5B2IA

Human nucleosome containing cpg unmethylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iA00
3AZKD 3LJAD 3AZIB 4QLCD 4ZUXD 4KGCC 1P34A 5DNMC 3WTPA 1M18B 1P3MD 5CHLB 4Z5TA 5F99D 4R8PB 4JJNA 5B0YA 3AV2A 4DRAA 4YS3B 4J8WA 3UT9D 1KX4D 1KX3A 3REJC 3B0DB 3NQUB 3WAAB 1ID3C 5AV6C 4Z66B 3REKD 5B24C 1KX5B 4J8UA 4AWLB 1F66A 2PYOA 3MGPD 4J8XA 1P3ID 4H9NB 5B31D 2F8NB 2CV5A 3MGSA 3AN2D 3LELC 5B2JD 5CPID 5GSUB 2AROD 2NQBC 1AOID 5AVBC 4G92C 3KWQD 1EQZD 1TZYB 5DNMA 4WU8B 3AZIC 1P3FD 2HUEB 5CPKB 3KXBA 4J8VB 5B1LB 1M18C 3LZ0D 3LZ1B 4R8PC 3REJA 1P3OB 1P3PD 4YS3C 5AV6A 1A7WA 3VH6W 5B40B 3AFAB 3RELB 5AVCD 3B0DC 1JFIA 5B24A 3WAAC 3MGRD 3B6FB 1P3BD 3AZEB 3AZGD 5B32G 5KDMA 1KX5C 1HQ3D 3LELA 4AWLC 1P3AD 4KUDD 2NQBA 5AVBA 1P3KD 5B0ZD 3C1BD 3VH6T 3AZKB 3LJAB 4QLCB 5GT3D 4ZUXB 5GSUC 3AZIA 3W98D 5AV9D 3AZHD 1TZYC 4KHAA 4WU8C 4CSRB 1P3MB 1M18A 3TU4D 5F99B 2HUEC 5CPKC 4R8PA 1M1AD 4J8VC 3UT9B 1KX4B 5B1LC 1U35D 4YS3A 2NZDB 2L5AA 5AV8D 1H3OA 4NE5A 3LZ1C 3X1VD 1P3OC 3NQUA 3WAAA 3AZJD 3REKB 5B40C 3RELC 3AFAC 4Z66A 3MGPB 1P3IB 1KX5A 3B6FC 4H9NA 3AZEC 3AN2B 5B2JB 5CPIB 2HIOD 1AOIB 5GSUA 3R45B 3KWQB 1EQZB 3AYWD 4ZBJB 3AZKC 1TZYA 4QLCC 1P3FB 4Z2MH 4ZUXC 4WU8A 1F1EA 5CPKA 5B33D 4J8VA 5B1LA 3LZ0B 1P3MC 5F99C 3LZ1A 1P3PB 4E44A 1P3OA 3UT9C 1KX4C 2NZDC 5AVCB 5BNXB 5B40A 1F66C 3RELA 3AFAA 2PYOC 3MGRB 4H9RB 5AY8D 1P3BB 4H9SC 3B6FA 3AZGB 3AZEA 1HQ3B 1P3AB 4KUDB 5B1MD 3MGPC 3B6GD 1P3KB 5B0ZB 3C1BB 3X1TD 3AN2C 5B2JC 5GT3B 3AZKA 3W98B 4QLCA 3W97C 1AOIC 4ZUXA 4X23C 3KWQC 3MGQD 1EQZC 5AV9B 3KXBC 4ZBJC 4YM6D 3AZHB 3REID 3WTPE 1P3FC 3TU4B 3UTAD 4CSRA 1P3MA 4DRBA 5F99A 3AZLD 1M1AB 1U35B 5AV5D 5AV8B 3UT9A 1KX4A 3LZ0C 3AZMD 2NZDA 3X1VB 5G49B 1ULYA 1P3PC 4Z5TD 4G91B 3AZJB 5CPJD 5JRGD 4H9SA 4M6BA 5AVCC 3B0CW 3B0BA 