5B24D

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24D00
5B1LA 3REIA 4X23A 3B0DB 5B0ZC 3AZGB 5BT1C 5B33C 3KWQB 5AV6A 3X1UD 5AV6C 4YM6A 3KUYB 4WU9B 3AZFD 3MGQB 5CPIA 4H9OA 2CV5D 3AZLC 3MGQD 3AZMD 3AZEA 3MNNB 3AZEC 5B2JC 3B0CT 5AVCC 1P3GD 5CPKD 4J8UB 5AV8A 3AZFC 3TU4C 3LJAC 3W99D 4J8VA 4J8VB 4ZUXB 4WU8B 1S32C 1S32A 5CP6A 3UTBA 5CPJD 5AY8B 1B6WA 5BO0A 3B6FD 5B2IB 4WNNB 1P34C 5GXQA 3AFAA 4Z66C 3LZ1D 4AWLC 3B6GB 3X1TD 4LD9B 3MGQA 4X23C 5GT0C 4KHAB 1H3OB 3C1BA 3REKD 3C1BB 3KXBC 2HUEC 3KSYA 3KXBA 4HGAB 3AN2B 5B2JA 5AV8D 1KX3D 4KGCB 3TU4A 1KU5A 1ZLAD 3WTPB 4J8XC 5B40A 5AVBA 3MVDA 1P34D 4JJND 1TZYA 3NQUB 3WKJC 3NQUA 5AV9A 4E44A 2YFWA 3UTBC 3UT9B 3AFAD 5FUGB 5B24D 4Z66A 1P3MB 1M19A 3AZJC 4KHAA 3REKA 3AFAC 5GT3D 3REID 3REIB 4J8UD 3AZHB 1U35C 1P3AA 1HTAA 2CV5C 5B1MB 4YS3D 5B1MA 3WAAC 1P3FC 1R4VA 5CPID 4JJNA 3REHC 5B32G 3W96B 4J8WD 3AZIB 3LELA 5E5AB 3V9RB 4WU8D 1F66A 1P3PD 3WKJD 5JRGC 2RVQC 5AVBC 3MVDC 5B40C 5FUGA 3RELD 3AZKC 2BYKB 5AV8B 5B24A 3X1VA 4H9QA 1HQ3A 4ZBJB 5AV5C 3MGRA 3X1SA 5C3IC 2RVQD 1P3PB 2FJ7A 2PYOD 3A6NC 3REKC 4G92B 1EQZB 5GXQD 1ID3C 3AV2C 2NQBC 3LJAD 4WV4B 5F99B 3NQJB 3NQJA 3UTAD 5CHLB 4KUDB 4XUJA 2AROB 5B2JD 3MGSA 3AYWC 1KX3A 3AZHA 1KX4C 1F66C 5B32C 1AOIB 5CPIC 1P3OA 5F99D 3AZLA 4R8PD 5B24C 2CWEA 4E45A 4QLCA 3W96D 1F1EA 2NZDA 3W98D 4CAYB 2HIOD 3AZGD 1B67A 3UTAC 5B24B 2BYKA 5DNMA 4EO5C 1AOIC 5B32B 2IO5B 3AV2A 3MGSD 5GXQC 3AYWD 1ID3D 3O62A 3MGPB 3AZMA 3AZNA 3AZNC 1KX5D 1P3AB 1P3LC 5DNNC 4KGCD 2NQBB 3R45B 1JFIA 3B6GA 1A7WA 4H9NB 1P3BA 1ID3B 1P3IB 3REKB 5AY8D 1ULYA 1P3PC 3A6ND 4X23D 4XZQB 2NZDC 1HQ3D 3REHD 3AV1D 1P3ID 3WTPA 5B40B 5AVBB 3MVDB 3X1TA 5B31D 1KX5A 3V9RA 5B1LC 3O62C 3W96C 3AZMC 3REHB 3AZJD 2F8NB 4H9RA 3WAAB 1P3FD 5BT1D 5B33D 5DNNA 1P3LA 1U35D 3MGPA 3AZMB 3O62B 3AZJB 5B1LB 2F8ND 1P3MC 5B2IA 3VH5T 4J8XA 4ZUXD 4UUZB 5B1LD 3AZKA 4XZQC 3KXBD 2NZDB 5CP6D 4J8UA 1P3IC 5BNXB 5DNND 4KGCC 3WA9D 3LZ1A 5DNNB 4Z2MG 4HGAC 3VH5W 5E5AD 2HUEB 3AN2C 1P3LB 5B0ZA 5AV9D 3C1BC 3LELD 1P3AC 5GT0B 3AZNB 3MGPC 4H9SA 5GXQB 4H9RB 1AOID 2F8NG 2IO5C 4Z66B 4EO5B 1P34B 5G49B 5B2IC 3TU4D 5BNVB 1ZLAA 3UTAB 1P3MD 1S32B 4WU8C 5JRGA 4XZQA 4J8VC 3LJAB 4H9QB 3TU4B 4H9NA 5B0ZD 5CPIB 3AZIA 5AVCB 3MNNC 3AZEB 3MNNA 1F66B 3VH5A 5GT3A 1KX4B 3B0CW 2AROC 3VH6A 3C1CD 3AYWB 3MGQC 5GSUA 1TAFB 5CPJA 4KUDC 3X1VD 5DNMD 5AV6D 3KWQC 5B33B 5F99A 5F99C 4CSRB 3B0DC 3AV2B 3WTPE 1KX3C 2HIOB 1EQZC 5CP6B 4G92C 3LELC 3A6NB 4WNNA 3RELB 3W98A 1BFMA 5C3IB 1M18C 1M18A 5KDMA 4ZBJC 2BYMA 5AV5B 5AV5A 2NQBD 1P3KA 3X1UA 5AV8C 3AZFA 5AVBD 5B40D 3MVDD 4UUZA 4XUJD 5JA4A 3REJB 3AZKB 2FJ7C 5JRGB 1P3AD 5E5AC 3W97D 2LY8A 1P3OB 3AZIC 1Q9CA 4CSRA 3KWQA 4J8WA 1P3FB 4H9OB 4QLCD 1WWSA 5GSUC 3W96A 5B1MC 2CV5B 4NE6A 5AVCD 1KX4A 1S32D 3AZHC 3REIC 1U35B 1EQZA 1WWIA 5B31G 1TAFA 4YM6C 3AFAB 4NE3A 3LZ0D 5B33A 5BNXA 5B0YD 2F8NK 1BH9B 1P3MA 1M19B 5B32D 1P3GC 1P3GA 3UTBB 3UT9C 3C1CB 3WKJA 3LJAA 3WKJB 4J8XD 3WTPC 4J8XB 2BYMB 5KDMB 3AV1C 1P3BB 3AZID 4YM6D 1TZYB 5BNVA 1KX4D 1N1JB 3KXBB 4YS3A 3AN2D 5B2ID 4X23B 5B0YA 3WA9A 3WA9C 4LD9C 4AWLB 4J8WB 3B6GC 4Z66D 1P3PA 5AY8A 5AY8C 5BO0B 5GT0D 3UT9A 3B6FA 4ZUXC 4M6BA 3MGRD 1P3KB 3WAAD 2L5AA 3AZFB 3AZND 1KX5C 5CPKC 5CPKA 4XZQD 4J8UC 5B2JB 2JSSA 3X1SC 3B0BA 3AZLB 4KGCA 3KUYC 5B0YC 3KUYA 5AV6B 4JJNB 4WU9A 4WU9C 4Z5TC 4LD9A 4YS3C 3AZGC 5B0ZB 1BH8B 3X1SD 2CV5A 3UTBD 1TZYD 4H9PB 3AZHD 5GT0A 3UT9D 1U35A 5B1MD 4YS3B 4Z5TB 2F8NA 4JJNC 4Z5TD 3REHA 5B0YB 5DNMB 4NE5A 3WAAA 2F8NH 3VH6T 5B32A 3X1SB 3X1TB 4J8VD 3W99A 3W97C 4WU8A 4ZUXA 2NZDD 5CPKB 1KX5B 2PYOB 4WZSB 5AV9C 3B6FB 4QLCC 1P3KC 3MGRC 5AV5D 1P3OD 3R45A 1JFIB 1HQ3C 3LZ1C 1P34A 4G91C 4LD9D 1P3IA 1P3LD 1ID3A 1ZLAB 3MGPD 5E5AA 5JRGD 2AROA 4DRAA 4XUJB 4DRBA 3REJD 5CPJC 3C1BD 5B31B 4KUDA 1M1AB 3AN2A 4Z5TA 4J8WC 3AZGA 3WA9B 3LZ0B 4R8PB 1P3FA 4Z2MH 1N1JA 3W98C 4CAYA 3MGSC 3AYWA 3AZED 5GT3B 1TZYC 1P3BC 3AZLD 3W99C 3AV1B 3W97A 3WTPD 3X1UC 3X1VB 3X1UB 3X1VC 5BS7A 1BH9A 3W99B 2AROD 5JA4B 3C1CC 3REJA 1P3BD 3UTAA 1M19D 1F66D 1P3GB 5GT3C 3MNND 3MGSB 1M19C 3A6NA 3AZJA 3RELA 3W98B 1AOIA 5GSUD 3VH6W 4WU9D 3KUYD 2NQBA 4R8PC 3LZ0A 4R8PA 3LZ0C 4YM6B 4H9SC 3AV2D 1BH8A 3O62D 1H3OA 2YFVA 4H9PA 5B31A 1M1AC 5B31C 1M1AA 5CPJB 5GSUB 4XUJC 1ZLAC 3B6GD 4G91B 1P3OC 3LZ1B 1HQ3B 1M18D 3MGRB 1P3KD 3AZKD 4NFTA 4QLCB 5AVCA 3B6FC 5AV9B 2FJ7B 3C1CA 3REJC 2PYOC 1EQZD 2FJ7D 2PYOA 5BS7C 2YFWB 3W97B 3X1TC 3AV1A 1M18B 5G49A 5DNMC 3KWQD 3RELC 3LELB 5CP6C 4KUDD 2YFVB 1M1AD 2HIOC 2HIOA 1KX3B
