5B2AO

Crystal structure of a mutant of ospa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKVLGDVKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title A mutant of OspA
rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 49
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2016-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 5b2aO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 5b2aO02
5B10O 2FKJA 3AUMO 1OSPO 2I5VO 2OY8A 2PI3O 2OY1O 2FKGA 2OY7A 3CKFA 3EC5A 5B11O 2HKDA 2AF5A 5B2AO 2OL7A 5B3MO 1FJ1E 2G8CO 2OL8O 2OY5O 3CKGA 1P4PA 2OL6O 2OYBO 2I5ZO
chains in the Genus database with same CATH superfamily
1BJ7A 5D4AA 5IO5A 1MX7A 2AKQA 1SY2A 2OY7A 4BX7A 2RTLA 2OF9A 4N7DA 4ODDA 3PQSA 1S44A 4FBVA 4INNA 2GC9A 2AT8X 4HPAA 2RD7C 2A3FX 3D95A 3BY0A 1IFBA 4JHQA 3VGWA 1PBOA 2IZDB 3VHMA 4I6SA 3RY1A 1UYNX 4CPIA 3G71E 2BT9A 3WVMA 3LTWA 2Y3FA 3RY2A 2ASNX 1MDCA 2ZJPE 2R73A 3Q6LA 2PI3O 1A18A 3X00A 1VQ9E 3JSQA 1ALBA 1SRJA 2QOMA 4IOAE 1WBIA 2OL6O 5HCCC 5AJBA 2K62A 2RTKA 5HTEA 2C1QA 1LF7A 4L1NA 3FEPA 5CHKA 3CKFA 1W6FA 5CSEA 4EFGA 5LJBA 1IJ8A 3PIPE 4GU8A 3WZOA 2E4JA 4GD9A 2R74A 3WJBA 4NLIA 1NDJA 2QO4A 2ZSCA 1AB0A 5JVGE 2KTSA 4NYRA 3EW2A 3TF6A 2Y32A 3C76X 4GGRA 2A13A 4WF9E 4Z2VA 1HMSA 1SWSA 2OY8A 1VQLE 2KTDA 2OZQA 2QO5A 4BVMA 1X8NA 5FENA 1QQSA 2W2FA 2RTFB 2QOSC 4Y0RA 1U0XA 3ZWEA 2CZUA 3RDUA 3JS1A 3DSZA 4BOEA 1SWUA 3PQUA 4I60A 1RSTB 4MVLA 1VQ5E 1LIDA 1EI5A 1TW4A 5DM6E 1SWTA 3RKGA 2JN3A 1SWRA 1IKJA 1VWGB 1OPBA 1R0UA 1AVEA 1TXLA 3B2IA 4YKMA 3B2JA 1SXYA 1XKIA 4NNSA 2M4LA 3CBCA 3FLLA 1D3SA 4KH8A 1HQQA 1LPJA 1CBIA 4I3DA 5HA0A 2GH7A 3EW1A 1KT3A 5B29A 4C5PA 4ORRA 5GAEG 4XMEA 1TVQA 3CR6A 4AZPA 4GJSA 2RA6A 1E06A 4YBUA 1BLRA 1YWDA 3EYCA 1NP4A 1VWKB 3ZZVA 1X71A 4B55A 1VWEB 1QY1A 2AH7X 3AKNA 3VG5A 1VWOB 5DG4A 2WSJA 4Z27A 1KGLA 1NP1A 1LNMA 2RTIB 1GT5A 3FIDA 1SWEA 3HK1A 1HMRA 3V8UA 4Y0PA 2RTGB 3CCLE 4ID2A 2O62A 3FA8A 1Y53X 4NV7A 2JU7A 1TOWA 4I9RA 1AELA 5BVTA 1ACDA 1VWDB 4CPFA 4IB7A 1DF8A 2HLVA 3BSZE 4BX5B 3SZJA 3E3CA 3IG9A 1EXSA 1AVGI 3ZW0A 1X8QA 4YGGA 5B2AO 4M6SA 4IB9A 3WJDA 1YITE 4GZVA 3CCVE 3CCRE 2OVAA 4YCEA 5F1EA 3UEVA 2PY1A 2QEXE 1G85A 4ORUA 5B3MO 5H9NA 2X56A 4HPCA 1SLFB 2RTJA 4L3RA 2QA4E 3T6FA 2FKJA 1MX8A 5L3YA 3CXCE 1E2TA 2R56A 5FAZA 3EBKA 4GDAA 2FS7A 1BSOA 1M1KG 4N7CA 1YP7A 3CQNA 2ZJQE 4KT5A 1LIFA 4LZUA 4O3ZA 1IFCA 3BRNA 2BHVA 4Z28A 3FW5A 4WCEE 2RTRB 4AZOA 2X8TA 2IZIA 1PTSA 1TOUA 1MEPA 1DF3A 4U8UN 1YJ9E 2IZKA 4GH7A 1Y9TA 3RSWA 4CK4A 1MVGA 1ICNA 2HZQA 4ZHFA 1Q81G 4NNTA 2UYWA 4NYQA 1NQNA 3P6EA 4U3QA 4YH0A 3VHIA 4TJZA 4ZHDA 2FGSA 1YWAA 3S5XA 2RCQA 4QGWA 3FR2A 2IZEB 1EPBA 1XCAA 2FR3A 1QFVA 3HWEA 1HN2A 2IZHB 2L67A 2MO5A 4GGTA 3KFIA 5B10O 1B4MA 