5B24D

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24D00
4Z66D 3NQJA 4CAYB 5CPJC 1M19B 3A6NC 3MGQD 3AZKA 2FJ7C 5B1MB 2PYOA 3AZHD 3AZJA 1WWIA 5AVBB 5AVCC 4ZUXB 1BH9A 4NE6A 5B2JD 3MNNB 3REHA 3AZND 3W96D 5B0YD 3NQUB 4KUDA 1M18A 3UT9B 4Z5TA 2AROA 3AFAB 1P3MD 1KX4C 3B6GC 3AN2A 1P3IC 3WKJB 3LJAC 3W99A 3KWQA 3REID 5B31A 5DNMD 3W98C 3WTPD 3W97D 2NQBC 2CV5C 4DRAA 3C1CC 3MGPB 1M19D 3REKC 4YM6B 1ULYA 5B2IA 4AWLC 5AVBD 3REJB 4EO5B 1P3FA 3AZLB 5DNNA 3MNND 2RVQD 4JJNA 5CPIA 1AOIA 3LZ0C 5AV5C 5KDMB 4YS3C 5B32C 3UT9D 1ID3C 3KUYC 3AYWC 1TZYB 5CP6C 5GXQC 3AFAD 4M6BA 5JRGA 1EQZA 2BYMA 5B40B 3WAAD 1P3LC 3WKJD 5CPKD 1ZLAC 3UTAA 5BO0B 1P3AA 4J8WB 5BT1D 2NZDB 1KX5C 5GT3A 5B24C 3X1SC 5B0ZB 5GT0C 3TU4A 4H9RA 5GSUA 5AVCA 4QLCB 3MGPD 2YFVA 3AZIA 1P3KC 4YM6D 4R8PD 1M1AD 3WA9D 3VH5A 3LZ1C 5BNXB 4G92B 4XZQD 3AZEC 5E5AB 5JA4B 1P3OD 1KX3B 1KX4A 2YFWA 3AV2C 1TZYD 2HIOA 3NQJB 3MGSB 4J8VA 3LJAA 4G91B 3AZKC 1P3GA 3AZJB 2PYOC 3W98A 3AZMD 1BH9B 3REHB 2NQBA 5CHLB 4J8UB 3KXBD 5AV6A 4J8WD 3RELA 2NZDD 3B0CW 1M18C 4Z5TC 3REKA 1BH8A 2F8NA 3X1UC 2AROC 5AV8D 4J8XC 3UTBB 4QLCD 3AN2C 5AV5A 4YS3A 3X1TD 3KWQC 5F99A 1ID3A 3VH6A 5B31C 5CP6A 5GXQA 5E5AD 4X23A 5AY8D 3MGRD 1U35C 3AV1B 3MGSD 1ZLAA 3VH5W 4LD9A 4WNNA 5AV9A 1F66A 3LELB 1WWSA 1P3FB 5DNNB 5CPIB 5B24A 4J8UD 4JJNC 1AOIC 1P3PB 3B6FB 4WU9D 1H3OA 1P3KA 3X1VB 2IO5C 3LZ1A 3UTBD 2BYMB 5JRGC 1EQZC 3AZEA 4H9QA 3MGQC 3AZHC 3AZGD 1P3AC 3AV2A 5B2JC 5FUGA 5CPJB 4XUJA 5GT3C 3A6NB 3W96C 5B1LA 5B0YC 2FJ7B 3AV1D 3TU4C 5AVCB 5GSUC 4ZBJC 3VH6W 3AZIC 3LELD 4E44A 5DNND 2BYKA 5CPID 3C1BA 4CSRB 3X1UA 1KX4B 1P3PD 4J8XA 3REIC 3B6GB 3B6FD 1P3IB 3X1VD 2HIOC 4H9NA 3WTPC 4J8VC 3W97C 3AZFA 4H9OB 5B33A 1P3GC 1JFIA 3W98B 1M19C 4KGCD 2NQBB 1U35A 1N1JB 1HQ3B 5AV6C 2CV5B 3C1CB 3RELC 5CPJD 3REKB 3A6ND 2FJ7D 2F8NB 4AWLB 5B1MD 2LY8A 4DRBA 4ZUXD 2F8NK 3LZ0B 5AV5B 1F1EA 1P3BA 4YS3B 3WAAC 5B32B 3O62B 1ID3B 3KUYB 3AYWB 5CPKC 1S32A 5F99C 4X23C 3B0CT 3B6GD 1P3ID 1P3LB 4Z66A 5BT1C 1ZLAB 3MGQA 1P34B 4LD9C 3AZHA 5AV9C 1B6WA 2L5AA 1F66C 1KX5B 5C3IC 5B2JA 4WU8B 4R8PC 5B24B 3AZNA 1M1AC 3X1SB 3W96A 5B0YA 3WA9C 5GT0B 1HQ3D 5G49A 2CV5D 4Z2MH 1H3OB 3C1CD 4XZQC 1P3KB 1P3MA 1P3OC 3VH5T 3LZ1B 4H9PA 3REJD 2CWEA 3R45B 1TZYC 3AZLD 3AZEB 3LZ0D 4H9QB 3MVDB 3REIA 5B32D 5DNMA 3O62D 3KUYD 3AYWD 3AV2B 3AZMC 3WTPA 5FUGB 3W97A 3KXBC 4XUJC 3AZKB 1P3LD 5B1LC 5B40D 4CAYA 2PYOB 1M19A 4KHAA 1P34D 5AV8C 1KX5D 3MNNA 4WU8D 1M18B 4KUDB 4Z5TB 3X1SD 3C1BC 5GT0D 3NQUA 2AROB 5B0ZD 3X1UB 4J8XB 3UT9A 3X1TC 4HGAC 3AN2B 3AFAA 4H9NB 5AY8C 3W99B 3MGRC 3WAAA 3AZFC 3VH6T 3KWQB 3WKJA 5B31B 5CPKA 5B33C 3AZED 4G91C 3MVDD 1A7WA 1KX3D 1U35B 4H9SC 3AZKD 5B2IB 2PYOD 4WU9C 3AZJD 3KSYA 2F8NH 3MGPA 4YM6A 4R8PA 1M1AA 4JJNB 3REHD 1AOIB 3WA9A 1TAFA 3UTBC 1P3BC 4KUDD 1M18D 4XZQA 4Z5TD 1S32C 1P3OA 2AROD 5KDMA 2IO5B 5JRGB 3AZGC 3AN2D 1EQZB 1TZYA 4Z66C 3W99D 3UTAB 3MGQB 3B0BA 3KWQD 3AZHB 3AV1C 1P3AB 5B31D 3AZMA 5GT3B 3KXBA 1KU5A 5B0YB 3AZNC 2NZDA 3TU4B 4NFTA 4H9RB 5GSUB 4ZBJB 3AZIB 2YFVB 5AV8A 1P3MC 5B2ID 4UUZA 4QLCA 1P3FD 4JJND 1AOID 2HUEC 5BNXA 3REIB 3X1TA 5DNMC 2YFWB 5JA4A 2HIOB 3WTPB 5AY8A 3LJAB 3B0DC 4J8VB 3W97B 4KGCC 3MGRA 5JRGD 5B32G 1EQZD 3MGSA 1P3GB 1R4VA 3UTAD 4KHAB 1P3AD 5B1MC 4H9SA 5AV6B 5AVBC 3RELB 4ZUXC 5GT3D 2RVQC 3V9RA 3MNNC 2JSSA 4J8UA 1BH8B 3TU4D 4WU9A 5GSUD 3UT9C 5AVCD 3AZID 3AFAC 3UTBA 3WAAB 5CPKB 5F99B 3WKJC 4NE3A 5CP6B 5GXQB 4X23B 1KX4D 3AZGA 2HIOD 4J8VD 3LJAD 5BS7C 4LD9B 3AV1A 4WNNB 5AV9B 1HQ3C 1P3GD 1F66B 5C3IB 3W98D 3MGPC 4R8PB 1M1AB 4YM6C 2NQBD 3WA9B 3LELA 1TAFB 5AV6D 3REJC 4EO5C 3RELD 4XZQB 3AZLC 3REKD 1P3OB 1P3PA 2F8ND 3B6FA 3O62C 3X1VA 1BFMA 4E45A 5BNVA 5AV5D 4YS3D 5B40C 5F99D 1ID3D 3AZMB 5CP6D 5GXQD 4X23D 4KGCA 1P34C 3KXBB 4XUJB 5B1LB 5B31G 4J8WC 4WU8C 2NZDC 1ZLAD 5CPJA 3A6NA 2FJ7A 4LD9D 5AV8B 5B0ZC 5B1MA 5AV9D 1F66D 4UUZB 5AVBA 4ZUXA 4QLCC 2BYKB 3C1BB 5B24D 3X1TB 4HGAB 4CSRA 4G92C 1P3KD 5E5AC 3MVDC 5AY8B 1KX3C 3B6GA 1Q9CA 4Z2MG 3MGRB 3LZ1D 3AZFB 1P3IA 5B33B 3MGSC 1HTAA 1JFIB 4H9OA 3AZJC 3AV2D 4WZSB 3V9RB 3REHC 5BS7A 4XUJD 1N1JA 4J8UC 5B1LD 1B67A 1HQ3A 4WU9B 2CV5A 3C1CA 4KUDC 1P3BB 3REJA 3AZLA 3LZ0A 3C1BD 1S32B 3W99C 5B32A 3X1UD 3O62A 3KUYA 4J8XD 3AYWA 4WV4B 3AZGB 4Z66B 3AZFD 1P3LA 5B40A 5B33D 5BO0A 5B2JB 1P34A 3AZNB 5B2IC 3W96B 1U35D 3LELC 4J8WA 1P3FC 1KX5A 4WU8A 5G49B 3WTPE 5DNNC 3X1SA 5CPIC 5GT0A 1P3MB 4NE5A 5B0ZA 1P3PC 3B6FC 4H9PB 3X1VC 5BNVB 2F8NG 1P3BD 2HUEB 3R45A 5DNMB 1S32D 5E5AA 3MVDA 3UTAC 1KX3A 3B0DB 4KGCB