chains in the Genus database with same CATH superfamily
2Y2HA 5B1LA 1T3UA 3REIA 4X23A 3B0DB 5B0ZC 3AZGB 5BT1C 5B33C 2FFFB 3KWQB 5AV6A 3X1UD 5AV6C 3KFUG 4YM6A 3KUYB 4WU9B 3AZFD 3MGQB 5CPIA 4H9OA 2CV5D 2JCHA 3MGQD 3AZLC 3AZMD 3AZEA 3MNNB 3AZEC 5B2JC 3B0CT 5AVCC 1P3GD 5CPKD 4J8UB 4WJ3C 5AV8A 3AZFC 3TU4C 2Y2PA 3LJAC 3W99D 4J8VA 4J8VB 4ZUXB 4WU8B 1S32C 1S32A 5CP6A 3UTBA 5CPJD 5AY8B 1B6WA 5BO0A 3B6FD 5B2IB 4WNNB 1P34C 5GXQA 3AFAA 4Z66C 3LZ1D 4AWLC 3B6GB 3X1TD 2XD1A 4LD9B 3MGQA 2Y2GA 4X23C 5GT0C 4KHAB 1H3OB 3C1BA 3REKD 3C1BB 3KXBC 2HUEC 3KSYA 3KXBA 4HGAB 3AN2B 5B2JA 5AV8D 1KX3D 4KGCB 3TU4A 1KU5A 1ZLAD 3WTPB 4J8XC 5B40A 5AVBA 3MVDA 1P34D 4JJND 1TZYA 3NQUB 3WKJC 3NQUA 5AV9A 4E44A 2YFWA 3UTBC 3UT9B 3AFAD 5FUGB 2Y2IA 5B24D 4Z66A 1P3MB 1M19A 3AZJC 4KHAA 3REKA 3AFAC 5GT3D 3REID 3REIB 4J8UD 2J8PA 3AZHB 1U35C 1P3AA 1HTAA 2CV5C 5B1MB 4YS3D 5B1MA 3WAAC 1P3FC 1R4VA 5CPID 4JJNA 3REHC 5B32G 4DQYB 4J8WD 3AZIB 3LELA 3W96B 5E5AB 3V9RB 4WU8D 1F66A 1P3PD 3WKJD 5JRGC 2RVQC 5AVBC 3MVDC 5B40C 5FUGA 3RELD 3AZKC 2BYKB 5AV8B 5B24A 3X1VA 4H9QA 1HQ3A 4ZBJB 5AV5C 3MGRA 3X1SA 5C3IC 2RVQD 1P3PB 2FJ7A 2PYOD 3A6NC 3REKC 4G92B 1EQZB 5GXQD 1ID3C 3EPHA 2Y2LA 3AV2C 2NQBC 3LJAD 2Y2QA 4WV4B 5F99B 3NQJB 3NQJA 3UTAD 5CHLB 4KUDB 4XUJA 2AROB 5B2JD 3MGSA 3AYWC 1KX3A 3AZHA 1KX4C 1F66C 2ZY5A 5B32C 3EPLA 1AOIB 3EPKA 5CPIC 1P3OA 5F99D 3AZLA 4R8PD 5B24C 2CWEA 4E45A 4QLCA 3W96D 1F1EA 2NZDA 3W98D 4CAYB 2HIOD 3AZGD 1B67A 3UTAC 5B24B 2BYKA 5DNMA 4EO5C 2ZM5A 1AOIC 5B32B 2IO5B 3AV2A 3MGSD 5GXQC 3AYWD 1ID3D 3O62A 3MGPB 3AZMA 3AZNA 3AZNC 1KX5D 1P3AB 1P3LC 5DNNC 4KGCD 2NQBB 3R45B 1JFIA 3B6GA 1A7WA 4H9NB 1P3BA 1ID3B 1P3IB 3REKB 5AY8D 1ULYA 1P3PC 3A6ND 4X23D 4XZQB 2NZDC 1HQ3D 3REHD 3AV1D 1P3ID 3WTPA 5B40B 5AVBB 3MVDB 3X1TA 5B31D 1KX5A 3V9RA 5B1LC 2Y2OA 3O62C 3W96C 2UWXA 3AZMC 3REHB 3AZJD 2F8NB 4H9RA 3WAAB 1P3FD 5BT1D 5B33D 5DNNA 1P3LA 1U35D 3MGPA 3AZMB 3O62B 3AZJB 5B1LB 2F8ND 1P3MC 5B2IA 3VH5T 4J8XA 4ZUXD 4UUZB 5B1LD 3P5JB 4XZQC 3KXBD 3AZKA 2NZDB 5CP6D 4J8UA 1P3IC 5BNXB 5DNND 4KGCC 3WA9D 3LZ1A 5DNNB 4Z2MG 4HGAC 3VH5W 5E5AD 2HUEB 3AN2C 1P3LB 5B0ZA 5AV9D 3C1BC 3LELD 1P3AC 5GT0B 3AZNB 3MGPC 4H9SA 5GXQB 4H9RB 1AOID 2F8NG 2IO5C 4Z66B 4EO5B 1P34B 5G49B 5B2IC 3TU4D 5BNVB 1ZLAA 3UTAB 1P3MD 1S32B 4WU8C 5JRGA 4XZQA 4J8VC 3LJAB 4H9QB 3TU4B 4H9NA 5B0ZD 5CPIB 3AZIA 5AVCB 3MNNC 3AZEB 3MNNA 1F66B 3VH5A 5GT3A 1KX4B 3B0CW 2AROC 3VH6A 3C1CD 3AYWB 3MGQC 5GSUA 1TAFB 5CPJA 4KUDC 3X1VD 5DNMD 5AV6D 3KWQC 5B33B 3AL0C 5F99A 5F99C 4CSRB 3B0DC 3H0RC 3AV2B 2Y2JA 3WTPE 1KX3C 2HIOB 2XD5A 2ZY3A 1EQZC 5CP6B 4G92C 3LELC 3A6NB 4WNNA 3RELB 3W98A 1BFMA 5C3IB 1M18C 1M18A 5KDMA 4ZBJC 2BYMA 5AV5B 5AV5A 2NQBD 1P3KA 3X1UA 5AV8C 3AZFA 5AVBD 5B40D 3MVDD 4UUZA 4XUJD 5JA4A 2BG1A 3REJB 3AZKB 5JRGB 2FJ7C 1P3AD 5E5AC 3W97D 2LY8A 1P3OB 3AZIC 1Q9CA 4CSRA 3KWQA 4J8WA 1P3FB 4H9OB 4QLCD 1WWSA 5GSUC 1W2EA 3W96A 5B1MC 2CV5B 3H0LC 4NE6A 2ZY2A 5AVCD 1KX4A 1S32D 3AZHC 3REIC 1U35B 3IP4C 1EQZA 1WWIA 5B31G 1TAFA 4YM6C 3AFAB 4NE3A 3LZ0D 5B33A 5BNXA 5B0YD 2F8NK 1BH9B 1P3MA 1M19B 5B32D 1P3GC 1P3GA 3UTBB 3UT9C 3C1CB 3WKJA 3LJAA 3F6TA 3WKJB 4J8XD 3WTPC 4J8XB 2BYMB 2Y2MA 5KDMB 3AV1C 2ZY4A 1P3BB 3AZID 3H0MC 4YM6D 1TZYB 5BNVA 1KX4D 1N1JB 3KXBB 4YS3A 3AN2D 5B2ID 4X23B 5B0YA 3WA9A 3WA9C 4LD9C 2DF4C 4J8WB 4AWLB 3B6GC 4Z66D 2F2AC 1P3PA 5AY8A 5AY8C 3A1IA 5BO0B 5GT0D 3UT9A 3B6FA 4ZUXC 2G5IC 2Y2KA 4M6BA 3MGRD 1P3KB 3WAAD 2L5AA 3AZFB 3AZND 1KX5C 4UPKA 5CPKC 5CPKA 4XZQD 4J8UC 5B2JB 2JSSA 3X1SC 3B0BA 2VQRA 3AZLB 4KGCA 2Y2NA 3KUYC 5B0YC 3KUYA 5AV6B 4JJNB 4WU9A 4WU9C 4Z5TC 4LD9A 4YS3C 3AZGC 5B0ZB 1BH8B 3X1SD 2CV5A 3UTBD 1TZYD 4H9PB 3AZHD 5GT0A 3UT9D 1U35A 5B1MD 4YS3B 4Z5TB 1PZRA 2F8NA 4JJNC 4Z5TD 3REHA 5B0YB 5DNMB 4NE5A 3WAAA 2JE5A 3EG5B 2F8NH 3VH6T 5B32A 3X1SB 3X1TB 4J8VD 3W99A 3W97C 4WU8A 4ZUXA 3FDDA 2NZDD 5CPKB 1KX5B 2PYOB 4WZSB 5AV9C 3B6FB 2DQNC 4QLCC 1P3KC 3MGRC 5AV5D 1P3OD 3R45A 1JFIB 1HQ3C 3LZ1C 1P34A 4G91C 4LD9D 1P3IA 1P3LD 1ID3A 1ZLAB 3MGPD 5E5AA 5JRGD 2AROA 4DRAA 4XUJB 4DRBA 3REJD 5CPJC 3C1BD 5B31B 4KUDA 1M1AB 3AN2A 4Z5TA 4J8WC 3AZGA 3WA9B 2W8SA 3LZ0B 4R8PB 1P3FA 2RIQA 4Z2MH 1N1JA 3W98C 4CAYA 3MGSC 3AYWA 3AZED 5GT3B 1TZYC 1P3BC 1Z2CB 3AZLD 3W99C 3AV1B 3W97A 2G5HC 3WTPD 3X1UC 3X1VB 3X1UB 3X1VC 5BS7A 1BH9A 3W99B 2AROD 5JA4B 3C1CC 3REJA 1P3BD 3UTAA 1M19D 1F66D 1P3GB 5GT3C 3MNND 3MGSB 1M19C 3A6NA 3AZJA 3RELA 3W98B 1AOIA 5GSUD 3A1KA 3VH6W 4WU9D 3KUYD 2NQBA 4R8PC 3LZ0A 4R8PA 3LZ0C 4YM6B 4H9SC 3AV2D 1BH8A 3O62D 1H3OA 2YFVA 4H9PA 5B31A 1M1AC 5B31C 1M1AA 5CPJB 5GSUB 4XUJC 3EPJA 1ZLAC 3B6GD 4G91B 1P3OC 3LZ1B 1HQ3B 1M18D 3MGRB 1P3KD 3AZKD 4NFTA 4QLCB 5AVCA 3B6FC 5AV9B 2FJ7B 3C1CA 3REJC 2PYOC 1EQZD 2FJ7D 2PYOA 5BS7C 2YFWB 3W97B 3X1TC 3AV1A 1M18B 5G49A 5DNMC 3KWQD 3RELC 3LELB 5CP6C 4KUDD 2YFVB 1M1AD 2HIOC 2HIOA 1KX3B