4OMWA 5F6BA 1VQKE 1YWCA 5D47A 3SZHA 1KZXA 3NPOA 3CCEE 1IW2A 3VG2A 3SLTA 1HBQA 1FENA 1FEMA 2WEWA 2FHNX 1JJXA 5LJCA 4QAEA 3STKA 3FR4A 1DFVA 4QYPA 5H9LA 5LKEA 2EU7X 1RBPA 3RBYA 1RJLC 1U17A 4RUUA 3QKGA 4I3BA 2XKLA 4BX7B 4FBOA 3G4SE 2NNDA 3FA7A 5GAHG 1K8AG 1DZKA 2F01A 1O8VA 1BSYA 1ZNGA 4FBRA 1KT4A 4QZUA 2Q9SA 4KCAA 1BSQA 2ALLX 1YWBA 3RDQA 3N91A 1GKAA 1UZ2X 4QYNA 1T0VA 1VPRA 4PJ2A 1VQ8E 4UU3A 3O22A 1I06A 2RN4A 4XMGA 3BU9A 1B56A 1KT7A 1DV9A 1SWPA 3IGEA 2QO6A 3RZYA 4ORWA 4GNYA 4AZMA 4ALBA 4CDEA 4BJ8A 2RTHB 5D8JA 1VQPE 1O1VA 4NW4A 4TKBA 2BSZA 4YDBA 1I9HA 3IA8A 3VG3A 2OTLE 1BRQA 1QFTA 3WJEA 1SLEB 1LCWA 1CBSA 1Q82G 1QVFE 2OY1O 1LCZA 1G74A 5LJEA 1IKEA 4YGZA 2JMBA 4I9SA 5B11O 4MIRA 4O49A 4PSQA 5EPQA 3AEHA 1SWJA 4IO9E 4WFAE 2BS5A 1AQBA 2IZAA 5KHPA 2AVIA 1PEEA 1VWLB 4IOCE 4IB6A 2AT0X 1N8RG 1VWMB 5L8IA 1D2UA 2QCBA 5EEDA 4EXZA 1M90G 1VWFB 3WYPA 3RDMA 1LIBA 2P8GA 2F09A 1SWHA 4IMOA 1LICA 1Y0GA 5AEOA 4Y5DA 5JD2A 1JJJA 2MJIA 2YMSA 1JIWI 4DQ3A 3CCUE 1PM1X 1DC9A 3OE3A 1VWQB 3VU1A 1RL6A 3TGCA 4TNNA 5IO6A 4GE1A 1OSPO 1NQMA 2FRSA 1BM5A 3CC4E 1FE3A 2VDFA 4NLJA 1JV4A 1W4TA 2C4IA 1VQME 2YG2A 2G78A 2OYBO 4GJVA 1QVGE 4TKJA 3BX8A 1ADLA 4HFOA 2FT9A 5MLCH 1IIUA 4LKTA 1ZNEA 2KT4B 3CWKA 3SZIA 4IBAA 3RDOA 1GX8A 3RWXA 1KQSE 3AKMA 4DNEA 3DLLE 4U8UM 1RXJA 3O19A 2A5CA 4JGLA 5GAGG 1K24A 2AT6X 1VQ6E 1SWAA 4U9CA 1EW3A 1OBUA 4UY8G 1SY3A 5HL7E 3NADA 1YJNE 3FELA 1UREA 3J7ZG 3WJGA 3S60A 3BS2A 2RTMA 1S2PA 4HPBA 1NBXA 3T1DA 5LJGA 5LKFA 1RLBE 3FDCA 2IZFB 4GKCA 4BGFA 4O3XB 5HCEC 1STPA 4ZCBA 5IRAA 4ORYA 5HWZA 1STSB 2QMIA 1EQDA 1SY0A 2MHDA 4Z2OA 3VG6A 1VWCB 1U18A 2FKGA 2Y3EA 3WBGA 3TGAA 5IRWA 2HKDA 2CAMA 3RDXA 3OW2E 1SWOA 2Z4IA 1SWCA 3VPJE 2AT5X 3U9PC 2DJGA 2FHLA 2BLGA 4K19A 4KC7A 5HTDA 4CSBA 5H9KA 1KQWA 3IFBA 4GRJA 1E02A 3FA9A 4FGIB 2AF5A 2C1SA 3WZNA 1ICMA 5HBSA 2GTLO 1QY2A 1GT3A 4AYHA 4ZH6A 2LBVA 3CF5E 3EC5A 4A60A 1SWKA 1GT1A 3BX7A 3UEWA 1KXOA 2OFAA 1QABE 4CPHB 5EDCA 1YUPA 3ZUIA 4O4UA 5HCDC 3PDFA 4A1HA 2WWPA 3C77X 3F6ZB 5CYBA 4EKVA 3QQ2A 2OF8A 5F7GA 1VQ7E 3STNA 1YP6A 3ZW2A 4ZR2A 2ANSA 3PIOE 2X46A 3OD9A 4OS0A 4DQ4A 1I78A 5HZ6A 1NGLA 1FTPA 3OBLA 1HMTA 5EDBA 4LQZA 3NX1A 1OEJA 3BDRA 4IMNA 1ZNDA 3HWGA 4XMHA 3CCJE 5KIDA 2POAA 4YFPA 1LUQA 3VG4A 5EZ2A 4HPDA 4MVKA 4AZRA 2VFBA 3TGBA 1VWRB 4ON1A 2FTBA 1KC8G 2Q4NA 3L4RA 3T6LA 3KFFA 1I04A 3PK2A 1GM6A 5H9AA 2OFBA 1G5WA 4ML7B 3KFGA 3B2KA 1ERXA 4AW8A 3FYFA 3CQRA 4FQBB 4QZTA 3RE5A 2OFMX 2HZRA 2GJ5A 1I4UA 5L8NA 5FQ7E 4TLJA 1YIJE 1JMZA 2DM5A 2CQLA 4AZQA 1BEBA 1N9YA 1CRBA 4WFNE 4WFBE 2ZAGA 1I05A 2IZCB 3T2XA 3U0DA 2MM3A 1ZNHA 1OBPA 2IZBA 2RTEB 4DCBA 4BQUA 2CBRA 2RTNB 2RCTA 2NP1A 1AVDA 1SRFA 5F2BA 3PH6A 4QGVA 1QY0A 4ALOA 2Z4HA 2LFOA 2WR6A 4O3YA 4R0BA 2X8SA 