chains in the Genus database with same CATH superfamily
4Z66D 3NQJA 4CAYB 5CPJC 1M19B 3A6NC 3MGQD 3AZKA 2FJ7C 5B1MB 2PYOA 3AZHD 3AZJA 1WWIA 5AVBB 5AVCC 4ZUXB 1BH9A 2ZM5A 4NE6A 5B2JD 2Y2QA 3MNNB 3REHA 2JCHA 3AZND 3W96D 3EPHA 5B0YD 3NQUB 4KUDA 1M18A 3UT9B 4Z5TA 1W2EA 4DQYB 2ZY3A 2AROA 3AFAB 1P3MD 1KX4C 3B6GC 3AN2A 2JE5A 1P3IC 3WKJB 2Y2OA 3LJAC 3W99A 3KWQA 3REID 5B31A 5DNMD 3W98C 3WTPD 3W97D 2NQBC 2CV5C 4DRAA 3C1CC 3MGPB 1M19D 3REKC 4YM6B 1ULYA 5B2IA 4AWLC 5AVBD 3REJB 4EO5B 1P3FA 3AZLB 5DNNA 3MNND 2RVQD 4JJNA 5CPIA 1AOIA 3LZ0C 5AV5C 5KDMB 4YS3C 5B32C 2Y2HA 3UT9D 3IP4C 3KUYC 1ID3C 3AYWC 1TZYB 5CP6C 5GXQC 3AFAD 4M6BA 5JRGA 1EQZA 2BYMA 5B40B 3WAAD 1P3LC 3WKJD 5CPKD 1ZLAC 3UTAA 5BO0B 1P3AA 4J8WB 5BT1D 2NZDB 1KX5C 5GT3A 5B24C 3X1SC 5B0ZB 5GT0C 3TU4A 4H9RA 5GSUA 5AVCA 4QLCB 3MGPD 2YFVA 3AZIA 1P3KC 4YM6D 4R8PD 1M1AD 3H0LC 3WA9D 3VH5A 3LZ1C 5BNXB 4G92B 4XZQD 3AZEC 5E5AB 5JA4B 1P3OD 1KX3B 1KX4A 2YFWA 3AV2C 1TZYD 2HIOA 3NQJB 3MGSB 4J8VA 3LJAA 1PZRA 4G91B 3AZKC 1P3GA 3AZJB 2PYOC 3W98A 3AZMD 1BH9B 3REHB 2NQBA 5CHLB 4J8UB 3KXBD 5AV6A 4J8WD 3RELA 2NZDD 3B0CW 1M18C 4Z5TC 3REKA 1BH8A 2F8NA 3X1UC 2AROC 5AV8D 4J8XC 2Y2LA 3UTBB 4QLCD 3AN2C 5AV5A 2VQRA 4YS3A 3X1TD 3KWQC 5F99A 1ID3A 3VH6A 5B31C 5CP6A 5GXQA 5E5AD 4X23A 5AY8D 3FDDA 3MGRD 1U35C 3AV1B 3MGSD 1ZLAA 3VH5W 4LD9A 2ZY2A 4WNNA 5AV9A 1F66A 3LELB 1WWSA 1P3FB 1T3UA 5DNNB 3AL0C 5CPIB 5B24A 4J8UD 4JJNC 1AOIC 1P3PB 3B6FB 2Y2NA 4WU9D 1H3OA 1P3KA 3X1VB 2IO5C 3LZ1A 3UTBD 2BYMB 5JRGC 1EQZC 3AZEA 4H9QA 3MGQC 3AZHC 3AZGD 1P3AC 3AV2A 5B2JC 5FUGA 5CPJB 4XUJA 5GT3C 3A6NB 3W96C 5B1LA 5B0YC 2FJ7B 3AV1D 3EPKA 3TU4C 3H0MC 5AVCB 5GSUC 4ZBJC 3VH6W 3AZIC 3LELD 4E44A 5DNND 2BYKA 5CPID 3C1BA 4CSRB 3EPLA 3X1UA 1KX4B 1P3PD 4J8XA 3REIC 3B6GB 3B6FD 1Z2CB 1P3IB 3X1VD 2ZY4A 2HIOC 4H9NA 3WTPC 4J8VC 3W97C 3AZFA 4H9OB 5B33A 1P3GC 1JFIA 3W98B 1M19C 4KGCD 2NQBB 1U35A 1N1JB 1HQ3B 5AV6C 2CV5B 3C1CB 3RELC 5CPJD 3REKB 3A6ND 2FJ7D 2F8NB 4AWLB 5B1MD 2LY8A 4DRBA 4ZUXD 2F8NK 2G5IC 3LZ0B 5AV5B 1F1EA 1P3BA 3P5JB 3EPJA 4YS3B 3WAAC 5B32B 3O62B 1ID3B 3KUYB 3AYWB 5CPKC 1S32A 5F99C 4X23C 3B0CT 3B6GD 1P3ID 2Y2IA 1P3LB 4Z66A 5BT1C 1ZLAB 2DF4C 3MGQA 1P34B 4LD9C 3AZHA 5AV9C 1B6WA 2L5AA 1F66C 1KX5B 5C3IC 5B2JA 4WU8B 4R8PC 5B24B 3AZNA 1M1AC 3W96A 3X1SB 5B0YA 3WA9C 5GT0B 1HQ3D 5G49A 2Y2PA 2CV5D 4Z2MH 1H3OB 3C1CD 4XZQC 1P3KB 1P3MA 1P3OC 3VH5T 3LZ1B 3F6TA 4H9PA 3REJD 2CWEA 3R45B 1TZYC 3AZLD 3AZEB 3LZ0D 4H9QB 3MVDB 3REIA 5B32D 5DNMA 3O62D 3KUYD 3AYWD 3AV2B 3AZMC 3WTPA 2J8PA 5FUGB 3W97A 3KXBC 4XUJC 3AZKB 1P3LD 5B1LC 5B40D 4CAYA 2PYOB 1M19A 4KHAA 1P34D 5AV8C 1KX5D 3MNNA 4WU8D 1M18B 4KUDB 4Z5TB 3X1SD 3C1BC 5GT0D 3NQUA 2AROB 5B0ZD 3X1UB 4J8XB 3UT9A 3X1TC 2Y2GA 4HGAC 3AN2B 3AFAA 4H9NB 5AY8C 3W99B 3MGRC 3WAAA 3AZFC 3VH6T 3KWQB 3WKJA 5B31B 5CPKA 5B33C 3AZED 4G91C 3MVDD 1A7WA 1KX3D 1U35B 4H9SC 2ZY5A 3AZKD 3KFUG 5B2IB 2PYOD 4WU9C 3AZJD 3KSYA 2F8NH 3MGPA 4YM6A 4R8PA 1M1AA 4JJNB 3REHD 1AOIB 3WA9A 1TAFA 3UTBC 1P3BC 4KUDD 1M18D 4XZQA 4Z5TD 1S32C 1P3OA 2AROD 5KDMA 2IO5B 5JRGB 3AZGC 3AN2D 1EQZB 1TZYA 4Z66C 3W99D 3UTAB 3MGQB 3B0BA 3KWQD 3AZHB 3AV1C 1P3AB 5B31D 3H0RC 2Y2JA 3AZMA 5GT3B 3KXBA 1KU5A 5B0YB 3AZNC 2NZDA 3TU4B 4NFTA 4H9RB 5GSUB 4ZBJB 2UWXA 2YFVB 3AZIB 5AV8A 1P3MC 5B2ID 4UUZA 4QLCA 1P3FD 4JJND 1AOID 2HUEC 5BNXA 3REIB 3X1TA 5DNMC 2YFWB 5JA4A 2HIOB 3WTPB 5AY8A 3LJAB 3B0DC 4J8VB 3W97B 4KGCC 3MGRA 5JRGD 5B32G 1EQZD 3MGSA 1P3GB 1R4VA 3UTAD 4KHAB 1P3AD 5B1MC 4H9SA 5AV6B 5AVBC 3RELB 4ZUXC 5GT3D 2RVQC 3V9RA 3MNNC 2JSSA 4J8UA 1BH8B 2Y2KA 3TU4D 4WU9A 5GSUD 3UT9C 5AVCD 3AZID 3AFAC 3UTBA 3WAAB 5CPKB 5F99B 3WKJC 4NE3A 5CP6B 5GXQB 4X23B 1KX4D 3AZGA 2HIOD 4J8VD 3LJAD 2XD1A 2DQNC 5BS7C 4LD9B 3AV1A 2G5HC 4WNNB 5AV9B 1HQ3C 1P3GD 1F66B 2XD5A 5C3IB 3W98D 3MGPC 4R8PB 1M1AB 4YM6C 2NQBD 3WA9B 3LELA 1TAFB 5AV6D 3REJC 4EO5C 3RELD 4XZQB 3AZLC 3REKD 1P3OB 1P3PA 2F8ND 3B6FA 3O62C 2F2AC 3X1VA 1BFMA 4E45A 5BNVA 5AV5D 2FFFB 2Y2MA 4YS3D 5B40C 5F99D 1ID3D 3AZMB 5CP6D 5GXQD 4X23D 4KGCA 1P34C 3KXBB 4XUJB 5B1LB 5B31G 4J8WC 4WU8C 2NZDC 1ZLAD 5CPJA 3A6NA 2FJ7A 4LD9D 5AV8B 5AV9D 5B1MA 5B0ZC 1F66D 4UUZB 5AVBA 4ZUXA 4QLCC 2BYKB 3C1BB 5B24D 3X1TB 4HGAB 4CSRA 3A1IA 4G92C 1P3KD 5E5AC 3MVDC 5AY8B 1KX3C 3B6GA 1Q9CA 2RIQA 4Z2MG 3MGRB 3LZ1D 3AZFB 1P3IA 5B33B 3MGSC 1HTAA 1JFIB 4H9OA 3AZJC 3AV2D 4WZSB 3V9RB 3REHC 5BS7A 4XUJD 1N1JA 4J8UC 5B1LD 1B67A 1HQ3A 4WU9B 2CV5A 3C1CA 4KUDC 2BG1A 1P3BB 2W8SA 3REJA 3AZLA 3LZ0A 3C1BD 1S32B 3W99C 5B32A 3X1UD 3O62A 3EG5B 3KUYA 4J8XD 4WV4B 3AYWA 3AZGB 4Z66B 3AZFD 1P3LA 4WJ3C 5B40A 5B33D 5BO0A 5B2JB 1P34A 3AZNB 5B2IC 3W96B 1U35D 3LELC 4J8WA 3A1KA 1P3FC 4WU8A 1KX5A 5G49B 5DNNC 3WTPE 3X1SA 5CPIC 5GT0A 1P3MB 4NE5A 5B0ZA 1P3PC 3B6FC 4H9PB 3X1VC 5BNVB 2F8NG 1P3BD 2HUEB 3R45A 5DNMB 1S32D 4UPKA 5E5AA 3MVDA 3UTAC 1KX3A 3B0DB 4KGCB