chains in the Genus database with same CATH topology
2Y2HA 5B1LA 1T3UA 3REIA 4X23A 3B0DB 5B0ZC 3AZGB 5BT1C 5B33C 2FFFB 3KWQB 5AV6A 3X1UD 5AV6C 3KFUG 4YM6A 3KUYB 4WU9B 3AZFD 3MGQB 5CPIA 4H9OA 2CV5D 2JCHA 3MGQD 3AZLC 3AZMD 3AZEA 3MNNB 3AZEC 5B2JC 3B0CT 5AVCC 1P3GD 5CPKD 4J8UB 4WJ3C 5AV8A 3AZFC 3TU4C 2Y2PA 3LJAC 3W99D 4J8VA 4J8VB 4ZUXB 4WU8B 1S32C 1S32A 5CP6A 3UTBA 5CPJD 5AY8B 1B6WA 5BO0A 3B6FD 5B2IB 4WNNB 1P34C 5GXQA 3AFAA 4Z66C 3LZ1D 4AWLC 3B6GB 3X1TD 2XD1A 4LD9B 3MGQA 2Y2GA 4X23C 5GT0C 4KHAB 1H3OB 3C1BA 3REKD 3C1BB 3KXBC 2HUEC 3KSYA 3KXBA 4HGAB 3AN2B 5B2JA 5AV8D 1KX3D 4KGCB 3TU4A 1KU5A 1ZLAD 3WTPB 4J8XC 5B40A 5AVBA 3MVDA 1P34D 4JJND 1TZYA 3NQUB 3WKJC 3NQUA 5AV9A 4E44A 2YFWA 3UTBC 3UT9B 3AFAD 5FUGB 2Y2IA 5B24D 4Z66A 1P3MB 1M19A 3AZJC 4KHAA 3REKA 3AFAC 5GT3D 3REID 3REIB 4J8UD 2J8PA 3AZHB 1U35C 1P3AA 1HTAA 2CV5C 5B1MB 4YS3D 5B1MA 3WAAC 1P3FC 1R4VA 5CPID 4JJNA 3REHC 5B32G 4DQYB 4J8WD 3AZIB 3LELA 3W96B 5E5AB 3V9RB 4WU8D 1F66A 1P3PD 3WKJD 5JRGC 2RVQC 5AVBC 3MVDC 5B40C 5FUGA 3RELD 3AZKC 2BYKB 5AV8B 5B24A 3X1VA 4H9QA 1HQ3A 4ZBJB 5AV5C 3MGRA 3X1SA 5C3IC 2RVQD 1P3PB 2FJ7A 2PYOD 3A6NC 3REKC 4G92B 1EQZB 5GXQD 1ID3C 3EPHA 2Y2LA 3AV2C 2NQBC 3LJAD 2Y2QA 4WV4B 5F99B 3NQJB 3NQJA 3UTAD 5CHLB 4KUDB 4XUJA 2AROB 5B2JD 3MGSA 3AYWC 1KX3A 3AZHA 1KX4C 1F66C 2ZY5A 5B32C 3EPLA 1AOIB 3EPKA 5CPIC 1P3OA 5F99D 3AZLA 4R8PD 5B24C 2CWEA 4E45A 4QLCA 3W96D 1F1EA 2NZDA 3W98D 4CAYB 2HIOD 3AZGD 1B67A 3UTAC 5B24B 2BYKA 5DNMA 4EO5C 2ZM5A 1AOIC 5B32B 2IO5B 3AV2A 3MGSD 5GXQC 3AYWD 1ID3D 3O62A 3MGPB 3AZMA 3AZNA 3AZNC 1KX5D 1P3AB 1P3LC 5DNNC 4KGCD 2NQBB 3R45B 1JFIA 3B6GA 1A7WA 4H9NB 1P3BA 1ID3B 1P3IB 3REKB 5AY8D 1ULYA 1P3PC 3A6ND 4X23D 4XZQB 2NZDC 1HQ3D 3REHD 3AV1D 1P3ID 3WTPA 5B40B 5AVBB 3MVDB 3X1TA 5B31D 1KX5A 3V9RA 5B1LC 2Y2OA 3O62C 3W96C 2UWXA 3AZMC 3REHB 3AZJD 2F8NB 4H9RA 3WAAB 1P3FD 5BT1D 5B33D 5DNNA 1P3LA 1U35D 3MGPA 3AZMB 3O62B 3AZJB 5B1LB 2F8ND 1P3MC 5B2IA 3VH5T 4J8XA 4ZUXD 4UUZB 5B1LD 3P5JB 4XZQC 3KXBD 3AZKA 2NZDB 5CP6D 4J8UA 1P3IC 5BNXB 5DNND 4KGCC 3WA9D 3LZ1A 5DNNB 4Z2MG 4HGAC 3VH5W 5E5AD 2HUEB 3AN2C 1P3LB 5B0ZA 5AV9D 3C1BC 3LELD 1P3AC 5GT0B 3AZNB 3MGPC 4H9SA 5GXQB 4H9RB 1AOID 2F8NG 2IO5C 4Z66B 4EO5B 1P34B 5G49B 5B2IC 3TU4D 5BNVB 1ZLAA 3UTAB 1P3MD 1S32B 4WU8C 5JRGA 4XZQA 4J8VC 3LJAB 4H9QB 3TU4B 4H9NA 5B0ZD 5CPIB 3AZIA 5AVCB 3MNNC 3AZEB 3MNNA 1F66B 3VH5A 5GT3A 1KX4B 3B0CW 2AROC 3VH6A 3C1CD 3AYWB 3MGQC 5GSUA 1TAFB 5CPJA 4KUDC 3X1VD 5DNMD 5AV6D 3KWQC 5B33B 3AL0C 5F99A 5F99C 4CSRB 3B0DC 3H0RC 3AV2B 2Y2JA 3WTPE 1KX3C 2HIOB 2XD5A 2ZY3A 1EQZC 5CP6B 4G92C 3LELC 3A6NB 4WNNA 3RELB 3W98A 1BFMA 5C3IB 1M18C 1M18A 5KDMA 4ZBJC 2BYMA 5AV5B 5AV5A 2NQBD 1P3KA 3X1UA 5AV8C 3AZFA 5AVBD 5B40D 3MVDD 4UUZA 4XUJD 5JA4A 2BG1A 3REJB 3AZKB 5JRGB 2FJ7C 1P3AD 5E5AC 3W97D 2LY8A 1P3OB 3AZIC 1Q9CA 4CSRA 3KWQA 4J8WA 1P3FB 4H9OB 4QLCD 1WWSA 5GSUC 1W2EA 3W96A 5B1MC 2CV5B 3H0LC 4NE6A 2ZY2A 5AVCD 1KX4A 1S32D 3AZHC 3REIC 1U35B 3IP4C 1EQZA 1WWIA 5B31G 1TAFA 4YM6C 3AFAB 4NE3A 3LZ0D 5B33A 5BNXA 5B0YD 2F8NK 1BH9B 1P3MA 1M19B 5B32D 1P3GC 1P3GA 3UTBB 3UT9C 3C1CB 3WKJA 3LJAA 3F6TA 3WKJB 4J8XD 3WTPC 4J8XB 2BYMB 2Y2MA 5KDMB 3AV1C 2ZY4A 1P3BB 3AZID 3H0MC 4YM6D 1TZYB 5BNVA 1KX4D 1N1JB 3KXBB 4YS3A 3AN2D 5B2ID 4X23B 5B0YA 3WA9A 3WA9C 4LD9C 2DF4C 4J8WB 4AWLB 3B6GC 4Z66D 2F2AC 1P3PA 5AY8A 5AY8C 3A1IA 5BO0B 5GT0D 3UT9A 3B6FA 4ZUXC 2G5IC 2Y2KA 4M6BA 3MGRD 1P3KB 3WAAD 2L5AA 3AZFB 3AZND 1KX5C 4UPKA 5CPKC 5CPKA 4XZQD 4J8UC 5B2JB 2JSSA 3X1SC 3B0BA 2VQRA 3AZLB 4KGCA 2Y2NA 3KUYC 5B0YC 3KUYA 5AV6B 4JJNB 4WU9A 4WU9C 4Z5TC 4LD9A 4YS3C 3AZGC 5B0ZB 1BH8B 3X1SD 2CV5A 3UTBD 1TZYD 4H9PB 3AZHD 5GT0A 3UT9D 1U35A 5B1MD 4YS3B 4Z5TB 1PZRA 2F8NA 4JJNC 4Z5TD 3REHA 5B0YB 5DNMB 4NE5A 3WAAA 2JE5A 3EG5B 2F8NH 3VH6T 5B32A 3X1SB 3X1TB 4J8VD 3W99A 3W97C 4WU8A 4ZUXA 3FDDA 2NZDD 5CPKB 1KX5B 2PYOB 4WZSB 5AV9C 3B6FB 2DQNC 4QLCC 1P3KC 3MGRC 5AV5D 1P3OD 