3AV1D 4UUZB 3MGRC 3MGPA 1P3IA 5BS7C 2RVQD 3AZGC 5GXQD 2HIOB 4XUJD 3AN2A 3WA9D 1HQ3C 5B2JA 5CPIA 1P3AC 4KUDC 3W97A 5GT0D 1AOIA 3AYWB 4X23A 4J8XD 1P3KC 3R45A 5B0ZC 3KWQA 1EQZA 3AZFD 5E5AD 1B67A 5GT3C 1P3FA 3KSYA 1N1JA 4KGCD 5AV9C 3AZHC 5B33B 3C1CD 5JA4B 3TU4C 3LZ0A 2FJ7D 1M1AC 1P3PA 1Q9CA 1U35C 4WU9B 5AV8C 1M19D 4Z66C 3X1VC 5AVCA 5BNXA 4H9QB 4Z2MG 5AY8B 3MGRA 4G91C 3AZJC 4H9RA 1ZLAD 5BS7A 1P3BA 1ID3D 3AZGA 5B1MB 3B6GB 3X1SD 1TAFB 3UTBD 1HQ3A 1P3AA 4KUDA 1P3GD 3X1TB 1P3KA 5B0ZA 2HIOC 2F8NG 1WWSA 5GT3A 5CP6D 3W99D 3MGQB 3AYWC 4YM6B 4HGAB 2NQBD 3REIB 5AV9A 3AZND 3AZHA 3UTAB 3TU4A 3AZLB 5C3IB 5DNND 1M1AA 5AV5B 5B33C 2F8NK 5BO0B 2CWEA 3AZMB 1U35A 5AV8A 4E45A 1BFMA 3X1VA 4EO5B 5BT1C 5G49A 5JRGB 5CPJB 2LY8A 5B31B 4WU9C 3AZJA 1BH8B 2F8NA 3AV1B 3REHD 3W96D 5B32D 2AROB 5AY8C 4UUZA 4LD9D 5GXQB 1WWIA 4XUJB 3WA9B 3NQJB 3LJAC 2HIOA 5B1MC 3B6GC 4CAYB 5GT0B 4J8XB 4H9OB 4NE3A 3X1UD 3X1TC 3AYWA 5E5AB 3AZFB 1P3LD 5BNVB 3MGQC 3MNND 4KGCB 5B2ID 4YM6C 1S32D 4HGAC 3O62D 3REIC 3C1CB 5B33A 3UTAC 5JA4A 3WKJD 3AZLC 2YFWB 2FJ7B 5C3IC 5AV5C 1M19B 3MVDD 3AZMC 3REKC 4WU9A 2YFVB 4EO5C 4H9QA 1P3IC 1ZLAB 5CPJC 5AY8A 5B31C 1ID3B 3A6ND 3X1SB 3AV1C 5CPIC 3UTBB 3LJAA 5B1MA 3B6GA 1P3GB 1TAFA 2AROC 3KUYD 2RVQC 4XZQD 5GXQC 5B31G 4XUJC 3X1TA 1R4VA 3B6FD 3WA9C 5CP6B 3W99B 5GT0C 1P34D 3MGQA 3AZNB 3AZFC 5E5AC 4YM6A 3VH5A 3REIA 3WTPD 3UTAA 2BYMB 5DNNB 3AZLA 3C1CC 4KHAB 4JJND 5AV5A 5B0YD 3AV2D 4J8WD 5BO0A 3AZMA 3REKA 2FJ7C 1KX3D 1M19C 1P3BC 5JRGA 5CPJA 5B31A 3W96B 3REHB 1H3OB 5B32B 1BH8A 2NZDD 3AV1A 3VH5W 1F66D 4LD9B 4J8UD 2AROA 1ZLAC 2PYOD 3C1BC 5GXQA 3X1SC 4XUJA 3MGSD 2CV5D 3UTBC 3NQJA 3B0CT 3WA9A 3W98C 1P3GC 4CAYA 3X1UB 5GT0A 1P3LB 4H9OA 4WZSB 3AZFA 4H9PB 5E5AA 5DNMD 5CP6C 3W99C 3VH5T 5BNVA 3MNNB 5B2IB 1S32B 