3PPTA 1N0SA 1MK5A 5HA1A 2KD2A 1EALA 2AL0X 2IZJA 1BRPA 1OBQA 4TKHA 3G7XA 2CZTA 2WPUA 3P6FA 1A3YA 1JZUA 1SWDA 3PEDA 4XMFA 4Y0QA 2AT3X 4U67E 4ORSA 4WBKA 4JNJA 2WEXA 5BVSA 1A2DA 4OKAA 3ZQ3A 4GK9A 4I3CA 2X4MA 2OY5O 1MM9A 1SA8A 4RUNA 4KIIA 1PMPA 2ZAIA 3BLGA 3WOVA 1GKAB 5D45A 4OMXA 4GNWA 4WHIA 1DZPA 4ZHCA 1STRB 4MVEA 3CCQE 1JBHA 2CM4A 3PECA 4O4XA 1DZJA 5HZ8A 1YJWE 1SRIA 3WJFA 1KT5A 1ERBA 3CMPA 1N43A 1SXXA 3FR5A 3K3LA 1JJ2E 5BVQA 3FMZA 4IRWA 2LKKA 3MBTA 1SRHA 1RAVA 2FR2A 3UEUA 4BX6A 5JVHE 2OL7A 5LJKA 3CD6E 2G8CO 2QM9A 1K73G 4KC8A 1LDQA 1SWGA 1A57A 5KICA 3EBWA 1JYJA 2F73A 1H91A 4IB8A 4NV8A 5FQ6E 2JW1A 1CBQA 3ZUOA 4YCHA 2RTBB 1RXHA 4IABA 4JO6A 4YBPA 3UAQA 2NNQA 1PBYA 2JGSA 4BBOA 1RSUB 2OVSA 3P24A 4YGHA 3NQKA 1RXKA 3S26A 1OPAA 3T2WA 2A2UA 3SOTA 3FA6A 1G7NA 4OS8A 1QG5A 4Z6JA 3ZW1A 4ZJ0A 3KVNA 1SWLA 4OELA 1VQOE 1SWBA 5FFHA 2JU3A 2UZ2A 1GXAA 4EQAC 2BC3A 2Q2MA 4LZVA 4HWMA 1B8EA 3APXA 2ACPX 5EEEA 4NP1A 4YDAA 2HYSA 3LV4A 5B5GA 2OVEA 3MX7A 3NQ3A 2X55A 1KL5A 4QRLA 1JQPA 4GUZA 3BU1A 4YKOA 2AMMX 4ZGUA 1VQNE 2VFCA 3NP1A 3PH5A 1DZMA 4OS3A 5IXGA 3P02A 5C0NA 1KD1G 1P4PA 3GE2A 1KQXA 3SAOA 4A1YA 4Z2PA 1LIEA 2WQ9A 3F9DA 3NBXX 4O9SA 1L6MA 1SXUA 1YI2E 3GAQA 1FELA 4IAXA 3O2YA 3APWA 4IAWA 5L8OA 2RTDB 3HPEA 5BYPA 1HXZA 4I95A 4EDEA 1LFOA 4U8UO 1SLDB 2LA7A 1LKEA 2Q39A 3HWFA 4CV7A 3HOEA 5LJHA 2A2GA 1HY2A 3FEKA 1VYGA 3I0AA 4YMYA 1WUBA 1SMPI 2L9CA 3CC2E 3RDSA 1HQPA 1LELA 5FQ8E 3APVA 3P6CA 1HXLA 1GGLA 1QWDA 3CBSA 5B27A 1VYOA 4XMCA 5JR8A 3FIQA 3STMX 3D9WA 1LDOA 5DM7E 5HZQA 5F58A 2OTJE 1Y52X 2RQ0A 1NJIG 4ZHHA 1X8UA 4XMDA 1K9MG 1EIIA 3SLOA 1ZNLA 1LCVA 2RTCB 2DJFA 3KQ0A 4CDFA 3FENA 4ARHA 2RTQB 4MVIA 1GT4A 3KZAA 4BCSA 3HOLA 1NC9A 1T8VA 1T68X 3VE1A 1W5RA 1SWQA 3ZW0B 4YFQA 2IZGB 1FDQA 5IO7A 1YHQE 3C78X 3P6GA 4LKPA 4WFUA 4CDDA 3U03A 1OEEA 1SREA 4O4OA 2X8FA 5F6ZA 2K23A 3CCME 4M7MA 3P6DA 1S7DA 3WXQA 3H3IA 3CMAE 2I5ZO 1Q7YG 3CCSE 3S5VA 2FS6A 4QQ1A 3JQOA 4WFVA 2HNXA 3G6EE 4ZGFA 1KL4A 4YVBA 1S72E 1VWNB 1VWAB 2OFRX 1N9MA 1Y55X 4MISA 2KW1A 2GTLM 1KOIA 5HZ9A 3B2HA 1N4JA 3VHHA 5D48A 1SWNA 4O4SA 3D4RA 1N7YA 2CBSA 2WUTA 1JMXA 2BS6A 3NX2A 3CKGA 3KFHA 1KZWA 3LHNA 2FWVA 1VWHB 1X8OA 4ZHGA 1VWJB 1CBRA 3EMMA 3RE6A 4ORXA 2Q2PA 4D6BA 2G5LA 1JJUA 4BX5A 1ZNKA 5K06A 1ML7A 2RTPB 2WQAE 1MOYA 1ZRYA 5AJCA 1GX9A 3EM0A 1BBPA 1OEKA 4ES7A 1YIVA 4CPHA 4MEEA 3FW4A 3CC7E 1SWFA 4OEMA 1W2BE 1FJ1E 1SRGA 1EIOA 2L68A 1Q86G 3D96A 2W2BA 3HTYA 1JYDA 3CPWE 4U46A 3AUMO 4ZFXA 3TZSA 2ZJRE 5H8TA 1VWBB 5CE4A 3WZPA 2JU8A 3I56E 5IRUA 5K67A 4COTA 2A8GA 4Y0SA 1X8PA 2N93A 5HZ5A 4QGXA 3B2LA 5AQ6A 4ZH9A 2ACOA 3VG7A 3I17A 3NQ9A 2W2AA 3NR3A 3ZI8A 4O3WA 2L5PA 1MUPA 4YFRA 2A5BA 5HAEA 2HMBA 3D97A 3PP6A 1X89A 2LBAA 3HWDA 1VWIB 3MM0A 4EEJA 