;  4KGC B;  3AV2 C;  3NQJ B;  3AZK C;  3KXB C;  3TU4 D;  4DQY B;  5BS7 C;  3NQU A;  3VH6 T;  4WU8 A;  2ARO D;  3WTP B;  3B6F C;  3AV2 B;  5DNM A;  3AZK B;  3KXB B;  3W96 D;  5B2J A;  4YM6 C;  3B6G A;  4XZQ D;  4H9N B;  5BT1 C;  2J8P A;  5CP6 A;  5E5A C;  5CPJ A;  3AN2 C;  3B6F B;  1P3F C;  5F99 D;  3B0D C;  2IO5 C;  5DNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...