3O62B 3W97D 3VH6A 4KGCA 4X23D 3AZNC 4WV4B 3KXBD 3C1CA 3WKJB 1HTAA 4WNNB 5DNNC 2YFWA 2FJ7A 3REJD 3MVDB 1M19A 2BYKB 5AV6D 1BH9B 2YFVA 5B24D 3V9RB 3A6NB 1ZLAA 1ID3A 3W96C 3REHC 3C1BA 5B32C 3X1SA 5FUGB 3KUYB 3UTBA 4LD9C 3W98A 3LELD 1P3GA 4XZQB 5AVBD 5CP6A 3X1UC 1P34B 3W99A 3AZID 2IO5B 1P3LC 3AZNA 3WTPB 2JSSA 3MNNC 1M18D 2BYMA 5B2IC 1S32C 3O62C 4Z5TB 5DNNA 4JJNB 5B0YB 4R8PD 3AV2B 4J8WB 3WKJC 4YS3D 1KX3B 1B6WA 3MVDC 3WAAD 3W96A 3REHA 5B32A 4Z66D 1F66B 4J8UB 2PYOB 1KX5D 4LD9A 3A6NC 4NE6A 2CV5B 3MGSB 2F8ND 3KUYC 4XZQC 3X1UA 5GSUD 1P3LA 5DNMB 4H9PA 1TZYD 1KU5A 4WU8D 3W97B 1P34C 3MNNA 5B2IA 2IO5C 4X23B 1S32A 3O62A 3KXBB 3WTPC 5CPKD 4J8VD 3WKJA 5B1LD 4NFTA 1N1JB 4WNNA 4Z5TC 3REJB 3LZ1D 4JJNC 5JRGC 5B0YC 3AV2C 4J8WC 3MVDA 1P3OD 5AV6B 2BYKA 1KX3C 5B40D 3RELD 3AFAD 1JFIB 5B24B 1BH9A 5BT1D 2F8NH 3V9RA 3A6NA 4WU9D 3AZED 5KDMB 3LELB 4J8UC 5FUGA 3KUYA 4J8XC 2NQBB 4XZQA 5AVBB 4G92B 2CV5C 3MGSC
chains in the Genus database with same CATH superfamily
3AZKD 3LJAD 3AZIB 4QLCD 4ZUXD 4KGCC 1P34A 5DNMC 3WTPA 1M18B 1P3MD 5CHLB 4Z5TA 5F99D 4R8PB 4JJNA 5B0YA 3AV2A 4DRAA 4YS3B 4J8WA 3UT9D 1KX4D 4DQYB 1KX3A 3REJC 3B0DB 3NQUB 3WAAB 1ID3C 2G5HC 5AV6C 4Z66B 3REKD 5B24C 1KX5B 4J8UA 4AWLB 1F66A 2PYOA 3MGPD 4J8XA 1P3ID 4H9NB 5B31D 2F8NB 2CV5A 3MGSA 3AN2D 3LELC 5B2JD 5CPID 5GSUB 2AROD 2Y2IA 1AOID 5AVBC 2NQBC 4G92C 2XD1A 3KWQD 1EQZD 1TZYB 5DNMA 4WU8B 3AZIC 1P3FD 2HUEB 5CPKB 3KXBA 4J8VB 5B1LB 1M18C 3LZ0D 3LZ1B 4R8PC 3REJA 2JCHA 1P3OB 1P3PD 3EPJA 4YS3C 5AV6A 1A7WA 3VH6W 5B40B 3AFAB 3RELB 5AVCD 3B0DC 1JFIA 5B24A 3WAAC 3MGRD 3B6FB 1P3BD 3AZEB 3AZGD 3AL0C 5B32G 5KDMA 1KX5C 1HQ3D 3LELA 4AWLC 1P3AD 4KUDD 2NQBA 5AVBA 1P3KD 5B0ZD 3C1BD 3VH6T 3AZKB 3LJAB 4QLCB 5GT3D 4ZUXB 2ZY5A 5GSUC 3AZIA 3W98D 2FFFB 5AV9D 