2A0AA 2LB6A 1B0OA 2G79A 1SLGB 1Z24A 3I55E 4TQ2A 1SXWA 3F8AA 2MWHA 1E00A 1E5PA 2FLJA 3APUA 4AZNA 5H1SI 3SLJA 4Y59A 4CPEA 2RTOB 3DTQA 3CMEE 2X32A 4UU2A 1VWPB 1BWYA 5B5FA 2RTAA 3Q34A 2OL8O 5K68A 2X34A 5DPQA 4BX6B 3VE2A 1SY1A 3ELXA 2NNEA 2JOZA 3WJCA 1HBPA 2OVDA 1KT6A 4GGZA 1VYFA 3MVFA 3ELZA 4QNIA 2GTLN 3UEXA 2CM9A 1K3BA 2IZLB 1Y9LA 2I5VO 1P6PA 1EUOA 1KFFA 5GADG 3MG5A 3P6HA 3WZQA 1UYOX 4D6AA 2GTFX 4A8ZA 2IFBA 1EPAA 2G7BA 4GETA 2MF6A 1VQ4E 3OJYC 5LJDA 2XSTA 3WYQA 2X45A 4CDCA 3ZW1B 1CJ5A 1KL3A 4GDZA 1GX3A 1O1UA 5AN9B
chains in the Genus database with same CATH topology
5B10O 2FKJA 3AUMO 1OSPO 2I5VO 2OY8A 2PI3O 2OY1O 2FKGA 2OY7A 3IG9A 3CKFA 1RJLC 3EC5A 5B11O 2HKDA 2AF5A 5B2AO 2OL7A 5B3MO 1FJ1E 2G8CO 2OL8O 2OY5O 3CKGA 1P4PA 2OL6O 3IGEA 2OYBO 2I5ZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B10 O;  2FKJ A;  3AUM O;  1OSP O;  2I5V O;  2OY8 A;  2PI3 O;  2OY1 O;  2FKG A;  2OY7 A;  3CKF A;  3EC5 A;  5B11 O;  2HKD A;  2AF5 A;  5B2A O;  2OL7 A;  5B3M O;  1FJ1 E;  2G8C O;  2OL8 O;  2OY5 O;  3CKG A;  1P4P A;  2OL6 O;  2OYB O;  2I5Z O; 
#chains in the Genus database with same CATH topology
 1BJ7 A;  5D4A A;  5IO5 A;  1MX7 A;  2AKQ A;  1SY2 A;  2OY7 A;  4BX7 A;  2RTL A;  2OF9 A;  4N7D A;  4ODD A;  3PQS A;  1S44 A;  4FBV A;  4INN A;  2GC9 A;  2AT8 X;  4HPA A;  2RD7 C;  2A3F X;  3D95 A;  3BY0 A;  1IFB A;  4JHQ A;  3VGW A;  1PBO A;  2IZD B;  3VHM A;  4I6S A;  3RY1 A;  1UYN X;  4CPI A;  3G71 E;  2BT9 A;  3WVM A;  3LTW A;  2Y3F A;  3RY2 A;  2ASN X;  1MDC A;  2ZJP E;  2R73 A;  3Q6L A;  2PI3 O;  1A18 A;  3X00 A;  1VQ9 E;  3JSQ A;  1ALB A;  1SRJ A;  2QOM A;  4IOA E;  1WBI A;  2OL6 O;  5HCC C;  5AJB A;  2K62 A;  2RTK A;  5HTE A;  2C1Q A;  1LF7 A;  4L1N A;  3FEP A;  5CHK A;  3CKF A;  1W6F A;  5CSE A;  4EFG A;  5LJB A;  1IJ8 A;  3PIP E;  4GU8 A;  3WZO A;  2E4J A;  4GD9 A;  2R74 A;  3WJB A;  4NLI A;  1NDJ A;  2QO4 A;  2ZSC A;  1AB0 A;  5JVG E;  2KTS A;  4NYR A;  3EW2 A;  3TF6 A;  2Y32 A;  3C76 X;  4GGR A;  2A13 A;  4WF9 E;  4Z2V A;  1HMS A;  1SWS A;  2OY8 A;  1VQL E;  2KTD A;  2OZQ A;  2QO5 A;  4BVM A;  1X8N A;  5FEN A;  1QQS A;  2W2F A;  2RTF B;  2QOS C;  4Y0R A;  1U0X A;  3ZWE A;  2CZU A;  3RDU A;  3JS1 A;  3DSZ A;  4BOE A;  1SWU A;  3PQU A;  4I60 A;  1RST B;  4MVL A;  1VQ5 E;  1LID A;  1EI5 A;  1TW4 A;  5DM6 E;  1SWT A;  3RKG A;  2JN3 A;  1SWR A;  1IKJ A;  1VWG B;  1OPB A;  1R0U A;  1AVE A;  1TXL A;  3B2I A;  4YKM A;  3B2J A;  1SXY A;  1XKI A;  4NNS A;  2M4L A;  3CBC A;  3FLL A;  1D3S A;  4KH8 A;  1HQQ A;  1LPJ A;  1CBI A;  4I3D A;  5HA0 A;  2GH7 A;  3EW1 A;  1KT3 A;  5B29 A;  4C5P A;  4ORR A;  5GAE G;  4XME A;  1TVQ A;  3CR6 A;  4AZP A;  4GJS A;  2RA6 A;  