chains in the Genus database with same CATH topology
4Z66D 3NQJA 4CAYB 5CPJC 1M19B 3A6NC 3MGQD 3AZKA 2FJ7C 5B1MB 2PYOA 3AZHD 3AZJA 1WWIA 5AVBB 5AVCC 4ZUXB 1BH9A 2ZM5A 4NE6A 5B2JD 2Y2QA 3MNNB 3REHA 2JCHA 3AZND 3W96D 3EPHA 5B0YD 3NQUB 4KUDA 1M18A 3UT9B 4Z5TA 1W2EA 4DQYB 2ZY3A 2AROA 3AFAB 1P3MD 1KX4C 3B6GC 3AN2A 2JE5A 1P3IC 3WKJB 2Y2OA 3LJAC 3W99A 3KWQA 3REID 5B31A 5DNMD 3W98C 3WTPD 3W97D 2NQBC 2CV5C 4DRAA 3C1CC 3MGPB 1M19D 3REKC 4YM6B 1ULYA 5B2IA 4AWLC 5AVBD 3REJB 4EO5B 1P3FA 3AZLB 5DNNA 3MNND 2RVQD 4JJNA 5CPIA 1AOIA 3LZ0C 5AV5C 5KDMB 4YS3C 5B32C 2Y2HA 3UT9D 3IP4C 3KUYC 1ID3C 3AYWC 1TZYB 5CP6C 5GXQC 3AFAD 4M6BA 5JRGA 1EQZA 2BYMA 5B40B 3WAAD 1P3LC 3WKJD 5CPKD 1ZLAC 3UTAA 5BO0B 1P3AA 4J8WB 5BT1D 2NZDB 1KX5C 5GT3A 5B24C 3X1SC 5B0ZB 5GT0C 3TU4A 4H9RA 5GSUA 5AVCA 4QLCB 3MGPD 2YFVA 3AZIA 1P3KC 4YM6D 4R8PD 1M1AD 3H0LC 3WA9D 3VH5A 3LZ1C 5BNXB 4G92B 4XZQD 3AZEC 5E5AB 5JA4B 1P3OD 1KX3B 1KX4A 2YFWA 3AV2C 1TZYD 2HIOA 3NQJB 3MGSB 4J8VA 3LJAA 1PZRA 4G91B 3AZKC 1P3GA 3AZJB 2PYOC 3W98A 3AZMD 1BH9B 3REHB 2NQBA 5CHLB 4J8UB 3KXBD 5AV6A 4J8WD 3RELA 2NZDD 3B0CW 1M18C 4Z5TC 3REKA 1BH8A 2F8NA 3X1UC 2AROC 5AV8D 4J8XC 2Y2LA 3UTBB 4QLCD 3AN2C 5AV5A 2VQRA 4YS3A 3X1TD 3KWQC 5F99A 1ID3A 3VH6A 5B31C 5CP6A 5GXQA 5E5AD 4X23A 5AY8D 3FDDA 3MGRD 1U35C 3AV1B 3MGSD 1ZLAA 3VH5W 4LD9A 2ZY2A 4WNNA 5AV9A 1F66A 3LELB 1WWSA 1P3FB 1T3UA 5DNNB 3AL0C 5CPIB 5B24A 4J8UD 4JJNC 1AOIC 1P3PB 3B6FB 2Y2NA 4WU9D 1H3OA 1P3KA 3X1VB 2IO5C 3LZ1A 3UTBD 2BYMB 5JRGC 1EQZC 3AZEA 4H9QA 3MGQC 3AZHC 3AZGD 1P3AC 3AV2A 5B2JC 5FUGA 5CPJB 4XUJA 5GT3C 3A6NB 3W96C 5B1LA 5B0YC 2FJ7B 3AV1D 3EPKA 3TU4C 3H0MC 5AVCB 5GSUC 4ZBJC 3VH6W 3AZIC 3LELD 4E44A 5DNND 2BYKA 5CPID 3C1BA 4CSRB 3EPLA 3X1UA 1KX4B 1P3PD 4J8XA 3REIC 3B6GB 3B6FD 1Z2CB 1P3IB 3X1VD 2ZY4A 2HIOC 4H9NA 3WTPC 4J8VC 3W97C 3AZFA 4H9OB 5B33A 1P3GC 1JFIA 3W98B 1M19C 4KGCD 2NQBB 1U35A 1N1JB 1HQ3B 5AV6C 2CV5B 3C1CB 3RELC 5CPJD 3REKB 3A6ND 2FJ7D 2F8NB 4AWLB 5B1MD 2LY8A 4DRBA 4ZUXD 2F8NK 2G5IC 3LZ0B 5AV5B 1F1EA 1P3BA 3P5JB 3EPJA 4YS3B 3WAAC 5B32B 3O62B 1ID3B 3KUYB 3AYWB 5CPKC 1S32A 5F99C 4X23C 3B0CT 3B6GD 1P3ID 2Y2IA 1P3LB 4Z66A 5BT1C 1ZLAB 2DF4C 3MGQA 1P34B 4LD9C 3AZHA 5AV9C 1B6WA 2L5AA 1F66C 1KX5B 5C3IC 5B2JA 4WU8B 4R8PC 5B24B 3AZNA 1M1AC 3W96A 3X1SB 5B0YA 3WA9C 5GT0B 1HQ3D 5G49A 2Y2PA 2CV5D 4Z2MH 1H3OB 3C1CD 4XZQC 1P3KB 1P3MA 1P3OC 3VH5T 3LZ1B 3F6TA 4H9PA 3REJD 2CWEA 3R45B 1TZYC 3AZLD 3AZEB 3LZ0D 4H9QB 3MVDB 3REIA 5B32D 5DNMA 3O62D 3KUYD 3AYWD 3AV2B 3AZMC 3WTPA 2J8PA 5FUGB 3W97A 3KXBC 4XUJC 3AZKB 1P3LD 5B1LC 5B40D 4CAYA 2PYOB 1M19A 4KHAA 1P34D 5AV8C 1KX5D 3MNNA 4WU8D 1M18B 4KUDB 4Z5TB 3X1SD 3C1BC 5GT0D 3NQUA 2AROB 5B0ZD 3X1UB 4J8XB 3UT9A 3X1TC 2Y2GA 4HGAC 3AN2B 3AFAA 4H9NB 5AY8C 3W99B 3MGRC 3WAAA 3AZFC 3VH6T 3KWQB 3WKJA 5B31B 5CPKA 5B33C 3AZED 4G91C 3MVDD 1A7WA 1KX3D 1U35B 4H9SC 2ZY5A 3AZKD 3KFUG 5B2IB 2PYOD 4WU9C 3AZJD 3KSYA 2F8NH 3MGPA 4YM6A 4R8PA 1M1AA 4JJNB 3REHD 1AOIB 3WA9A 1TAFA 3UTBC 1P3BC 4KUDD 1M18D 4XZQA 4Z5TD 1S32C 1P3OA 2AROD 5KDMA 2IO5B 5JRGB 3AZGC 3AN2D 1EQZB 1TZYA 4Z66C 3W99D 3UTAB 3MGQB 3B0BA 3KWQD 3AZHB 3AV1C 1P3AB 5B31D 3H0RC 2Y2JA 3AZMA 5GT3B 3KXBA 1KU5A 5B0YB 3AZNC 2NZDA 3TU4B 4NFTA 4H9RB 5GSUB 4ZBJB 2UWXA 2YFVB 3AZIB 5AV8A 1P3MC 5B2ID 4UUZA 4QLCA 1P3FD 4JJND 1AOID 2HUEC 5BNXA 3REIB 3X1TA 5DNMC 2YFWB 5JA4A 2HIOB 3WTPB 5AY8A 3LJAB 3B0DC 4J8VB 3W97B 4KGCC 3MGRA 5JRGD 5B32G 1EQZD 3MGSA 1P3GB 1R4VA 3UTAD 4KHAB 1P3AD 5B1MC 4H9SA 5AV6B 5AVBC 3RELB 4ZUXC 5GT3D 2RVQC 3V9RA 3MNNC 2JSSA 4J8UA 1BH8B 2Y2KA 3TU4D 4WU9A 5GSUD 3UT9C 5AVCD 3AZID 3AFAC 3UTBA 3WAAB 5CPKB 5F99B 3WKJC 4NE3A 5CP6B 5GXQB 4X23B 1KX4D 3AZGA 2HIOD 4J8VD 3LJAD 2XD1A 2DQNC 5BS7C 4LD9B 3AV1A 2G5HC 4WNNB 5AV9B 1HQ3C 1P3GD 1F66B 2XD5A 5C3IB 3W98D 3MGPC 4R8PB 1M1AB 4YM6C 2NQBD 3WA9B 3LELA 1TAFB 5AV6D 3REJC 4EO5C 3RELD 4XZQB 3AZLC 3REKD 1P3OB 1P3PA 2F8ND 3B6FA 3O62C 2F2AC 3X1VA 