3AZHD 1TZYC 4KHAA 4WU8C 4CSRB 1P3MB 1M18A 3TU4D 5F99B 2Y2OA 2HUEC 5CPKC 4R8PA 1M1AD 4J8VC 3UT9B 1KX4B 5B1LC 1U35D 4YS3A 2NZDB 2L5AA 5AV8D 2Y2NA 1H3OA 4NE5A 3LZ1C 3X1VD 1P3OC 3NQUA 3WAAA 3AZJD 3REKB 5B40C 3RELC 3AFAC 4Z66A 3FDDA 3MGPB 1P3IB 1KX5A 3B6FC 4H9NA 3AZEC 3AN2B 5B2JB 5CPIB 2HIOD 1W2EA 2Y2PA 1AOIB 5GSUA 3R45B 3KWQB 1EQZB 3AYWD 4ZBJB 3AZKC 1TZYA 4QLCC 1P3FB 4Z2MH 1T3UA 4ZUXC 4WU8A 1F1EA 5CPKA 5B33D 4J8VA 5B1LA 3LZ0B 1P3MC 5F99C 3LZ1A 1P3PB 4E44A 1P3OA 3UT9C 1KX4C 2NZDC 5AVCB 5BNXB 5B40A 1F66C 3RELA 3AFAA 2PYOC 3MGRB 3H0RC 4H9RB 5AY8D 1P3BB 4H9SC 3B6FA 3AZGB 3AZEA 1HQ3B 1P3AB 4KUDB 5B1MD 3MGPC 3B6GD 2UWXA 1P3KB 5B0ZB 3C1BB 3X1TD 3AN2C 5B2JC 5GT3B 3AZKA 3W98B 4QLCA 3W97C 1AOIC 4ZUXA 4X23C 3KWQC 3MGQD 1EQZC 5AV9B 1PZRA 4ZBJC 4YM6D 3KXBC 3AZHB 3REID 3WTPE 1P3FC 3TU4B 3UTAD 4CSRA 1P3MA 4DRBA 5F99A 3AZLD 1M1AB 1U35B 5AV5D 5AV8B 3UT9A 1KX4A 3LZ0C 3AZMD 2NZDA 3X1VB 5G49B 1ULYA 1P3PC 4Z5TD 4G91B 3AZJB 5CPJD 5JRGD 4H9SA 4M6BA 5AVCC 3B0CW 3B0BA 3AV1D 4UUZB 3MGRC 3MGPA 1P3IA 5BS7C 2RVQD 3AZGC 5GXQD 2HIOB 4XUJD 3AN2A 3WA9D 1HQ3C 5B2JA 5CPIA 1P3AC 4KUDC 3W97A 5GT0D 1AOIA 3AYWB 4X23A 4J8XD 1P3KC 3R45A 5B0ZC 3KWQA 1EQZA 3AZFD 5E5AD 1B67A 5GT3C 1P3FA 3EG5B 3A1KA 3KSYA 1N1JA 4KGCD 5AV9C 3AZHC 5B33B 3C1CD 5JA4B 3TU4C 3LZ0A 2G5IC 1Z2CB 2FJ7D 1M1AC 1P3PA 1Q9CA 1U35C 4WU9B 5AV8C 1M19D 4Z66C 3X1VC 5AVCA 5BNXA 2ZY2A 4H9QB 4Z2MG 5AY8B 3MGRA 4G91C 3AZJC 4H9RA 1ZLAD 5BS7A 1P3BA 1ID3D 3AZGA 5B1MB 3B6GB 3X1SD 1TAFB 3UTBD 1HQ3A 1P3AA 4KUDA 1P3GD 3X1TB 4WJ3C 1P3KA 2VQRA 5B0ZA 2HIOC 2F8NG 1WWSA 5GT3A 2BG1A 5CP6D 3W99D 3MGQB 3AYWC 4YM6B 4HGAB 2NQBD 3REIB 5AV9A 3AZND 3AZHA 3UTAB 3TU4A 3AZLB 5C3IB 5DNND 1M1AA 5AV5B 5B33C 2F8NK 5BO0B 2CWEA 3AZMB 1U35A 5AV8A 4E45A 1BFMA 3X1VA 4EO5B 5BT1C 5G49A 5JRGB 