1E06 A;  4YBU A;  1BLR A;  1YWD A;  3EYC A;  1NP4 A;  1VWK B;  3ZZV A;  1X71 A;  4B55 A;  1VWE B;  1QY1 A;  2AH7 X;  3AKN A;  3VG5 A;  1VWO B;  5DG4 A;  2WSJ A;  4Z27 A;  1KGL A;  1NP1 A;  1LNM A;  2RTI B;  1GT5 A;  3FID A;  1SWE A;  3HK1 A;  1HMR A;  3V8U A;  4Y0P A;  2RTG B;  3CCL E;  4ID2 A;  2O62 A;  3FA8 A;  1Y53 X;  4NV7 A;  2JU7 A;  1TOW A;  4I9R A;  1AEL A;  5BVT A;  1ACD A;  1VWD B;  4CPF A;  4IB7 A;  1DF8 A;  2HLV A;  3BSZ E;  4BX5 B;  3SZJ A;  3E3C A;  3IG9 A;  1EXS A;  1AVG I;  3ZW0 A;  1X8Q A;  4YGG A;  5B2A O;  4M6S A;  4IB9 A;  3WJD A;  1YIT E;  4GZV A;  3CCV E;  3CCR E;  2OVA A;  4YCE A;  5F1E A;  3UEV A;  2PY1 A;  2QEX E;  1G85 A;  4ORU A;  5B3M O;  5H9N A;  2X56 A;  4HPC A;  1SLF B;  2RTJ A;  4L3R A;  2QA4 E;  3T6F A;  2FKJ A;  1MX8 A;  5L3Y A;  3CXC E;  1E2T A;  2R56 A;  5FAZ A;  3EBK A;  4GDA A;  2FS7 A;  1BSO A;  1M1K G;  4N7C A;  1YP7 A;  3CQN A;  2ZJQ E;  4KT5 A;  1LIF A;  4LZU A;  4O3Z A;  1IFC A;  3BRN A;  2BHV A;  4Z28 A;  3FW5 A;  4WCE E;  2RTR B;  4AZO A;  2X8T A;  2IZI A;  1PTS A;  1TOU A;  1MEP A;  1DF3 A;  4U8U N;  1YJ9 E;  2IZK A;  4GH7 A;  1Y9T A;  3RSW A;  4CK4 A;  1MVG A;  1ICN A;  2HZQ A;  4ZHF A;  1Q81 G;  4NNT A;  2UYW A;  4NYQ A;  1NQN A;  3P6E A;  4U3Q A;  4YH0 A;  3VHI A;  4TJZ A;  4ZHD A;  2FGS A;  1YWA A;  3S5X A;  2RCQ A;  4QGW A;  3FR2 A;  2IZE B;  1EPB A;  1XCA A;  2FR3 A;  1QFV A;  3HWE A;  1HN2 A;  2IZH B;  2L67 A;  2MO5 A;  4GGT A;  3KFI A;  5B10 O;  1B4M A;  4OMW A;  5F6B A;  1VQK E;  1YWC A;  5D47 A;  3SZH A;  1KZX A;  3NPO A;  3CCE E;  1IW2 A;  3VG2 A;  3SLT A;  1HBQ A;  1FEN A;  1FEM A;  2WEW A;  2FHN X;  1JJX A;  5LJC A;  4QAE A;  3STK A;  3FR4 A;  1DFV A;  4QYP A;  5H9L A;  5LKE A;  2EU7 X;  1RBP A;  3RBY A;  1RJL C;  1U17 A;  4RUU A;  3QKG A;  4I3B A;  2XKL A;  4BX7 B;  4FBO A;  3G4S E;  2NND A;  3FA7 A;  5GAH G;  1K8A G;  1DZK A;  2F01 A;  1O8V A;  1BSY A;  1ZNG A;  4FBR A;  1KT4 A;  4QZU A;  2Q9S A;  4KCA A;  1BSQ A;  2ALL X;  1YWB A;  3RDQ A;  3N91 A;  1GKA A;  1UZ2 X;  4QYN A;  1T0V A;  1VPR A;  4PJ2 A;  1VQ8 E;  4UU3 A;  3O22 A;  1I06 A;  2RN4 A;  4XMG A;  3BU9 A;  1B56 A;  1KT7 A;  1DV9 A;  1SWP A;  3IGE A;  2QO6 A;  3RZY A;  4ORW A;  4GNY A;  4AZM A;  4ALB A;  4CDE A;  4BJ8 A;  2RTH B;  5D8J A;  1VQP E;  1O1V A;  4NW4 A;  4TKB A;  2BSZ A;  4YDB A;  1I9H A;  3IA8 A;  3VG3 A;  2OTL E;  1BRQ A;  1QFT A;  3WJE A;  1SLE B;  1LCW A;  1CBS A;  1Q82 G;  1QVF E;  2OY1 O;  1LCZ A;  1G74 A;  5LJE A;  1IKE A;  4YGZ A;  2JMB A;  4I9S A;  5B11 O;  4MIR A;  4O49 A;  4PSQ A;  5EPQ A;  3AEH A;  1SWJ A;  4IO9 E;  4WFA E;  2BS5 A;  1AQB A;  2IZA A;  5KHP A;  2AVI A;  1PEE A;  1VWL B;  4IOC E;  