3R45A 1JFIB 1HQ3C 3LZ1C 1P34A 4G91C 4LD9D 1P3IA 1P3LD 1ID3A 1ZLAB 3MGPD 5E5AA 5JRGD 2AROA 4DRAA 4XUJB 4DRBA 3REJD 5CPJC 3C1BD 5B31B 4KUDA 1M1AB 3AN2A 4Z5TA 4J8WC 3AZGA 3WA9B 2W8SA 3LZ0B 4R8PB 1P3FA 2RIQA 4Z2MH 1N1JA 3W98C 4CAYA 3MGSC 3AYWA 3AZED 5GT3B 1TZYC 1P3BC 1Z2CB 3AZLD 3W99C 3AV1B 3W97A 2G5HC 3WTPD 3X1UC 3X1VB 3X1UB 3X1VC 5BS7A 1BH9A 3W99B 2AROD 5JA4B 3C1CC 3REJA 1P3BD 3UTAA 1M19D 1F66D 1P3GB 5GT3C 3MNND 3MGSB 1M19C 3A6NA 3AZJA 3RELA 3W98B 1AOIA 5GSUD 3A1KA 3VH6W 4WU9D 3KUYD 2NQBA 4R8PC 3LZ0A 4R8PA 3LZ0C 4YM6B 4H9SC 3AV2D 1BH8A 3O62D 1H3OA 2YFVA 4H9PA 5B31A 1M1AC 5B31C 1M1AA 5CPJB 5GSUB 4XUJC 3EPJA 1ZLAC 3B6GD 4G91B 1P3OC 3LZ1B 1HQ3B 1M18D 3MGRB 1P3KD 3AZKD 4NFTA 4QLCB 5AVCA 3B6FC 5AV9B 2FJ7B 3C1CA 3REJC 2PYOC 1EQZD 2FJ7D 2PYOA 5BS7C 2YFWB 3W97B 3X1TC 3AV1A 1M18B 5G49A 5DNMC 3KWQD 3RELC 3LELB 5CP6C 4KUDD 2YFVB 1M1AD 2HIOC 2HIOA 1KX3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L A;  3REI A;  4X23 A;  3B0D B;  5B0Z C;  3AZG B;  5BT1 C;  5B33 C;  3KWQ B;  5AV6 A;  3X1U D;  5AV6 C;  4YM6 A;  3KUY B;  4WU9 B;  3AZF D;  3MGQ B;  5CPI A;  4H9O A;  2CV5 D;  3AZL C;  3MGQ D;  3AZM D;  3AZE A;  3MNN B;  3AZE C;  5B2J C;  3B0C T;  5AVC C;  1P3G D;  5CPK D;  4J8U B;  5AV8 A;  3AZF C;  3TU4 C;  3LJA C;  3W99 D;  4J8V A;  4J8V B;  4ZUX B;  4WU8 B;  1S32 C;  1S32 A;  5CP6 A;  3UTB A;  5CPJ D;  5AY8 B;  1B6W A;  5BO0 A;  3B6F D;  5B2I B;  4WNN B;  1P34 C;  5GXQ A;  3AFA A;  4Z66 C;  3LZ1 D;  4AWL C;  3B6G B;  3X1T D;  4LD9 B;  3MGQ A;  4X23 C;  5GT0 C;  4KHA B;  1H3O B;  3C1B A;  3REK D;  3C1B B;  3KXB C;  2HUE C;  3KSY A;  3KXB A;  4HGA B;  3AN2 B;  5B2J A;  5AV8 D;  1KX3 D;  4KGC B;  3TU4 A;  1KU5 A;  1ZLA D;  3WTP B;  4J8X C;  5B40 A;  5AVB A;  3MVD A;  1P34 D;  4JJN D;  1TZY A;  3NQU B;  3WKJ C;  3NQU A;  5AV9 A;  4E44 A;  2YFW A;  3UTB C;  3UT9 B;  3AFA D;  5FUG B;  5B24 D;  4Z66 A;  1P3M B;  1M19 A;  3AZJ C;  4KHA A;  3REK A;  3AFA C;  5GT3 D;  3REI D;  3REI B;  4J8U D;  3AZH B;  1U35 C;  1P3A A;  1HTA A;  2CV5 C;  5B1M B;  4YS3 D;  5B1M A;  3WAA C;  1P3F C;  1R4V A;  5CPI D;  4JJN A;  3REH C;  5B32 G;  3W96 B;  4J8W D;  3AZI B;  3LEL A;  5E5A B;  3V9R B;  4WU8 D;  1F66 A;  1P3P D;  3WKJ D;  5JRG C;  2RVQ C;  5AVB C;  3MVD C;  5B40 C;  5FUG A;  3REL D;  3AZK C;  2BYK B;  5AV8 B;  5B24 A;  3X1V A;  4H9Q A;  1HQ3 A;  4ZBJ B;  5AV5 C;  3MGR A;  3X1S A;  5C3I C;  2RVQ D;  1P3P B;  2FJ7 A;  2PYO D;  3A6N C;  3REK C;  4G92 B;  1EQZ B;  5GXQ D;  1ID3 C;  3AV2 C;  2NQB C;  3LJA D;  4WV4 B;  5F99 B;  3NQJ B;  3NQJ A;  3UTA D;  5CHL B;  4KUD B;  4XUJ A;  2ARO B;  5B2J D;  3MGS A;  3AYW C;  1KX3 A;  3AZH A;  1KX4 C;  1F66 C;  5B32 C;  1AOI B;  5CPI C;  1P3O A;  5F99 D;  3AZL A;  4R8P D;  5B24 C;  2CWE A;  4E45 A;  4QLC A;  3W96 D;  1F1E A;  2NZD A;  3W98 D;  4CAY B;  2HIO D;  3AZG D;  1B67 A;  3UTA C;  5B24 B;  2BYK A;  5DNM A;  4EO5 C;  1AOI C;  5B32 B;  2IO5 B;  3AV2 A;  3MGS D;  5GXQ C;  3AYW D;  1ID3 D;  3O62 A;  3MGP B;  3AZM A;  3AZN A;  3AZN C;  1KX5 D;  1P3A B;  1P3L C;  5DNN C;  4KGC D;  2NQB B;  3R45 B;  1JFI A;  3B6G A;  1A7W A;  4H9N B;  1P3B A;  1ID3 B;  1P3I B;  3REK B;  5AY8 D;  1ULY A;  1P3P C;  3A6N D;  4X23 D;  4XZQ B;  2NZD C;  1HQ3 D;  3REH D;  3AV1 D;  1P3I D;  3WTP A;  5B40 B;  5AVB B;  3MVD B;  3X1T A;  5B31 D;  1KX5 A;  3V9R A;  5B1L C;  3O62 C;  3W96 C;  3AZM C;  3REH B;  3AZJ D;  2F8N B;  4H9R A;  3WAA B;  1P3F D;  5BT1 D;  5B33 D;  5DNN A;  1P3L A;  1U35 D;  3MGP A;  3AZM B;  3O62 B;  3AZJ B;  5B1L B;  2F8N D;  1P3M C;  5B2I A;  3VH5 T;  4J8X A;  4ZUX D;  4UUZ B;  5B1L D;  3AZK A;  4XZQ C;  3KXB D;  2NZD B;  5CP6 D;  4J8U A;  1P3I C;  5BNX B;  5DNN D;  4KGC C;  3WA9 D;  3LZ1 A;  5DNN B;  4Z2M G;  4HGA C;  3VH5 W;  5E5A D;  2HUE B;  3AN2 C;  1P3L B;  5B0Z A;  5AV9 D;  3C1B C;  3LEL D;  1P3A C;  5GT0 B;  3AZN B;  3MGP C;  4H9S A;  5GXQ B;  4H9R B;  1AOI D;  2F8N G;  2IO5 C;  4Z66 B;  4EO5 B;  1P34 B;  5G49 B;  5B2I C;  3TU4 D;  5BNV B;  1ZLA A;  3UTA B;  1P3M D;  1S32 B;  4WU8 C;  5JRG A;  4XZQ A;  4J8V C;  3LJA B;  4H9Q B;  3TU4 B;  4H9N A;  5B0Z D;  5CPI B;  3AZI A;  5AVC B;  3MNN C;  3AZE B;  3MNN A;  1F66 B;  3VH5 A;  5GT3 A;  1KX4 B;  3B0C W;  2ARO C;  3VH6 A;  3C1C D;  3AYW B;  3MGQ C;  5GSU A;  1TAF B;  5CPJ A;  4KUD C;  3X1V D;  5DNM D;  5AV6 D;  3KWQ C;  5B33 