1BFMA 4E45A 5BNVA 5AV5D 2FFFB 2Y2MA 4YS3D 5B40C 5F99D 1ID3D 3AZMB 5CP6D 5GXQD 4X23D 4KGCA 1P34C 3KXBB 4XUJB 5B1LB 5B31G 4J8WC 4WU8C 2NZDC 1ZLAD 5CPJA 3A6NA 2FJ7A 4LD9D 5AV8B 5AV9D 5B1MA 5B0ZC 1F66D 4UUZB 5AVBA 4ZUXA 4QLCC 2BYKB 3C1BB 5B24D 3X1TB 4HGAB 4CSRA 3A1IA 4G92C 1P3KD 5E5AC 3MVDC 5AY8B 1KX3C 3B6GA 1Q9CA 2RIQA 4Z2MG 3MGRB 3LZ1D 3AZFB 1P3IA 5B33B 3MGSC 1HTAA 1JFIB 4H9OA 3AZJC 3AV2D 4WZSB 3V9RB 3REHC 5BS7A 4XUJD 1N1JA 4J8UC 5B1LD 1B67A 1HQ3A 4WU9B 2CV5A 3C1CA 4KUDC 2BG1A 1P3BB 2W8SA 3REJA 3AZLA 3LZ0A 3C1BD 1S32B 3W99C 5B32A 3X1UD 3O62A 3EG5B 3KUYA 4J8XD 4WV4B 3AYWA 3AZGB 4Z66B 3AZFD 1P3LA 4WJ3C 5B40A 5B33D 5BO0A 5B2JB 1P34A 3AZNB 5B2IC 3W96B 1U35D 3LELC 4J8WA 3A1KA 1P3FC 4WU8A 1KX5A 5G49B 5DNNC 3WTPE 3X1SA 5CPIC 5GT0A 1P3MB 4NE5A 5B0ZA 1P3PC 3B6FC 4H9PB 3X1VC 5BNVB 2F8NG 1P3BD 2HUEB 3R45A 5DNMB 1S32D 4UPKA 5E5AA 3MVDA 3UTAC 1KX3A 3B0DB 4KGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 D;  3NQJ A;  4CAY B;  5CPJ C;  1M19 B;  3A6N C;  3MGQ D;  3AZK A;  2FJ7 C;  5B1M B;  2PYO A;  3AZH D;  3AZJ A;  1WWI A;  5AVB B;  5AVC C;  4ZUX B;  1BH9 A;  4NE6 A;  5B2J D;  3MNN B;  3REH A;  3AZN D;  3W96 D;  5B0Y D;  3NQU B;  4KUD A;  1M18 A;  3UT9 B;  4Z5T A;  2ARO A;  3AFA B;  1P3M D;  1KX4 C;  3B6G C;  3AN2 A;  1P3I C;  3WKJ B;  3LJA C;  3W99 A;  3KWQ A;  3REI D;  5B31 A;  5DNM D;  3W98 C;  3WTP D;  3W97 D;  2NQB C;  2CV5 C;  4DRA A;  3C1C C;  3MGP B;  1M19 D;  3REK C;  4YM6 B;  1ULY A;  5B2I A;  4AWL C;  5AVB D;  3REJ B;  4EO5 B;  1P3F A;  3AZL B;  5DNN A;  3MNN D;  2RVQ D;  4JJN A;  5CPI A;  1AOI A;  3LZ0 C;  5AV5 C;  5KDM B;  4YS3 C;  5B32 C;  3UT9 D;  1ID3 C;  3KUY C;  3AYW C;  1TZY B;  5CP6 C;  5GXQ C;  3AFA D;  4M6B A;  5JRG A;  1EQZ A;  2BYM A;  5B40 B;  3WAA D;  1P3L C;  3WKJ D;  5CPK D;  1ZLA C;  3UTA A;  5BO0 B;  1P3A A;  4J8W B;  5BT1 D;  2NZD B;  1KX5 C;  5GT3 A;  5B24 C;  3X1S C;  5B0Z B;  5GT0 C;  3TU4 A;  4H9R A;  5GSU A;  5AVC A;  4QLC B;  3MGP D;  2YFV A;  3AZI A;  1P3K C;  4YM6 D;  4R8P D;  1M1A D;  3WA9 D;  3VH5 A;  3LZ1 C;  5BNX B;  4G92 B;  4XZQ D;  3AZE C;  5E5A B;  5JA4 B;  1P3O D;  1KX3 B;  1KX4 A;  2YFW A;  3AV2 C;  1TZY D;  2HIO A;  3NQJ B;  3MGS B;  4J8V A;  3LJA A;  4G91 B;  3AZK C;  1P3G A;  3AZJ B;  2PYO C;  3W98 A;  3AZM D;  1BH9 B;  3REH B;  2NQB A;  5CHL B;  4J8U B;  3KXB D;  5AV6 A;  4J8W D;  3REL A;  2NZD D;  3B0C W;  1M18 C;  4Z5T C;  3REK A;  1BH8 A;  2F8N A;  3X1U C;  2ARO C;  5AV8 D;  4J8X C;  3UTB B;  4QLC D;  3AN2 C;  5AV5 A;  4YS3 A;  3X1T D;  3KWQ C;  5F99 A;  1ID3 A;  3VH6 A;  5B31 C;  5CP6 A;  5GXQ A;  5E5A D;  4X23 A;  5AY8 D;  3MGR D;  1U35 C;  3AV1 B;  3MGS D;  1ZLA A;  3VH5 W;  4LD9 A;  4WNN A;  5AV9 A;  1F66 A;  3LEL B;  1WWS A;  1P3F B;  5DNN B;  5CPI B;  5B24 A;  4J8U D;  4JJN C;  1AOI C;  1P3P B;  3B6F B;  4WU9 D;  1H3O A;  1P3K A;  3X1V B;  2IO5 C;  3LZ1 A;  3UTB D;  2BYM B;  5JRG C;  1EQZ C;  3AZE A;  4H9Q A;  3MGQ C;  3AZH C;  3AZG D;  1P3A C;  3AV2 A;  5B2J C;  5FUG A;  5CPJ B;  4XUJ A;  5GT3 C;  3A6N B;  3W96 C;  5B1L A;  5B0Y C;  2FJ7 B;  3AV1 D;  3TU4 C;  5AVC B;  5GSU C;  4ZBJ C;  3VH6 W;  3AZI C;  3LEL D;  4E44 A;  5DNN D;  2BYK A;  5CPI D;  3C1B A;  4CSR B;  3X1U A;  1KX4 B;  1P3P D;  4J8X A;  3REI C;  3B6G B;  3B6F D;  1P3I B;  3X1V D;  2HIO C;  4H9N A;  3WTP C;  4J8V C;  3W97 C;  3AZF A;  4H9O B;  5B33 A;  1P3G C;  1JFI A;  3W98 B;  1M19 C;  4KGC D;  2NQB B;  1U35 A;  1N1J B;  1HQ3 B;  5AV6 C;  2CV5 B;  3C1C B;  3REL C;  5CPJ D;  3REK B;  3A6N D;  2FJ7 D;  2F8N B;  4AWL B;  5B1M D;  2LY8 A;  4DRB A;  4ZUX D;  2F8N K;  3LZ0 B;  5AV5 B;  1F1E A;  1P3B A;  4YS3 B;  3WAA C;  5B32 B;  3O62 B;  1ID3 B;  3KUY B;  3AYW B;  5CPK C;  1S32 A;  5F99 C;  4X23 C;  3B0C T;  3B6G D;  1P3I D;  1P3L B;  4Z66 A;  5BT1 C;  1ZLA B;  3MGQ A;  1P34 B;  4LD9 C;  3AZH A;  5AV9 C;  1B6W A;  2L5A A;  1F66 C;  1KX5 B;  5C3I C;  5B2J A;  4WU8 B;  4R8P C;  5B24 B;  3AZN A;  1M1A C;  3X1S B;  3W96 A;  5B0Y A;  3WA9 C;  5GT0 B;  1HQ3 D;  5G49 A;  2CV5 D;  4Z2M H;  1H3O B;  3C1C D;  4XZQ C;  1P3K B;  1P3M A;  1P3O C;  3VH5 T;  3LZ1 B;  4H9P A;  3REJ D;  2CWE A;  3R45 B;  1TZY C;  3AZL D;  3AZE B;  3LZ0 D;  4H9Q B;  3MVD B;  3REI A;  5B32 D;  5DNM A;  3O62 D;  3KUY D;  3AYW D;  3AV2 B;  3AZM C;  3WTP A;  5FUG B;  3W97 A;  3KXB C;  4XUJ C;  3AZK B;  1P3L D;  5B1L