4IB6 A;  2AT0 X;  1N8R G;  1VWM B;  5L8I A;  1D2U A;  2QCB A;  5EED A;  4EXZ A;  1M90 G;  1VWF B;  3WYP A;  3RDM A;  1LIB A;  2P8G A;  2F09 A;  1SWH A;  4IMO A;  1LIC A;  1Y0G A;  5AEO A;  4Y5D A;  5JD2 A;  1JJJ A;  2MJI A;  2YMS A;  1JIW I;  4DQ3 A;  3CCU E;  1PM1 X;  1DC9 A;  3OE3 A;  1VWQ B;  3VU1 A;  1RL6 A;  3TGC A;  4TNN A;  5IO6 A;  4GE1 A;  1OSP O;  1NQM A;  2FRS A;  1BM5 A;  3CC4 E;  1FE3 A;  2VDF A;  4NLJ A;  1JV4 A;  1W4T A;  2C4I A;  1VQM E;  2YG2 A;  2G78 A;  2OYB O;  4GJV A;  1QVG E;  4TKJ A;  3BX8 A;  1ADL A;  4HFO A;  2FT9 A;  5MLC H;  1IIU A;  4LKT A;  1ZNE A;  2KT4 B;  3CWK A;  3SZI A;  4IBA A;  3RDO A;  1GX8 A;  3RWX A;  1KQS E;  3AKM A;  4DNE A;  3DLL E;  4U8U M;  1RXJ A;  3O19 A;  2A5C A;  4JGL A;  5GAG G;  1K24 A;  2AT6 X;  1VQ6 E;  1SWA A;  4U9C A;  1EW3 A;  1OBU A;  4UY8 G;  1SY3 A;  5HL7 E;  3NAD A;  1YJN E;  3FEL A;  1URE A;  3J7Z G;  3WJG A;  3S60 A;  3BS2 A;  2RTM A;  1S2P A;  4HPB A;  1NBX A;  3T1D A;  5LJG A;  5LKF A;  1RLB E;  3FDC A;  2IZF B;  4GKC A;  4BGF A;  4O3X B;  5HCE C;  1STP A;  4ZCB A;  5IRA A;  4ORY A;  5HWZ A;  1STS B;  2QMI A;  1EQD A;  1SY0 A;  2MHD A;  4Z2O A;  3VG6 A;  1VWC B;  1U18 A;  2FKG A;  2Y3E A;  3WBG A;  3TGA A;  5IRW A;  2HKD A;  2CAM A;  3RDX A;  3OW2 E;  1SWO A;  2Z4I A;  1SWC A;  3VPJ E;  2AT5 X;  3U9P C;  2DJG A;  2FHL A;  2BLG A;  4K19 A;  4KC7 A;  5HTD A;  4CSB A;  5H9K A;  1KQW A;  3IFB A;  4GRJ A;  1E02 A;  3FA9 A;  4FGI B;  2AF5 A;  2C1S A;  3WZN A;  1ICM A;  5HBS A;  2GTL O;  1QY2 A;  1GT3 A;  4AYH A;  4ZH6 A;  2LBV A;  3CF5 E;  3EC5 A;  4A60 A;  1SWK A;  1GT1 A;  3BX7 A;  3UEW A;  1KXO A;  2OFA A;  1QAB E;  4CPH B;  5EDC A;  1YUP A;  3ZUI A;  4O4U A;  5HCD C;  3PDF A;  4A1H A;  2WWP A;  3C77 X;  3F6Z B;  5CYB A;  4EKV A;  3QQ2 A;  2OF8 A;  5F7G A;  1VQ7 E;  3STN A;  1YP6 A;  3ZW2 A;  4ZR2 A;  2ANS A;  3PIO E;  2X46 A;  3OD9 A;  4OS0 A;  4DQ4 A;  1I78 A;  5HZ6 A;  1NGL A;  1FTP A;  3OBL A;  1HMT A;  5EDB A;  4LQZ A;  3NX1 A;  1OEJ A;  3BDR A;  4IMN A;  1ZND A;  3HWG A;  4XMH A;  3CCJ E;  5KID A;  2POA A;  4YFP A;  1LUQ A;  3VG4 A;  5EZ2 A;  4HPD A;  4MVK A;  4AZR A;  2VFB A;  3TGB A;  1VWR B;  4ON1 A;  2FTB A;  1KC8 G;  2Q4N A;  3L4R A;  3T6L A;  3KFF A;  1I04 A;  3PK2 A;  1GM6 A;  5H9A A;  2OFB A;  1G5W A;  4ML7 B;  3KFG A;  3B2K A;  1ERX A;  4AW8 A;  3FYF A;  3CQR A;  4FQB B;  4QZT A;  3RE5 A;  2OFM X;  2HZR A;  2GJ5 A;  1I4U A;  5L8N A;  5FQ7 E;  4TLJ A;  1YIJ E;  1JMZ A;  2DM5 A;  2CQL A;  4AZQ A;  1BEB A;  1N9Y A;  1CRB A;  4WFN E;  4WFB E;  2ZAG A;  1I05 A;  2IZC B;  3T2X A;  3U0D A;  2MM3 A;  1ZNH A;  1OBP A;  2IZB A;  2RTE B;  4DCB A;  4BQU A;  2CBR A;  2RTN