B;  5F99 A;  5F99 C;  4CSR B;  3B0D C;  3AV2 B;  3WTP E;  1KX3 C;  2HIO B;  1EQZ C;  5CP6 B;  4G92 C;  3LEL C;  3A6N B;  4WNN A;  3REL B;  3W98 A;  1BFM A;  5C3I B;  1M18 C;  1M18 A;  5KDM A;  4ZBJ C;  2BYM A;  5AV5 B;  5AV5 A;  2NQB D;  1P3K A;  3X1U A;  5AV8 C;  3AZF A;  5AVB D;  5B40 D;  3MVD D;  4UUZ A;  4XUJ D;  5JA4 A;  3REJ B;  3AZK B;  2FJ7 C;  5JRG B;  1P3A D;  5E5A C;  3W97 D;  2LY8 A;  1P3O B;  3AZI C;  1Q9C A;  4CSR A;  3KWQ A;  4J8W A;  1P3F B;  4H9O B;  4QLC D;  1WWS A;  5GSU C;  3W96 A;  5B1M C;  2CV5 B;  4NE6 A;  5AVC D;  1KX4 A;  1S32 D;  3AZH C;  3REI C;  1U35 B;  1EQZ A;  1WWI A;  5B31 G;  1TAF A;  4YM6 C;  3AFA B;  4NE3 A;  3LZ0 D;  5B33 A;  5BNX A;  5B0Y D;  2F8N K;  1BH9 B;  1P3M A;  1M19 B;  5B32 D;  1P3G C;  1P3G A;  3UTB B;  3UT9 C;  3C1C B;  3WKJ A;  3LJA A;  3WKJ B;  4J8X D;  3WTP C;  4J8X B;  2BYM B;  5KDM B;  3AV1 C;  1P3B B;  3AZI D;  4YM6 D;  1TZY B;  5BNV A;  1KX4 D;  1N1J B;  3KXB B;  4YS3 A;  3AN2 D;  5B2I D;  4X23 B;  5B0Y A;  3WA9 A;  3WA9 C;  4LD9 C;  4AWL B;  4J8W B;  3B6G C;  4Z66 D;  1P3P A;  5AY8 A;  5AY8 C;  5BO0 B;  5GT0 D;  3UT9 A;  3B6F A;  4ZUX C;  4M6B A;  3MGR D;  1P3K B;  3WAA D;  2L5A A;  3AZF B;  3AZN D;  1KX5 C;  5CPK C;  5CPK A;  4XZQ D;  4J8U C;  5B2J B;  2JSS A;  3X1S C;  3B0B A;  3AZL B;  4KGC A;  3KUY C;  5B0Y C;  3KUY A;  5AV6 B;  4JJN B;  4WU9 A;  4WU9 C;  4Z5T C;  4LD9 A;  4YS3 C;  3AZG C;  5B0Z B;  1BH8 B;  3X1S D;  2CV5 A;  3UTB D;  1TZY D;  4H9P B;  3AZH D;  5GT0 A;  3UT9 D;  1U35 A;  5B1M D;  4YS3 B;  4Z5T B;  2F8N A;  4JJN C;  4Z5T D;  3REH A;  5B0Y B;  5DNM B;  4NE5 A;  3WAA A;  2F8N H;  3VH6 T;  5B32 A;  3X1S B;  3X1T B;  4J8V D;  3W99 A;  3W97 C;  4WU8 A;  4ZUX A;  2NZD D;  5CPK B;  1KX5 B;  2PYO B;  4WZS B;  5AV9 C;  3B6F B;  4QLC C;  1P3K C;  3MGR C;  5AV5 D;  1P3O D;  3R45 A;  1JFI B;  1HQ3 C;  3LZ1 C;  1P34 A;  4G91 C;  4LD9 D;  1P3I A;  1P3L D;  1ID3 A;  1ZLA B;  3MGP D;  5E5A A;  5JRG D;  2ARO A;  4DRA A;  4XUJ B;  4DRB A;  3REJ D;  5CPJ C;  3C1B D;  5B31 B;  4KUD A;  1M1A B;  3AN2 A;  4Z5T A;  4J8W C;  3AZG A;  3WA9 B;  3LZ0 B;  4R8P B;  1P3F A;  4Z2M H;  1N1J A;  3W98 C;  4CAY A;  3MGS C;  3AYW A;  3AZE D;  5GT3 B;  1TZY C;  1P3B C;  3AZL D;  3W99 C;  3AV1 B;  3W97 A;  3WTP D;  3X1U C;  3X1V B;  3X1U B;  3X1V C;  5BS7 A;  1BH9 A;  3W99 B;  2ARO D;  5JA4 B;  3C1C C;  3REJ A;  1P3B D;  3UTA A;  1M19 D;  1F66 D;  1P3G B;  5GT3 C;  3MNN D;  3MGS B;  1M19 C;  3A6N A;  3AZJ A;  3REL A;  3W98 B;  1AOI A;  5GSU D;  3VH6 W;  4WU9 D;  3KUY D;  2NQB A;  4R8P C;  3LZ0 A;  4R8P A;  3LZ0 C;  4YM6 B;  4H9S C;  3AV2 D;  1BH8 A;  3O62 D;  1H3O A;  2YFV A;  4H9P A;  5B31 A;  1M1A C;  5B31 C;  1M1A A;  5CPJ B;  5GSU B;  4XUJ C;  1ZLA C;  3B6G D;  4G91 B;  1P3O C;  3LZ1 B;  1HQ3 B;  1M18 D;  3MGR B;  1P3K D;  3AZK D;  4NFT A;  4QLC B;  5AVC A;  3B6F C;  5AV9 B;  2FJ7 B;  3C1C A;  3REJ C;  2PYO C;  1EQZ D;  2FJ7 D;  2PYO A;  5BS7 C;  2YFW B;  3W97 B;  3X1T C;  3AV1 A;  1M18 B;  5G49 A;  5DNM C;  3KWQ D;  3REL C;  3LEL B;  5CP6 C;  4KUD D;  2YFV B;  1M1A D;  2HIO C;  2HIO A;  1KX3 B; 
#chains in the Genus database with same CATH topology
 2Y2H A;  5B1L A;  1T3U A;  3REI A;  4X23 A;  3B0D B;  5B0Z C;  3AZG B;  5BT1 C;  5B33 C;  2FFF B;  3KWQ B;  5AV6 A;  3X1U D;  5AV6 C;  3KFU G;  4YM6 A;  3KUY B;  4WU9 B;  3AZF D;  3MGQ B;  5CPI A;  4H9O A;  2CV5 D;  2JCH A;  3MGQ D;  3AZL C;  3AZM D;  3AZE A;  3MNN B;  3AZE C;  5B2J C;  3B0C T;  5AVC C;  1P3G D;  5CPK D;  4J8U B;  4WJ3 C;  5AV8 A;  3AZF C;  3TU4 C;  2Y2P A;  3LJA C;  3W99 D;  4J8V A;  4J8V B;  4ZUX B;  4WU8 B;  1S32 C;  1S32 A;  5CP6 A;  3UTB A;  5CPJ D;  5AY8 B;  1B6W A;  5BO0 A;  3B6F D;  5B2I B;  4WNN B;  1P34 C;  5GXQ A;  3AFA A;  4Z66 C;  3LZ1 D;  4AWL C;  3B6G B;  3X1T D;  2XD1 A;  4LD9 B;  3MGQ A;  2Y2G A;  4X23 C;  5GT0 C;  4KHA B;  1H3O B;  3C1B A;  3REK D;  3C1B B;  3KXB C;  2HUE C;  3KSY A;  3KXB A;  4HGA B;  3AN2 B;  5B2J A;  5AV8 D;  1KX3 D;  4KGC B;  3TU4 A;  1KU5 A;  1ZLA D;  3WTP B;  4J8X C;  5B40 A;  5AVB A;  3MVD A;  1P34 D;  4JJN D;  1TZY A;  3NQU B;  3WKJ C;  3NQU A;  5AV9 A;  4E44 A;  2YFW A;  3UTB C;  3UT9 B;  3AFA D;  5FUG B;  2Y2I A;  5B24 D;  4Z66 A;  1P3M B;  1M19 A;  3AZJ C;  4KHA A;  3REK A;  3AFA C;  5GT3 D;  3REI D;  3REI B;  4J8U D;  2J8P A;  3AZH B;  