C;  5B40 D;  4CAY A;  2PYO B;  1M19 A;  4KHA A;  1P34 D;  5AV8 C;  1KX5 D;  3MNN A;  4WU8 D;  1M18 B;  4KUD B;  4Z5T B;  3X1S D;  3C1B C;  5GT0 D;  3NQU A;  2ARO B;  5B0Z D;  3X1U B;  4J8X B;  3UT9 A;  3X1T C;  4HGA C;  3AN2 B;  3AFA A;  4H9N B;  5AY8 C;  3W99 B;  3MGR C;  3WAA A;  3AZF C;  3VH6 T;  3KWQ B;  3WKJ A;  5B31 B;  5CPK A;  5B33 C;  3AZE D;  4G91 C;  3MVD D;  1A7W A;  1KX3 D;  1U35 B;  4H9S C;  3AZK D;  5B2I B;  2PYO D;  4WU9 C;  3AZJ D;  3KSY A;  2F8N H;  3MGP A;  4YM6 A;  4R8P A;  1M1A A;  4JJN B;  3REH D;  1AOI B;  3WA9 A;  1TAF A;  3UTB C;  1P3B C;  4KUD D;  1M18 D;  4XZQ A;  4Z5T D;  1S32 C;  1P3O A;  2ARO D;  5KDM A;  2IO5 B;  5JRG B;  3AZG C;  3AN2 D;  1EQZ B;  1TZY A;  4Z66 C;  3W99 D;  3UTA B;  3MGQ B;  3B0B A;  3KWQ D;  3AZH B;  3AV1 C;  1P3A B;  5B31 D;  3AZM A;  5GT3 B;  3KXB A;  1KU5 A;  5B0Y B;  3AZN C;  2NZD A;  3TU4 B;  4NFT A;  4H9R B;  5GSU B;  4ZBJ B;  3AZI B;  2YFV B;  5AV8 A;  1P3M C;  5B2I D;  4UUZ A;  4QLC A;  1P3F D;  4JJN D;  1AOI D;  2HUE C;  5BNX A;  3REI B;  3X1T A;  5DNM C;  2YFW B;  5JA4 A;  2HIO B;  3WTP B;  5AY8 A;  3LJA B;  3B0D C;  4J8V B;  3W97 B;  4KGC C;  3MGR A;  5JRG D;  5B32 G;  1EQZ D;  3MGS A;  1P3G B;  1R4V A;  3UTA D;  4KHA B;  1P3A D;  5B1M C;  4H9S A;  5AV6 B;  5AVB C;  3REL B;  4ZUX C;  5GT3 D;  2RVQ C;  3V9R A;  3MNN C;  2JSS A;  4J8U A;  1BH8 B;  3TU4 D;  4WU9 A;  5GSU D;  3UT9 C;  5AVC D;  3AZI D;  3AFA C;  3UTB A;  3WAA B;  5CPK B;  5F99 B;  3WKJ C;  4NE3 A;  5CP6 B;  5GXQ B;  4X23 B;  1KX4 D;  3AZG A;  2HIO D;  4J8V D;  3LJA D;  5BS7 C;  4LD9 B;  3AV1 A;  4WNN B;  5AV9 B;  1HQ3 C;  1P3G D;  1F66 B;  5C3I B;  3W98 D;  3MGP C;  4R8P B;  1M1A B;  4YM6 C;  2NQB D;  3WA9 B;  3LEL A;  1TAF B;  5AV6 D;  3REJ C;  4EO5 C;  3REL D;  4XZQ B;  3AZL C;  3REK D;  1P3O B;  1P3P A;  2F8N D;  3B6F A;  3O62 C;  3X1V A;  1BFM A;  4E45 A;  5BNV A;  5AV5 D;  4YS3 D;  5B40 C;  5F99 D;  1ID3 D;  3AZM B;  5CP6 D;  5GXQ D;  4X23 D;  4KGC A;  1P34 C;  3KXB B;  4XUJ B;  5B1L B;  5B31 G;  4J8W C;  4WU8 C;  2NZD C;  1ZLA D;  5CPJ A;  3A6N A;  2FJ7 A;  4LD9 D;  5AV8 B;  5B0Z C;  5B1M A;  5AV9 D;  1F66 D;  4UUZ B;  5AVB A;  4ZUX A;  4QLC C;  2BYK B;  3C1B B;  5B24 D;  3X1T B;  4HGA B;  4CSR A;  4G92 C;  1P3K D;  5E5A C;  3MVD C;  5AY8 B;  1KX3 C;  3B6G A;  1Q9C A;  4Z2M G;  3MGR B;  3LZ1 D;  3AZF B;  1P3I A;  5B33 B;  3MGS C;  1HTA A;  1JFI B;  4H9O A;  3AZJ C;  3AV2 D;  4WZS B;  3V9R B;  3REH C;  5BS7 A;  4XUJ D;  1N1J A;  4J8U C;  5B1L D;  1B67 A;  1HQ3 A;  4WU9 B;  2CV5 A;  3C1C A;  4KUD C;  1P3B B;  3REJ A;  3AZL A;  3LZ0 A;  3C1B D;  1S32 B;  3W99 C;  5B32 A;  3X1U D;  3O62 A;  3KUY A;  4J8X D;  3AYW A;  4WV4 B;  3AZG B;  4Z66 B;  3AZF D;  1P3L A;  5B40 A;  5B33 D;  5BO0 A;  5B2J B;  1P34 A;  3AZN B;  5B2I C;  3W96 B;  1U35 D;  3LEL C;  4J8W A;  1P3F C;  1KX5 A;  4WU8 A;  5G49 B;  3WTP E;  5DNN C;  3X1S A;  5CPI C;  5GT0 A;  1P3M B;  4NE5 A;  5B0Z A;  1P3P C;  3B6F C;  4H9P B;  3X1V C;  5BNV B;  2F8N G;  1P3B D;  2HUE B;  3R45 A;  5DNM B;  1S32 D;  5E5A A;  3MVD A;  3UTA C;  1KX3 A;  3B0D B;  4KGC B; 
#chains in the Genus database with same CATH topology
 4Z66 D;  3NQJ A;  4CAY B;  5CPJ C;  1M19 B;  3A6N C;  3MGQ D;  3AZK A;  2FJ7 C;  5B1M B;  2PYO A;  3AZH D;  3AZJ A;  1WWI A;  5AVB B;  5AVC C;  4ZUX B;  1BH9 A;  2ZM5 A;  4NE6 A;  5B2J D;  2Y2Q A;  3MNN B;  3REH A;  2JCH A;  3AZN D;  3W96 D;  3EPH A;  5B0Y D;  3NQU B;  4KUD A;  1M18 A;  3UT9 B;  4Z5T A;  1W2E A;  4DQY B;  2ZY3 A;  2ARO A;  3AFA B;  1P3M D;  1KX4 C;  3B6G C;  3AN2 A;  2JE5 A;  1P3I C;  3WKJ B;  2Y2O A;  3LJA C;  3W99 A;  3KWQ A;  3REI D;  5B31 A;  5DNM D;  3W98 C;  3WTP D;  3W97 D;  2NQB C;  2CV5 C;  4DRA A;  3C1C C;  3MGP B;  1M19 D;  3REK C;  4YM6 B;  1ULY A;  5B2I A;  4AWL C;  5AVB D;  3REJ B;  4EO5 B;  1P3F A;  3AZL B;  5DNN A;  3MNN D;  2RVQ D;  4JJN A;  5CPI A;  1AOI A;  3LZ0 C;  5AV5 C;  5KDM B;  4YS3 C;  5B32 C;  2Y2H A;  3UT9 D;  3IP4 C;  3KUY C;  1ID3 C;  3AYW C;  1TZY B;  5CP6 C;  5GXQ C;  3AFA D;  4M6B A;  5JRG A;  1EQZ A;  2BYM A;  5B40 B;  3WAA D;  1P3L C;  3WKJ D;  5CPK D;  1ZLA C;  3UTA A;  5BO0 B;  1P3A A;  4J8W B;  5BT1 D;  2NZD B;  1KX5 C;  5GT3 A;  5B24 C;  3X1S C;  5B0Z B;  5GT0 C;  3TU4 A;  4H9R A;  5GSU A;  5AVC A;  4QLC B;  3MGP D;  2YFV A;  3AZI A;  1P3K C;  