B;  2RCT A;  2NP1 A;  1AVD A;  1SRF A;  5F2B A;  3PH6 A;  4QGV A;  1QY0 A;  4ALO A;  2Z4H A;  2LFO A;  2WR6 A;  4O3Y A;  4R0B A;  2X8S A;  3PPT A;  1N0S A;  1MK5 A;  5HA1 A;  2KD2 A;  1EAL A;  2AL0 X;  2IZJ A;  1BRP A;  1OBQ A;  4TKH A;  3G7X A;  2CZT A;  2WPU A;  3P6F A;  1A3Y A;  1JZU A;  1SWD A;  3PED A;  4XMF A;  4Y0Q A;  2AT3 X;  4U67 E;  4ORS A;  4WBK A;  4JNJ A;  2WEX A;  5BVS A;  1A2D A;  4OKA A;  3ZQ3 A;  4GK9 A;  4I3C A;  2X4M A;  2OY5 O;  1MM9 A;  1SA8 A;  4RUN A;  4KII A;  1PMP A;  2ZAI A;  3BLG A;  3WOV A;  1GKA B;  5D45 A;  4OMX A;  4GNW A;  4WHI A;  1DZP A;  4ZHC A;  1STR B;  4MVE A;  3CCQ E;  1JBH A;  2CM4 A;  3PEC A;  4O4X A;  1DZJ A;  5HZ8 A;  1YJW E;  1SRI A;  3WJF A;  1KT5 A;  1ERB A;  3CMP A;  1N43 A;  1SXX A;  3FR5 A;  3K3L A;  1JJ2 E;  5BVQ A;  3FMZ A;  4IRW A;  2LKK A;  3MBT A;  1SRH A;  1RAV A;  2FR2 A;  3UEU A;  4BX6 A;  5JVH E;  2OL7 A;  5LJK A;  3CD6 E;  2G8C O;  2QM9 A;  1K73 G;  4KC8 A;  1LDQ A;  1SWG A;  1A57 A;  5KIC A;  3EBW A;  1JYJ A;  2F73 A;  1H91 A;  4IB8 A;  4NV8 A;  5FQ6 E;  2JW1 A;  1CBQ A;  3ZUO A;  4YCH A;  2RTB B;  1RXH A;  4IAB A;  4JO6 A;  4YBP A;  3UAQ A;  2NNQ A;  1PBY A;  2JGS A;  4BBO A;  1RSU B;  2OVS A;  3P24 A;  4YGH A;  3NQK A;  1RXK A;  3S26 A;  1OPA A;  3T2W A;  2A2U A;  3SOT A;  3FA6 A;  1G7N A;  4OS8 A;  1QG5 A;  4Z6J A;  3ZW1 A;  4ZJ0 A;  3KVN A;  1SWL A;  4OEL A;  1VQO E;  1SWB A;  5FFH A;  2JU3 A;  2UZ2 A;  1GXA A;  4EQA C;  2BC3 A;  2Q2M A;  4LZV A;  4HWM A;  1B8E A;  3APX A;  2ACP X;  5EEE A;  4NP1 A;  4YDA A;  2HYS A;  3LV4 A;  5B5G A;  2OVE A;  3MX7 A;  3NQ3 A;  2X55 A;  1KL5 A;  4QRL A;  1JQP A;  4GUZ A;  3BU1 A;  4YKO A;  2AMM X;  4ZGU A;  1VQN E;  2VFC A;  3NP1 A;  3PH5 A;  1DZM A;  4OS3 A;  5IXG A;  3P02 A;  5C0N A;  1KD1 G;  1P4P A;  3GE2 A;  1KQX A;  3SAO A;  4A1Y A;  4Z2P A;  1LIE A;  2WQ9 A;  3F9D A;  3NBX X;  4O9S A;  1L6M A;  1SXU A;  1YI2 E;  3GAQ A;  1FEL A;  4IAX A;  3O2Y A;  3APW A;  4IAW A;  5L8O A;  2RTD B;  3HPE A;  5BYP A;  1HXZ A;  4I95 A;  4EDE A;  1LFO A;  4U8U O;  1SLD B;  2LA7 A;  1LKE A;  2Q39 A;  3HWF A;  4CV7 A;  3HOE A;  5LJH A;  2A2G A;  1HY2 A;  3FEK A;  1VYG A;  3I0A A;  4YMY A;  1WUB A;  1SMP I;  2L9C A;  3CC2 E;  3RDS A;  1HQP A;  1LEL A;  5FQ8 E;  3APV A;  3P6C A;  1HXL A;  1GGL A;  1QWD A;  3CBS A;  5B27 A;  1VYO A;  4XMC A;  5JR8 A;  3FIQ A;  3STM X;  3D9W A;  1LDO A;  5DM7 E;  5HZQ A;  5F58 A;  2OTJ E;  1Y52 X;  2RQ0 A;  1NJI G;  4ZHH A;  1X8U A;  4XMD A;  1K9M G;  1EII A;  3SLO A;  1ZNL A;  1LCV A;  2RTC B;  2DJF A;  3KQ0 A;  4CDF A;  3FEN A;  4ARH A;  2RTQ B;  4MVI A;  1GT4 A;  3KZA A;  4BCS A;  3HOL A;  1NC9 A;  1T8V A;  1T68 X;  