1U35 C;  1P3A A;  1HTA A;  2CV5 C;  5B1M B;  4YS3 D;  5B1M A;  3WAA C;  1P3F C;  1R4V A;  5CPI D;  4JJN A;  3REH C;  5B32 G;  4DQY B;  4J8W D;  3AZI B;  3LEL A;  3W96 B;  5E5A B;  3V9R B;  4WU8 D;  1F66 A;  1P3P D;  3WKJ D;  5JRG C;  2RVQ C;  5AVB C;  3MVD C;  5B40 C;  5FUG A;  3REL D;  3AZK C;  2BYK B;  5AV8 B;  5B24 A;  3X1V A;  4H9Q A;  1HQ3 A;  4ZBJ B;  5AV5 C;  3MGR A;  3X1S A;  5C3I C;  2RVQ D;  1P3P B;  2FJ7 A;  2PYO D;  3A6N C;  3REK C;  4G92 B;  1EQZ B;  5GXQ D;  1ID3 C;  3EPH A;  2Y2L A;  3AV2 C;  2NQB C;  3LJA D;  2Y2Q A;  4WV4 B;  5F99 B;  3NQJ B;  3NQJ A;  3UTA D;  5CHL B;  4KUD B;  4XUJ A;  2ARO B;  5B2J D;  3MGS A;  3AYW C;  1KX3 A;  3AZH A;  1KX4 C;  1F66 C;  2ZY5 A;  5B32 C;  3EPL A;  1AOI B;  3EPK A;  5CPI C;  1P3O A;  5F99 D;  3AZL A;  4R8P D;  5B24 C;  2CWE A;  4E45 A;  4QLC A;  3W96 D;  1F1E A;  2NZD A;  3W98 D;  4CAY B;  2HIO D;  3AZG D;  1B67 A;  3UTA C;  5B24 B;  2BYK A;  5DNM A;  4EO5 C;  2ZM5 A;  1AOI C;  5B32 B;  2IO5 B;  3AV2 A;  3MGS D;  5GXQ C;  3AYW D;  1ID3 D;  3O62 A;  3MGP B;  3AZM A;  3AZN A;  3AZN C;  1KX5 D;  1P3A B;  1P3L C;  5DNN C;  4KGC D;  2NQB B;  3R45 B;  1JFI A;  3B6G A;  1A7W A;  4H9N B;  1P3B A;  1ID3 B;  1P3I B;  3REK B;  5AY8 D;  1ULY A;  1P3P C;  3A6N D;  4X23 D;  4XZQ B;  2NZD C;  1HQ3 D;  3REH D;  3AV1 D;  1P3I D;  3WTP A;  5B40 B;  5AVB B;  3MVD B;  3X1T A;  5B31 D;  1KX5 A;  3V9R A;  5B1L C;  2Y2O A;  3O62 C;  3W96 C;  2UWX A;  3AZM C;  3REH B;  3AZJ D;  2F8N B;  4H9R A;  3WAA B;  1P3F D;  5BT1 D;  5B33 D;  5DNN A;  1P3L A;  1U35 D;  3MGP A;  3AZM B;  3O62 B;  3AZJ B;  5B1L B;  2F8N D;  1P3M C;  5B2I A;  3VH5 T;  4J8X A;  4ZUX D;  4UUZ B;  5B1L D;  3P5J B;  4XZQ C;  3KXB D;  3AZK A;  2NZD B;  5CP6 D;  4J8U A;  1P3I C;  5BNX B;  5DNN D;  4KGC C;  3WA9 D;  3LZ1 A;  5DNN B;  4Z2M G;  4HGA C;  3VH5 W;  5E5A D;  2HUE B;  3AN2 C;  1P3L B;  5B0Z A;  5AV9 D;  3C1B C;  3LEL D;  1P3A C;  5GT0 B;  3AZN B;  3MGP C;  4H9S A;  5GXQ B;  4H9R B;  1AOI D;  2F8N G;  2IO5 C;  4Z66 B;  4EO5 B;  1P34 B;  5G49 B;  5B2I C;  3TU4 D;  5BNV B;  1ZLA A;  3UTA B;  1P3M D;  1S32 B;  4WU8 C;  5JRG A;  4XZQ A;  4J8V C;  3LJA B;  4H9Q B;  3TU4 B;  4H9N A;  5B0Z D;  5CPI B;  3AZI A;  5AVC B;  3MNN C;  3AZE B;  3MNN A;  1F66 B;  3VH5 A;  5GT3 A;  1KX4 B;  3B0C W;  2ARO C;  3VH6 A;  3C1C D;  3AYW B;  3MGQ C;  5GSU A;  1TAF B;  5CPJ A;  4KUD C;  3X1V D;  5DNM D;  5AV6 D;  3KWQ C;  5B33 B;  3AL0 C;  5F99 A;  5F99 C;  4CSR B;  3B0D C;  3H0R C;  3AV2 B;  2Y2J A;  3WTP E;  1KX3 C;  2HIO B;  2XD5 A;  2ZY3 A;  1EQZ C;  5CP6 B;  4G92 C;  3LEL C;  3A6N B;  4WNN A;  3REL B;  3W98 A;  1BFM A;  5C3I B;  1M18 C;  1M18 A;  5KDM A;  4ZBJ C;  2BYM A;  5AV5 B;  5AV5 A;  2NQB D;  1P3K A;  3X1U A;  5AV8 C;  3AZF A;  5AVB D;  5B40 D;  3MVD D;  4UUZ A;  4XUJ D;  5JA4 A;  2BG1 A;  3REJ B;  3AZK B;  5JRG B;  2FJ7 C;  1P3A D;  5E5A C;  3W97 D;  2LY8 A;  1P3O B;  3AZI C;  1Q9C A;  4CSR A;  3KWQ A;  4J8W A;  1P3F B;  4H9O B;  4QLC D;  1WWS A;  5GSU C;  1W2E A;  3W96 A;  5B1M C;  2CV5 B;  3H0L C;  4NE6 A;  2ZY2 A;  5AVC D;  1KX4 A;  1S32 D;  3AZH C;  3REI C;  1U35 B;  3IP4 C;  1EQZ A;  1WWI A;  5B31 G;  1TAF A;  4YM6 C;  3AFA B;  4NE3 A;  3LZ0 D;  5B33 A;  5BNX A;  5B0Y D;  2F8N K;  1BH9 B;  1P3M A;  1M19 B;  5B32 D;  1P3G C;  1P3G A;  3UTB B;  3UT9 C;  3C1C B;  3WKJ A;  3LJA A;  3F6T A;  3WKJ B;  4J8X D;  3WTP C;  4J8X B;  2BYM B;  2Y2M A;  5KDM B;  3AV1 C;  2ZY4 A;  1P3B B;  3AZI D;  3H0M C;  4YM6 D;  1TZY B;  5BNV A;  1KX4 D;  1N1J B;  3KXB B;  4YS3 A;  3AN2 D;  5B2I D;  4X23 B;  5B0Y A;  3WA9 A;  3WA9 C;  4LD9 C;  2DF4 C;  4J8W B;  4AWL B;  3B6G C;  4Z66 D;  2F2A C;  1P3P A;  5AY8 A;  5AY8 C;  3A1I A;  5BO0 B;  5GT0 D;  3UT9 A;  3B6F A;  4ZUX C;  2G5I C;  2Y2K A;  4M6B A;  3MGR D;  1P3K B;  3WAA D;  2L5A A;  3AZF B;  3AZN D;  1KX5 C;  4UPK A;  5CPK C;  5CPK A;  4XZQ D;  4J8U C;  5B2J B;  2JSS A;  3X1S C;  3B0B A;  2VQR A;  3AZL B;  4KGC A;  2Y2N A;  3KUY C;  5B0Y C;  3KUY A;  5AV6 B;  4JJN B;  4WU9 A;  4WU9 C;  4Z5T C;  4LD9 A;  4YS3 C;  3AZG C;  5B0Z B;  1BH8 B;  3X1S D;  2CV5 A;  3UTB D;  1TZY D;  4H9P B;  3AZH D;  5GT0 A;  3UT9 D;  1U35 A;  5B1M D;  4YS3 B;  4Z5T B;  1PZR A;  2F8N A;  4JJN C;  4Z5T D;  3REH A;  5B0Y B;  5DNM B;  4NE5 A;  3WAA A;  2JE5 A;  3EG5 B;  2F8N H;  3VH6 T;  5B32 