4YM6 D;  4R8P D;  1M1A D;  3H0L C;  3WA9 D;  3VH5 A;  3LZ1 C;  5BNX B;  4G92 B;  4XZQ D;  3AZE C;  5E5A B;  5JA4 B;  1P3O D;  1KX3 B;  1KX4 A;  2YFW A;  3AV2 C;  1TZY D;  2HIO A;  3NQJ B;  3MGS B;  4J8V A;  3LJA A;  1PZR A;  4G91 B;  3AZK C;  1P3G A;  3AZJ B;  2PYO C;  3W98 A;  3AZM D;  1BH9 B;  3REH B;  2NQB A;  5CHL B;  4J8U B;  3KXB D;  5AV6 A;  4J8W D;  3REL A;  2NZD D;  3B0C W;  1M18 C;  4Z5T C;  3REK A;  1BH8 A;  2F8N A;  3X1U C;  2ARO C;  5AV8 D;  4J8X C;  2Y2L A;  3UTB B;  4QLC D;  3AN2 C;  5AV5 A;  2VQR A;  4YS3 A;  3X1T D;  3KWQ C;  5F99 A;  1ID3 A;  3VH6 A;  5B31 C;  5CP6 A;  5GXQ A;  5E5A D;  4X23 A;  5AY8 D;  3FDD A;  3MGR D;  1U35 C;  3AV1 B;  3MGS D;  1ZLA A;  3VH5 W;  4LD9 A;  2ZY2 A;  4WNN A;  5AV9 A;  1F66 A;  3LEL B;  1WWS A;  1P3F B;  1T3U A;  5DNN B;  3AL0 C;  5CPI B;  5B24 A;  4J8U D;  4JJN C;  1AOI C;  1P3P B;  3B6F B;  2Y2N A;  4WU9 D;  1H3O A;  1P3K A;  3X1V B;  2IO5 C;  3LZ1 A;  3UTB D;  2BYM B;  5JRG C;  1EQZ C;  3AZE A;  4H9Q A;  3MGQ C;  3AZH C;  3AZG D;  1P3A C;  3AV2 A;  5B2J C;  5FUG A;  5CPJ B;  4XUJ A;  5GT3 C;  3A6N B;  3W96 C;  5B1L A;  5B0Y C;  2FJ7 B;  3AV1 D;  3EPK A;  3TU4 C;  3H0M C;  5AVC B;  5GSU C;  4ZBJ C;  3VH6 W;  3AZI C;  3LEL D;  4E44 A;  5DNN D;  2BYK A;  5CPI D;  3C1B A;  4CSR B;  3EPL A;  3X1U A;  1KX4 B;  1P3P D;  4J8X A;  3REI C;  3B6G B;  3B6F D;  1Z2C B;  1P3I B;  3X1V D;  2ZY4 A;  2HIO C;  4H9N A;  3WTP C;  4J8V C;  3W97 C;  3AZF A;  4H9O B;  5B33 A;  1P3G C;  1JFI A;  3W98 B;  1M19 C;  4KGC D;  2NQB B;  1U35 A;  1N1J B;  1HQ3 B;  5AV6 C;  2CV5 B;  3C1C B;  3REL C;  5CPJ D;  3REK B;  3A6N D;  2FJ7 D;  2F8N B;  4AWL B;  5B1M D;  2LY8 A;  4DRB A;  4ZUX D;  2F8N K;  2G5I C;  3LZ0 B;  5AV5 B;  1F1E A;  1P3B A;  3P5J B;  3EPJ A;  4YS3 B;  3WAA C;  5B32 B;  3O62 B;  1ID3 B;  3KUY B;  3AYW B;  5CPK C;  1S32 A;  5F99 C;  4X23 C;  3B0C T;  3B6G D;  1P3I D;  2Y2I A;  1P3L B;  4Z66 A;  5BT1 C;  1ZLA B;  2DF4 C;  3MGQ A;  1P34 B;  4LD9 C;  3AZH A;  5AV9 C;  1B6W A;  2L5A A;  1F66 C;  1KX5 B;  5C3I C;  5B2J A;  4WU8 B;  4R8P C;  5B24 B;  3AZN A;  1M1A C;  3W96 A;  3X1S B;  5B0Y A;  3WA9 C;  5GT0 B;  1HQ3 D;  5G49 A;  2Y2P A;  2CV5 D;  4Z2M H;  1H3O B;  3C1C D;  4XZQ C;  1P3K B;  1P3M A;  1P3O C;  3VH5 T;  3LZ1 B;  3F6T A;  4H9P A;  3REJ D;  2CWE A;  3R45 B;  1TZY C;  3AZL D;  3AZE B;  3LZ0 D;  4H9Q B;  3MVD B;  3REI A;  5B32 D;  5DNM A;  3O62 D;  3KUY D;  3AYW D;  3AV2 B;  3AZM C;  3WTP A;  2J8P A;  5FUG B;  3W97 A;  3KXB C;  4XUJ C;  3AZK B;  1P3L D;  5B1L C;  5B40 D;  4CAY A;  2PYO B;  1M19 A;  4KHA A;  1P34 D;  5AV8 C;  1KX5 D;  3MNN A;  4WU8 D;  1M18 B;  4KUD B;  4Z5T B;  3X1S D;  3C1B C;  5GT0 D;  3NQU A;  2ARO B;  5B0Z D;  3X1U B;  4J8X B;  3UT9 A;  3X1T C;  2Y2G A;  4HGA C;  3AN2 B;  3AFA A;  4H9N B;  5AY8 C;  3W99 B;  3MGR C;  3WAA A;  3AZF C;  3VH6 T;  3KWQ B;  3WKJ A;  5B31 B;  5CPK A;  5B33 C;  3AZE D;  4G91 C;  3MVD D;  1A7W A;  1KX3 D;  1U35 B;  4H9S C;  2ZY5 A;  3AZK D;  3KFU G;  5B2I B;  2PYO D;  4WU9 C;  3AZJ D;  3KSY A;  2F8N H;  3MGP A;  4YM6 A;  4R8P A;  1M1A A;  4JJN B;  3REH D;  1AOI B;  3WA9 A;  1TAF A;  3UTB C;  1P3B C;  4KUD D;  1M18 D;  4XZQ A;  4Z5T D;  1S32 C;  1P3O A;  2ARO D;  5KDM A;  2IO5 B;  5JRG B;  3AZG C;  3AN2 D;  1EQZ B;  1TZY A;  4Z66 C;  3W99 D;  3UTA B;  3MGQ B;  3B0B A;  3KWQ D;  3AZH B;  3AV1 C;  1P3A B;  5B31 D;  3H0R C;  2Y2J A;  3AZM A;  5GT3 B;  3KXB A;  1KU5 A;  5B0Y B;  3AZN C;  2NZD A;  3TU4 B;  4NFT A;  4H9R B;  5GSU B;  4ZBJ B;  2UWX A;  2YFV B;  3AZI B;  5AV8 A;  1P3M C;  5B2I D;  4UUZ A;  4QLC A;  1P3F D;  4JJN D;  1AOI D;  2HUE C;  5BNX A;  3REI B;  3X1T A;  5DNM C;  2YFW B;  5JA4 A;  2HIO B;  3WTP B;  5AY8 A;  3LJA B;  3B0D C;  4J8V B;  3W97 B;  4KGC C;  3MGR A;  5JRG D;  5B32 G;  1EQZ D;  3MGS A;  1P3G B;  1R4V A;  3UTA D;  4KHA B;  1P3A D;  5B1M C;  4H9S A;  5AV6 B;  5AVB C;  3REL B;  4ZUX C;  5GT3 D;  2RVQ C;  3V9R A;  3MNN C;  2JSS A;  4J8U A;  1BH8 B;  2Y2K A;  3TU4 D;  4WU9 A;  5GSU D;  3UT9 C;  5AVC D;  3AZI D;  3AFA C;  3UTB A;  3WAA B;  5CPK B;  5F99 B;  3WKJ C;  4NE3 A;  5CP6 B;  5GXQ B;  4X23 B;  1KX4 D;  3AZG A;  2HIO D;  4J8V D;  3LJA D;  2XD1 A;  2DQN C;  5BS7 C;  4LD9 B;  3AV1 A;  2G5H C;  4WNN B;  5AV9 B;  1HQ3 C;  1P3G D;  1F66 B;  2XD5 A;  5C3I B;  3W98 D;  3MGP C;  4R8P