3VE1 A;  1W5R A;  1SWQ A;  3ZW0 B;  4YFQ A;  2IZG B;  1FDQ A;  5IO7 A;  1YHQ E;  3C78 X;  3P6G A;  4LKP A;  4WFU A;  4CDD A;  3U03 A;  1OEE A;  1SRE A;  4O4O A;  2X8F A;  5F6Z A;  2K23 A;  3CCM E;  4M7M A;  3P6D A;  1S7D A;  3WXQ A;  3H3I A;  3CMA E;  2I5Z O;  1Q7Y G;  3CCS E;  3S5V A;  2FS6 A;  4QQ1 A;  3JQO A;  4WFV A;  2HNX A;  3G6E E;  4ZGF A;  1KL4 A;  4YVB A;  1S72 E;  1VWN B;  1VWA B;  2OFR X;  1N9M A;  1Y55 X;  4MIS A;  2KW1 A;  2GTL M;  1KOI A;  5HZ9 A;  3B2H A;  1N4J A;  3VHH A;  5D48 A;  1SWN A;  4O4S A;  3D4R A;  1N7Y A;  2CBS A;  2WUT A;  1JMX A;  2BS6 A;  3NX2 A;  3CKG A;  3KFH A;  1KZW A;  3LHN A;  2FWV A;  1VWH B;  1X8O A;  4ZHG A;  1VWJ B;  1CBR A;  3EMM A;  3RE6 A;  4ORX A;  2Q2P A;  4D6B A;  2G5L A;  1JJU A;  4BX5 A;  1ZNK A;  5K06 A;  1ML7 A;  2RTP B;  2WQA E;  1MOY A;  1ZRY A;  5AJC A;  1GX9 A;  3EM0 A;  1BBP A;  1OEK A;  4ES7 A;  1YIV A;  4CPH A;  4MEE A;  3FW4 A;  3CC7 E;  1SWF A;  4OEM A;  1W2B E;  1FJ1 E;  1SRG A;  1EIO A;  2L68 A;  1Q86 G;  3D96 A;  2W2B A;  3HTY A;  1JYD A;  3CPW E;  4U46 A;  3AUM O;  4ZFX A;  3TZS A;  2ZJR E;  5H8T A;  1VWB B;  5CE4 A;  3WZP A;  2JU8 A;  3I56 E;  5IRU A;  5K67 A;  4COT A;  2A8G A;  4Y0S A;  1X8P A;  2N93 A;  5HZ5 A;  4QGX A;  3B2L A;  5AQ6 A;  4ZH9 A;  2ACO A;  3VG7 A;  3I17 A;  3NQ9 A;  2W2A A;  3NR3 A;  3ZI8 A;  4O3W A;  2L5P A;  1MUP A;  4YFR A;  2A5B A;  5HAE A;  2HMB A;  3D97 A;  3PP6 A;  1X89 A;  2LBA A;  3HWD A;  1VWI B;  3MM0 A;  4EEJ A;  2A0A A;  2LB6 A;  1B0O A;  2G79 A;  1SLG B;  1Z24 A;  3I55 E;  4TQ2 A;  1SXW A;  3F8A A;  2MWH A;  1E00 A;  1E5P A;  2FLJ A;  3APU A;  4AZN A;  5H1S I;  3SLJ A;  4Y59 A;  4CPE A;  2RTO B;  3DTQ A;  3CME E;  2X32 A;  4UU2 A;  1VWP B;  1BWY A;  5B5F A;  2RTA A;  3Q34 A;  2OL8 O;  5K68 A;  2X34 A;  5DPQ A;  4BX6 B;  3VE2 A;  1SY1 A;  3ELX A;  2NNE A;  2JOZ A;  3WJC A;  1HBP A;  2OVD A;  1KT6 A;  4GGZ A;  1VYF A;  3MVF A;  3ELZ A;  4QNI A;  2GTL N;  3UEX A;  2CM9 A;  1K3B A;  2IZL B;  1Y9L A;  2I5V O;  1P6P A;  1EUO A;  1KFF A;  5GAD G;  3MG5 A;  3P6H A;  3WZQ A;  1UYO X;  4D6A A;  2GTF X;  4A8Z A;  2IFB A;  1EPA A;  2G7B A;  4GET A;  2MF6 A;  1VQ4 E;  3OJY C;  5LJD A;  2XST A;  3WYQ A;  2X45 A;  4CDC A;  3ZW1 B;  1CJ5 A;  1KL3 A;  4GDZ A;  1GX3 A;  1O1U A;  5AN9 B; 
#chains in the Genus database with same CATH homology
 5B10 O;  2FKJ A;  3AUM O;  1OSP O;  2I5V O;  2OY8 A;  2PI3 O;  2OY1 O;  2FKG A;  2OY7 A;  3IG9 A;  3CKF A;  1RJL C;  3EC5 A;  5B11 O;  2HKD A;  2AF5 A;  5B2A O;  2OL7 A;  5B3M O;  1FJ1 E;  2G8C O;  2OL8 O;  2OY5 O;  3CKG A;  1P4P A;  2OL6 O;  3IGE A;  2OYB O;  2I5Z O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...