A;  3X1S B;  3X1T B;  4J8V D;  3W99 A;  3W97 C;  4WU8 A;  4ZUX A;  3FDD A;  2NZD D;  5CPK B;  1KX5 B;  2PYO B;  4WZS B;  5AV9 C;  3B6F B;  2DQN C;  4QLC C;  1P3K C;  3MGR C;  5AV5 D;  1P3O D;  3R45 A;  1JFI B;  1HQ3 C;  3LZ1 C;  1P34 A;  4G91 C;  4LD9 D;  1P3I A;  1P3L D;  1ID3 A;  1ZLA B;  3MGP D;  5E5A A;  5JRG D;  2ARO A;  4DRA A;  4XUJ B;  4DRB A;  3REJ D;  5CPJ C;  3C1B D;  5B31 B;  4KUD A;  1M1A B;  3AN2 A;  4Z5T A;  4J8W C;  3AZG A;  3WA9 B;  2W8S A;  3LZ0 B;  4R8P B;  1P3F A;  2RIQ A;  4Z2M H;  1N1J A;  3W98 C;  4CAY A;  3MGS C;  3AYW A;  3AZE D;  5GT3 B;  1TZY C;  1P3B C;  1Z2C B;  3AZL D;  3W99 C;  3AV1 B;  3W97 A;  2G5H C;  3WTP D;  3X1U C;  3X1V B;  3X1U B;  3X1V C;  5BS7 A;  1BH9 A;  3W99 B;  2ARO D;  5JA4 B;  3C1C C;  3REJ A;  1P3B D;  3UTA A;  1M19 D;  1F66 D;  1P3G B;  5GT3 C;  3MNN D;  3MGS B;  1M19 C;  3A6N A;  3AZJ A;  3REL A;  3W98 B;  1AOI A;  5GSU D;  3A1K A;  3VH6 W;  4WU9 D;  3KUY D;  2NQB A;  4R8P C;  3LZ0 A;  4R8P A;  3LZ0 C;  4YM6 B;  4H9S C;  3AV2 D;  1BH8 A;  3O62 D;  1H3O A;  2YFV A;  4H9P A;  5B31 A;  1M1A C;  5B31 C;  1M1A A;  5CPJ B;  5GSU B;  4XUJ C;  3EPJ A;  1ZLA C;  3B6G D;  4G91 B;  1P3O C;  3LZ1 B;  1HQ3 B;  1M18 D;  3MGR B;  1P3K D;  3AZK D;  4NFT A;  4QLC B;  5AVC A;  3B6F C;  5AV9 B;  2FJ7 B;  3C1C A;  3REJ C;  2PYO C;  1EQZ D;  2FJ7 D;  2PYO A;  5BS7 C;  2YFW B;  3W97 B;  3X1T C;  3AV1 A;  1M18 B;  5G49 A;  5DNM C;  3KWQ D;  3REL C;  3LEL B;  5CP6 C;  4KUD D;  2YFV B;  1M1A D;  2HIO C;  2HIO A;  1KX3 B; 
#chains in the Genus database with same CATH homology
 2Y2H A;  5B1L A;  1T3U A;  3REI A;  4X23 A;  3B0D B;  5B0Z C;  3AZG B;  5BT1 C;  5B33 C;  2FFF B;  3KWQ B;  5AV6 A;  3X1U D;  5AV6 C;  3KFU G;  4YM6 A;  3KUY B;  4WU9 B;  3AZF D;  3MGQ B;  5CPI A;  4H9O A;  2CV5 D;  2JCH A;  3MGQ D;  3AZL C;  3AZM D;  3AZE A;  3MNN B;  3AZE C;  5B2J C;  3B0C T;  5AVC C;  1P3G D;  5CPK D;  4J8U B;  4WJ3 C;  5AV8 A;  3AZF C;  3TU4 C;  2Y2P A;  3LJA C;  3W99 D;  4J8V A;  4J8V B;  4ZUX B;  4WU8 B;  1S32 C;  1S32 A;  5CP6 A;  3UTB A;  5CPJ D;  5AY8 B;  1B6W A;  5BO0 A;  3B6F D;  5B2I B;  4WNN B;  1P34 C;  5GXQ A;  3AFA A;  4Z66 C;  3LZ1 D;  4AWL C;  3B6G B;  3X1T D;  2XD1 A;  4LD9 B;  3MGQ A;  2Y2G A;  4X23 C;  5GT0 C;  4KHA B;  1H3O B;  3C1B A;  3REK D;  3C1B B;  3KXB C;  2HUE C;  3KSY A;  3KXB A;  4HGA B;  3AN2 B;  5B2J A;  5AV8 D;  1KX3 D;  4KGC B;  3TU4 A;  1KU5 A;  1ZLA D;  3WTP B;  4J8X C;  5B40 A;  5AVB A;  3MVD A;  1P34 D;  4JJN D;  1TZY A;  3NQU B;  3WKJ C;  3NQU A;  5AV9 A;  4E44 A;  2YFW A;  3UTB C;  3UT9 B;  3AFA D;  5FUG B;  2Y2I A;  5B24 D;  4Z66 A;  1P3M B;  1M19 A;  3AZJ C;  4KHA A;  3REK A;  3AFA C;  5GT3 D;  3REI D;  3REI B;  4J8U D;  2J8P A;  3AZH B;  1U35 C;  1P3A A;  1HTA A;  2CV5 C;  5B1M B;  4YS3 D;  5B1M A;  3WAA C;  1P3F C;  1R4V A;  5CPI D;  4JJN A;  3REH C;  5B32 G;  4DQY B;  4J8W D;  3AZI B;  3LEL A;  3W96 B;  5E5A B;  3V9R B;  4WU8 D;  1F66 A;  1P3P D;  3WKJ D;  5JRG C;  2RVQ C;  5AVB C;  3MVD C;  5B40 C;  5FUG A;  3REL D;  3AZK C;  2BYK B;  5AV8 B;  5B24 A;  3X1V A;  4H9Q A;  1HQ3 A;  4ZBJ B;  5AV5 C;  3MGR A;  3X1S A;  5C3I C;  2RVQ D;  1P3P B;  2FJ7 A;  2PYO D;  3A6N C;  3REK C;  4G92 B;  1EQZ B;  5GXQ D;  1ID3 C;  3EPH A;  2Y2L A;  3AV2 C;  2NQB C;  3LJA D;  2Y2Q A;  4WV4 B;  5F99 B;  3NQJ B;  3NQJ A;  3UTA D;  5CHL B;  4KUD B;  4XUJ A;  2ARO B;  5B2J D;  3MGS A;  3AYW C;  1KX3 A;  3AZH A;  1KX4 C;  1F66 C;  2ZY5 A;  5B32 C;  3EPL A;  1AOI B;  3EPK A;  5CPI C;  1P3O A;  5F99 D;  3AZL A;  4R8P D;  5B24 C;  2CWE A;  4E45 A;  4QLC A;  3W96 D;  1F1E A;  2NZD A;  3W98 D;  4CAY B;  2HIO D;  3AZG D;  1B67 A;  3UTA C;  5B24 B;  2BYK A;  5DNM A;  4EO5 C;  2ZM5 A;  1AOI C;  5B32 B;  2IO5 B;  3AV2 A;  3MGS D;  5GXQ C;  3AYW D;  1ID3 D;  3O62 A;  3MGP B;  3AZM A;  3AZN A;  3AZN C;  1KX5 D;  1P3A B;  1P3L C;  5DNN C;  4KGC D;  2NQB B;  3R45 B;  1JFI A;  3B6G A;  1A7W A;  4H9N B;  1P3B A;  1ID3 B;  1P3I B;  3REK B;  5AY8 D;  1ULY A;  1P3P C;  3A6N D;  4X23 D;  4XZQ B;  2NZD C;  1HQ3 D;  3REH D;  3AV1 D;  1P3I D;  3WTP A;  5B40 B;  5AVB B;  3MVD B;  3X1T A;  5B31 D;  1KX5 A;  3V9R A;  5B1L C;  2Y2O A;  3O62 C;  3W96 C;  2UWX A;  3AZM C;  3REH B;  3AZJ D;  2F8N B;  4H9R A;  3WAA B;  1P3F D;  5BT1 D;  5B33 D;  5DNN A;  1P3L A;  1U35 D;  3MGP A;  