B;  1M1A B;  4YM6 C;  2NQB D;  3WA9 B;  3LEL A;  1TAF B;  5AV6 D;  3REJ C;  4EO5 C;  3REL D;  4XZQ B;  3AZL C;  3REK D;  1P3O B;  1P3P A;  2F8N D;  3B6F A;  3O62 C;  2F2A C;  3X1V A;  1BFM A;  4E45 A;  5BNV A;  5AV5 D;  2FFF B;  2Y2M A;  4YS3 D;  5B40 C;  5F99 D;  1ID3 D;  3AZM B;  5CP6 D;  5GXQ D;  4X23 D;  4KGC A;  1P34 C;  3KXB B;  4XUJ B;  5B1L B;  5B31 G;  4J8W C;  4WU8 C;  2NZD C;  1ZLA D;  5CPJ A;  3A6N A;  2FJ7 A;  4LD9 D;  5AV8 B;  5AV9 D;  5B1M A;  5B0Z C;  1F66 D;  4UUZ B;  5AVB A;  4ZUX A;  4QLC C;  2BYK B;  3C1B B;  5B24 D;  3X1T B;  4HGA B;  4CSR A;  3A1I A;  4G92 C;  1P3K D;  5E5A C;  3MVD C;  5AY8 B;  1KX3 C;  3B6G A;  1Q9C A;  2RIQ A;  4Z2M G;  3MGR B;  3LZ1 D;  3AZF B;  1P3I A;  5B33 B;  3MGS C;  1HTA A;  1JFI B;  4H9O A;  3AZJ C;  3AV2 D;  4WZS B;  3V9R B;  3REH C;  5BS7 A;  4XUJ D;  1N1J A;  4J8U C;  5B1L D;  1B67 A;  1HQ3 A;  4WU9 B;  2CV5 A;  3C1C A;  4KUD C;  2BG1 A;  1P3B B;  2W8S A;  3REJ A;  3AZL A;  3LZ0 A;  3C1B D;  1S32 B;  3W99 C;  5B32 A;  3X1U D;  3O62 A;  3EG5 B;  3KUY A;  4J8X D;  4WV4 B;  3AYW A;  3AZG B;  4Z66 B;  3AZF D;  1P3L A;  4WJ3 C;  5B40 A;  5B33 D;  5BO0 A;  5B2J B;  1P34 A;  3AZN B;  5B2I C;  3W96 B;  1U35 D;  3LEL C;  4J8W A;  3A1K A;  1P3F C;  4WU8 A;  1KX5 A;  5G49 B;  5DNN C;  3WTP E;  3X1S A;  5CPI C;  5GT0 A;  1P3M B;  4NE5 A;  5B0Z A;  1P3P C;  3B6F C;  4H9P B;  3X1V C;  5BNV B;  2F8N G;  1P3B D;  2HUE B;  3R45 A;  5DNM B;  1S32 D;  4UPK A;  5E5A A;  3MVD A;  3UTA C;  1KX3 A;  3B0D B;  4KGC B; 
#chains in the Genus database with same CATH homology
 4Z66 D;  3NQJ A;  4CAY B;  5CPJ C;  1M19 B;  3A6N C;  3MGQ D;  3AZK A;  2FJ7 C;  5B1M B;  2PYO A;  3AZH D;  3AZJ A;  1WWI A;  5AVB B;  5AVC C;  4ZUX B;  1BH9 A;  2ZM5 A;  4NE6 A;  5B2J D;  2Y2Q A;  3MNN B;  3REH A;  2JCH A;  3AZN D;  3W96 D;  3EPH A;  5B0Y D;  3NQU B;  4KUD A;  1M18 A;  3UT9 B;  4Z5T A;  1W2E A;  4DQY B;  2ZY3 A;  2ARO A;  3AFA B;  1P3M D;  1KX4 C;  3B6G C;  3AN2 A;  2JE5 A;  1P3I C;  3WKJ B;  2Y2O A;  3LJA C;  3W99 A;  3KWQ A;  3REI D;  5B31 A;  5DNM D;  3W98 C;  3WTP D;  3W97 D;  2NQB C;  2CV5 C;  4DRA A;  3C1C C;  3MGP B;  1M19 D;  3REK C;  4YM6 B;  1ULY A;  5B2I A;  4AWL C;  5AVB D;  3REJ B;  4EO5 B;  1P3F A;  3AZL B;  5DNN A;  3MNN D;  2RVQ D;  4JJN A;  5CPI A;  1AOI A;  3LZ0 C;  5AV5 C;  5KDM B;  4YS3 C;  5B32 C;  2Y2H A;  3UT9 D;  3IP4 C;  3KUY C;  1ID3 C;  3AYW C;  1TZY B;  5CP6 C;  5GXQ C;  3AFA D;  4M6B A;  5JRG A;  1EQZ A;  2BYM A;  5B40 B;  3WAA D;  1P3L C;  3WKJ D;  5CPK D;  1ZLA C;  3UTA A;  5BO0 B;  1P3A A;  4J8W B;  5BT1 D;  2NZD B;  1KX5 C;  5GT3 A;  5B24 C;  3X1S C;  5B0Z B;  5GT0 C;  3TU4 A;  4H9R A;  5GSU A;  5AVC A;  4QLC B;  3MGP D;  2YFV A;  3AZI A;  1P3K C;  4YM6 D;  4R8P D;  1M1A D;  3H0L C;  3WA9 D;  3VH5 A;  3LZ1 C;  5BNX B;  4G92 B;  4XZQ D;  3AZE C;  5E5A B;  5JA4 B;  1P3O D;  1KX3 B;  1KX4 A;  2YFW A;  3AV2 C;  1TZY D;  2HIO A;  3NQJ B;  3MGS B;  4J8V A;  3LJA A;  1PZR A;  4G91 B;  3AZK C;  1P3G A;  3AZJ B;  2PYO C;  3W98 A;  3AZM D;  1BH9 B;  3REH B;  2NQB A;  5CHL B;  4J8U B;  3KXB D;  5AV6 A;  4J8W D;  3REL A;  2NZD D;  3B0C W;  1M18 C;  4Z5T C;  3REK A;  1BH8 A;  2F8N A;  3X1U C;  2ARO C;  5AV8 D;  4J8X C;  2Y2L A;  3UTB B;  4QLC D;  3AN2 C;  5AV5 A;  2VQR A;  4YS3 A;  3X1T D;  3KWQ C;  5F99 A;  1ID3 A;  3VH6 A;  5B31 C;  5CP6 A;  5GXQ A;  5E5A D;  4X23 A;  5AY8 D;  3FDD A;  3MGR D;  1U35 C;  3AV1 B;  3MGS D;  1ZLA A;  3VH5 W;  4LD9 A;  2ZY2 A;  4WNN A;  5AV9 A;  1F66 A;  3LEL B;  1WWS A;  1P3F B;  1T3U A;  5DNN B;  3AL0 C;  5CPI B;  5B24 A;  4J8U D;  4JJN C;  1AOI C;  1P3P B;  3B6F B;  2Y2N A;  4WU9 D;  1H3O A;  1P3K A;  3X1V B;  2IO5 C;  3LZ1 A;  3UTB D;  2BYM B;  5JRG C;  1EQZ C;  3AZE A;  4H9Q A;  3MGQ C;  3AZH C;  3AZG D;  1P3A C;  3AV2 A;  5B2J C;  5FUG A;  5CPJ B;  4XUJ A;  5GT3 C;  3A6N B;  3W96 C;  5B1L A;  5B0Y C;  2FJ7 B;  3AV1 D;  3EPK A;  3TU4 C;  3H0M C;  5AVC B;  5GSU C;  4ZBJ C;  3VH6 W;  3AZI C;  3LEL D;  4E44 A;  5DNN D;  2BYK A;  5CPI D;  3C1B A;  4CSR B;  3EPL A;  3X1U A;  1KX4 B;  1P3P D;  4J8X A;  3REI C;  3B6G B;  3B6F D;  1Z2C B;  1P3I B;  3X1V D;  2ZY4 A;  2HIO C;  4H9N A;  3WTP C;  4J8V C;  3W97 C;  3AZF A;  4H9O B;  5B33 A;  1P3G C;  1JFI A;  3W98 B;  1M19 C;  4KGC D;  2NQB B;  1U35 A;  1N1J B;  1HQ3 B;  5AV6 C;  2CV5 B;  3C1C B;  3REL C;  5CPJ D;  3REK B;  3A6N D;  2FJ7 D;  2F8N B;  4AWL B;  5B1M D;  2LY8 A;  4DRB A;  4ZUX D;  2F8N K;  2G5I C;  3LZ0 B;  5AV5 B;  1F1E A;  1P3B A;  3P5J B;  3EPJ A;  4YS3 B;  3WAA C;  5B32 B;  3O62 B;  1ID3 B;  3KUY B;  3AYW B;  5CPK C;  1S32 A;  5F99 C;  4X23 C;  3B0C T;  3B6G D;  1P3I D;  2Y2I A;  1P3L B;  4Z66 A;  5BT1 C;  1ZLA B;  2DF4 C;  3MGQ A;  1P34 B;  4LD9 C;  3AZH A;  5AV9 C;  1B6W A;  2L5A A;  1F66 C;  1KX5 B;  5C3I C;  5B2J A;  4WU8 B;  4R8P C;  5B24 B;  3AZN A;  1M1A C;  3W96 A;  3X1S B;  5B0Y A;  3WA9 C;  5GT0 B;  1HQ3 D;  5G49 A;  2Y2P A;  2CV5 D;  4Z2M H;  1H3O B;  3C1C D;  4XZQ C;  1P3K B;  1P3M A;  1P3O C;  3VH5 T;  3LZ1 B;  3F6T A;  4H9P A;  3REJ D;  2CWE A;  3R45 B;  1TZY C;  3AZL D;  3AZE B;  3LZ0 D;  4H9Q B;  3MVD B;  3REI A;  5B32 D;  5DNM A;  3O62 D;  3KUY D;  3AYW D;  3AV2 B;  3AZM C;  3WTP A;  2J8P A;  5FUG B;  3W97 A;  3KXB C;  4XUJ C;  3AZK B;  1P3L D;  5B1L C;  5B40 D;  4CAY A;  2PYO B;  1M19 A;  4KHA A;  1P34 D;  5AV8 C;  1KX5 D;  3MNN A;  4WU8 D;  1M18 B;  4KUD B;  4Z5T B;  3X1S D;  3C1B C;  5GT0 D;  3NQU A;  2ARO B;  5B0Z D;  3X1U B;  4J8X B;  3UT9 A;  3X1T C;  2Y2G A;  4HGA C;  3AN2 B;  3AFA A;  4H9N B;  5AY8 C;  3W99 B;  3MGR C;  3WAA A;  3AZF C;  3VH6 T;  3KWQ B;  3WKJ A;  5B31 B;  5CPK A;  5B33 C;  3AZE D;  4G91 C;  3MVD D;  1A7W A;  1KX3 D;  1U35 B;  4H9S C;  2ZY5 A;  3AZK D;  3KFU G;  5B2I B;  2PYO D;  4WU9 C;  3AZJ D;  3KSY A;  2F8N H;  3MGP A;  4YM6 A;  4R8P A;  1M1A A;  4JJN B;  3REH D;  1AOI B;  3WA9 A;  1TAF A;  3UTB C;  1P3B C;  4KUD D;  1M18 D;  4XZQ A;  4Z5T D;  1S32 C;  1P3O A;  2ARO D;  5KDM A;  2IO5 B;  5JRG B;  3AZG C;  3AN2 D;  1EQZ B;  1TZY A;  4Z66 C;  3W99 D;  3UTA B;  3MGQ B;  3B0B A;  3KWQ D;  3AZH B;  3AV1 C;  1P3A B;  5B31 D;  3H0R C;  2Y2J A;  3AZM A;  5GT3 B;  3KXB A;  1KU5 A;  5B0Y B;  3AZN C;  2NZD A;  3TU4 B;  4NFT A;  4H9R B;  5GSU B;  4ZBJ B;  2UWX A;  2YFV B;  3AZI B;  5AV8 A;  1P3M C;  5B2I D;  4UUZ A;  4QLC A;  1P3F D;  4JJN D;  1AOI D;  2HUE C;  5BNX A;  3REI B;  3X1T A;  5DNM C;  2YFW B;  5JA4 A;  2HIO B;  3WTP B;  5AY8 A;  3LJA B;  3B0D C;  4J8V B;  3W97 B;  4KGC C;  3MGR A;  5JRG D;  5B32 G;  1EQZ D;  3MGS A;  1P3G B;  1R4V A;  3UTA D;  4KHA B;  1P3A D;  5B1M C;  4H9S A;  5AV6 B;  5AVB C;  3REL B;  4ZUX C;  5GT3 D;  2RVQ C;  3V9R A;  3MNN C;  2JSS A;  4J8U A;  1BH8 B;  2Y2K A;  3TU4 D;  4WU9 A;  5GSU D;  3UT9 C;  5AVC D;  3AZI D;  3AFA C;  3UTB A;  3WAA B;  5CPK B;  5F99 B;  3WKJ C;  4NE3 A;  5CP6 B;  5GXQ B;  4X23 B;  1KX4 D;  3AZG A;  2HIO D;  4J8V D;  3LJA D;  2XD1 A;  2DQN C;  5BS7 C;  4LD9 B;  3AV1 A;  2G5H C;  4WNN B;  5AV9 B;  1HQ3 C;  1P3G D;  1F66 B;  2XD5 A;  5C3I B;  3W98 D;  3MGP C;  4R8P B;  1M1A B;  4YM6 C;  2NQB D;  3WA9 B;  3LEL A;  1TAF B;  5AV6 D;  3REJ C;  4EO5 C;  3REL D;  4XZQ B;  3AZL C;  3REK D;  1P3O B;  1P3P A;  2F8N D;  3B6F A;  3O62 C;  2F2A C;  3X1V A;  1BFM A;  4E45 A;  5BNV A;  5AV5 D;  2FFF B;  2Y2M A;  4YS3 D;  5B40 C;  5F99 D;  1ID3 D;  3AZM B;  5CP6 D;  5GXQ D;  4X23 D;  4KGC A;  1P34 C;  3KXB B;  4XUJ B;  5B1L B;  5B31 G;  4J8W C;  4WU8 C;  2NZD C;  1ZLA D;  5CPJ A;  3A6N A;  2FJ7 A;  4LD9 D;  5AV8 B;  5AV9 D;  5B1M A;  5B0Z C;  1F66 D;  4UUZ B;  5AVB A;  4ZUX A;  4QLC C;  2BYK B;  3C1B B;  5B24 D;  3X1T B;  4HGA B;  4CSR A;  3A1I A;  4G92 C;  1P3K D;  5E5A C;  3MVD C;  5AY8 B;  1KX3 C;  3B6G A;  1Q9C A;  2RIQ A;  4Z2M G;  3MGR B;  3LZ1 D;  3AZF B;  1P3I A;  5B33 B;  3MGS C;  1HTA A;  1JFI B;  4H9O A;  3AZJ C;  3AV2 D;  4WZS B;  3V9R B;  3REH C;  5BS7 A;  4XUJ D;  1N1J A;  4J8U C;  5B1L D;  1B67 A;  1HQ3 A;  4WU9 B;  2CV5 A;  3C1C A;  4KUD C;  2BG1 A;  1P3B B;  2W8S A;  3REJ A;  3AZL A;  3LZ0 A;  3C1B D;  1S32 B;  3W99 C;  5B32 A;  3X1U D;  3O62 A;  3EG5 B;  3KUY A;  4J8X D;  4WV4 B;  3AYW A;  3AZG B;  4Z66 B;  3AZF D;  1P3L A;  4WJ3 C;  5B40 A;  5B33 D;  5BO0 A;  5B2J B;  1P34 A;  3AZN B;  5B2I C;  3W96 B;  1U35 D;  3LEL C;  4J8W A;  3A1K A;  1P3F C;  4WU8 A;  1KX5 A;  5G49 B;  5DNN C;  3WTP E;  3X1S A;  5CPI C;  5GT0 A;  1P3M B;  4NE5 A;  5B0Z A;  1P3P C;  3B6F C;  4H9P B;  3X1V C;  5BNV B;  2F8N G;  1P3B D;  2HUE B;  3R45 A;  5DNM B;  1S32 D;  4UPK A;  5E5A A;  3MVD A;  3UTA C;  1KX3 A;  3B0D B;  4KGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...