3AZM B;  3O62 B;  3AZJ B;  5B1L B;  2F8N D;  1P3M C;  5B2I A;  3VH5 T;  4J8X A;  4ZUX D;  4UUZ B;  5B1L D;  3P5J B;  4XZQ C;  3KXB D;  3AZK A;  2NZD B;  5CP6 D;  4J8U A;  1P3I C;  5BNX B;  5DNN D;  4KGC C;  3WA9 D;  3LZ1 A;  5DNN B;  4Z2M G;  4HGA C;  3VH5 W;  5E5A D;  2HUE B;  3AN2 C;  1P3L B;  5B0Z A;  5AV9 D;  3C1B C;  3LEL D;  1P3A C;  5GT0 B;  3AZN B;  3MGP C;  4H9S A;  5GXQ B;  4H9R B;  1AOI D;  2F8N G;  2IO5 C;  4Z66 B;  4EO5 B;  1P34 B;  5G49 B;  5B2I C;  3TU4 D;  5BNV B;  1ZLA A;  3UTA B;  1P3M D;  1S32 B;  4WU8 C;  5JRG A;  4XZQ A;  4J8V C;  3LJA B;  4H9Q B;  3TU4 B;  4H9N A;  5B0Z D;  5CPI B;  3AZI A;  5AVC B;  3MNN C;  3AZE B;  3MNN A;  1F66 B;  3VH5 A;  5GT3 A;  1KX4 B;  3B0C W;  2ARO C;  3VH6 A;  3C1C D;  3AYW B;  3MGQ C;  5GSU A;  1TAF B;  5CPJ A;  4KUD C;  3X1V D;  5DNM D;  5AV6 D;  3KWQ C;  5B33 B;  3AL0 C;  5F99 A;  5F99 C;  4CSR B;  3B0D C;  3H0R C;  3AV2 B;  2Y2J A;  3WTP E;  1KX3 C;  2HIO B;  2XD5 A;  2ZY3 A;  1EQZ C;  5CP6 B;  4G92 C;  3LEL C;  3A6N B;  4WNN A;  3REL B;  3W98 A;  1BFM A;  5C3I B;  1M18 C;  1M18 A;  5KDM A;  4ZBJ C;  2BYM A;  5AV5 B;  5AV5 A;  2NQB D;  1P3K A;  3X1U A;  5AV8 C;  3AZF A;  5AVB D;  5B40 D;  3MVD D;  4UUZ A;  4XUJ D;  5JA4 A;  2BG1 A;  3REJ B;  3AZK B;  5JRG B;  2FJ7 C;  1P3A D;  5E5A C;  3W97 D;  2LY8 A;  1P3O B;  3AZI C;  1Q9C A;  4CSR A;  3KWQ A;  4J8W A;  1P3F B;  4H9O B;  4QLC D;  1WWS A;  5GSU C;  1W2E A;  3W96 A;  5B1M C;  2CV5 B;  3H0L C;  4NE6 A;  2ZY2 A;  5AVC D;  1KX4 A;  1S32 D;  3AZH C;  3REI C;  1U35 B;  3IP4 C;  1EQZ A;  1WWI A;  5B31 G;  1TAF A;  4YM6 C;  3AFA B;  4NE3 A;  3LZ0 D;  5B33 A;  5BNX A;  5B0Y D;  2F8N K;  1BH9 B;  1P3M A;  1M19 B;  5B32 D;  1P3G C;  1P3G A;  3UTB B;  3UT9 C;  3C1C B;  3WKJ A;  3LJA A;  3F6T A;  3WKJ B;  4J8X D;  3WTP C;  4J8X B;  2BYM B;  2Y2M A;  5KDM B;  3AV1 C;  2ZY4 A;  1P3B B;  3AZI D;  3H0M C;  4YM6 D;  1TZY B;  5BNV A;  1KX4 D;  1N1J B;  3KXB B;  4YS3 A;  3AN2 D;  5B2I D;  4X23 B;  5B0Y A;  3WA9 A;  3WA9 C;  4LD9 C;  2DF4 C;  4J8W B;  4AWL B;  3B6G C;  4Z66 D;  2F2A C;  1P3P A;  5AY8 A;  5AY8 C;  3A1I A;  5BO0 B;  5GT0 D;  3UT9 A;  3B6F A;  4ZUX C;  2G5I C;  2Y2K A;  4M6B A;  3MGR D;  1P3K B;  3WAA D;  2L5A A;  3AZF B;  3AZN D;  1KX5 C;  4UPK A;  5CPK C;  5CPK A;  4XZQ D;  4J8U C;  5B2J B;  2JSS A;  3X1S C;  3B0B A;  2VQR A;  3AZL B;  4KGC A;  2Y2N A;  3KUY C;  5B0Y C;  3KUY A;  5AV6 B;  4JJN B;  4WU9 A;  4WU9 C;  4Z5T C;  4LD9 A;  4YS3 C;  3AZG C;  5B0Z B;  1BH8 B;  3X1S D;  2CV5 A;  3UTB D;  1TZY D;  4H9P B;  3AZH D;  5GT0 A;  3UT9 D;  1U35 A;  5B1M D;  4YS3 B;  4Z5T B;  1PZR A;  2F8N A;  4JJN C;  4Z5T D;  3REH A;  5B0Y B;  5DNM B;  4NE5 A;  3WAA A;  2JE5 A;  3EG5 B;  2F8N H;  3VH6 T;  5B32 A;  3X1S B;  3X1T B;  4J8V D;  3W99 A;  3W97 C;  4WU8 A;  4ZUX A;  3FDD A;  2NZD D;  5CPK B;  1KX5 B;  2PYO B;  4WZS B;  5AV9 C;  3B6F B;  2DQN C;  4QLC C;  1P3K C;  3MGR C;  5AV5 D;  1P3O D;  3R45 A;  1JFI B;  1HQ3 C;  3LZ1 C;  1P34 A;  4G91 C;  4LD9 D;  1P3I A;  1P3L D;  1ID3 A;  1ZLA B;  3MGP D;  5E5A A;  5JRG D;  2ARO A;  4DRA A;  4XUJ B;  4DRB A;  3REJ D;  5CPJ C;  3C1B D;  5B31 B;  4KUD A;  1M1A B;  3AN2 A;  4Z5T A;  4J8W C;  3AZG A;  3WA9 B;  2W8S A;  3LZ0 B;  4R8P B;  1P3F A;  2RIQ A;  4Z2M H;  1N1J A;  3W98 C;  4CAY A;  3MGS C;  3AYW A;  3AZE D;  5GT3 B;  1TZY C;  1P3B C;  1Z2C B;  3AZL D;  3W99 C;  3AV1 B;  3W97 A;  2G5H C;  3WTP D;  3X1U C;  3X1V B;  3X1U B;  3X1V C;  5BS7 A;  1BH9 A;  3W99 B;  2ARO D;  5JA4 B;  3C1C C;  3REJ A;  1P3B D;  3UTA A;  1M19 D;  1F66 D;  1P3G B;  5GT3 C;  3MNN D;  3MGS B;  1M19 C;  3A6N A;  3AZJ A;  3REL A;  3W98 B;  1AOI A;  5GSU D;  3A1K A;  3VH6 W;  4WU9 D;  3KUY D;  2NQB A;  4R8P C;  3LZ0 A;  4R8P A;  3LZ0 C;  4YM6 B;  4H9S C;  3AV2 D;  1BH8 A;  3O62 D;  1H3O A;  2YFV A;  4H9P A;  5B31 A;  1M1A C;  5B31 C;  1M1A A;  5CPJ B;  5GSU B;  4XUJ C;  3EPJ A;  1ZLA C;  3B6G D;  4G91 B;  1P3O C;  3LZ1 B;  1HQ3 B;  1M18 D;  3MGR B;  1P3K D;  3AZK D;  4NFT A;  4QLC B;  5AVC A;  3B6F C;  5AV9 B;  2FJ7 B;  3C1C A;  3REJ C;  2PYO C;  1EQZ D;  2FJ7 D;  2PYO A;  5BS7 C;  2YFW B;  3W97 B;  3X1T C;  3AV1 A;  1M18 B;  5G49 A;  5DNM C;  3KWQ D;  3REL C;  3LEL B;  5CP6 C;  4KUD D;  2YFV B;  1M1A D;  2HIO C;  2HIO A;  1KX3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...