2ZY4A 5CPJB 2LY8A 5B31B 4WU9C 3AZJA 1BH8B 2F8NA 3AV1B 3REHD 3W96D 5B32D 2Y2LA 2AROB 5AY8C 4UUZA 4LD9D 5GXQB 1WWIA 4XUJB 3WA9B 3NQJB 3LJAC 2HIOA 5B1MC 3B6GC 4CAYB 5GT0B 4J8XB 4H9OB 4NE3A 3X1UD 3X1TC 3AYWA 5E5AB 3AZFB 1P3LD 5BNVB 3MGQC 3MNND 4KGCB 5B2ID 4YM6C 1S32D 4HGAC 3O62D 3EPLA 3REIC 3C1CB 3H0MC 5B33A 3UTAC 5JA4A 3WKJD 3AZLC 2YFWB 2FJ7B 5C3IC 5AV5C 1M19B 3MVDD 3AZMC 3REKC 4WU9A 2Y2GA 2YFVB 4EO5C 3A1IA 4H9QA 1P3IC 1ZLAB 5CPJC 5AY8A 5B31C 1ID3B 3A6ND 3X1SB 3AV1C 5CPIC 3UTBB 3LJAA 5B1MA 3B6GA 1P3GB 1TAFA 2AROC 3KUYD 2RVQC 4XZQD 5GXQC 5B31G 4XUJC 3X1TA 1R4VA 3B6FD 3WA9C 2Y2QA 5CP6B 3W99B 2Y2MA 5GT0C 3EPKA 1P34D 3MGQA 3AZNB 3AZFC 5E5AC 4YM6A 3VH5A 2XD5A 3REIA 3WTPD 3UTAA 2BYMB 5DNNB 3AZLA 3C1CC 4KHAB 4JJND 5AV5A 5B0YD 3AV2D 3H0LC 4J8WD 5BO0A 3AZMA 3REKA 2FJ7C 1KX3D 1M19C 1P3BC 5JRGA 5CPJA 5B31A 2Y2JA 3W96B 3REHB 1H3OB 5B32B 1BH8A 2NZDD 3AV1A 3VH5W 1F66D 4LD9B 4J8UD 2DQNC 2AROA 1ZLAC 2PYOD 3C1BC 5GXQA 3X1SC 4XUJA 3MGSD 2CV5D 3UTBC 2F2AC 3B0CT 3NQJA 3WA9A 3W98C 1P3GC 4CAYA 3X1UB 5GT0A 1P3LB 4H9OA 4WZSB 3AZFA 4H9PB 5E5AA 5DNMD 5CP6C 3W99C 3VH5T 5BNVA 3MNNB 5B2IB 2Y2HA 1S32B 3O62B 3W97D 3VH6A 4KGCA 4X23D 3AZNC 4WV4B 2ZM5A 3KXBD 3C1CA 3WKJB 1HTAA 4WNNB 5DNNC 2YFWA 2FJ7A 3REJD 3MVDB 1M19A 2BYKB 5AV6D 1BH9B 2YFVA 5B24D 3V9RB 3A6NB 1ZLAA 1ID3A 3W96C 3REHC 3C1BA 5B32C 3F6TA 3X1SA 5FUGB 3KUYB 3UTBA 4LD9C 3W98A 3LELD 1P3GA 4XZQB 3KFUG 5AVBD 5CP6A 3X1UC 1P34B 3W99A 3AZID 2IO5B 1P3LC 2RIQA 3AZNA 3WTPB 2JSSA 3P5JB 3MNNC 1M18D 2BYMA 2J8PA 2JE5A 5B2IC 1S32C 3O62C 4Z5TB 5DNNA 4JJNB 5B0YB 4R8PD 3AV2B 4J8WB 3WKJC 4YS3D 1KX3B 1B6WA 3MVDC 3WAAD 3W96A 3REHA 5B32A 4Z66D 1F66B 4J8UB 2PYOB 1KX5D 4LD9A 3A6NC 4NE6A 2CV5B 3MGSB 2F8ND 3KUYC 4XZQC 3X1UA 5GSUD 1P3LA 5DNMB 3IP4C 2Y2KA 4H9PA 1TZYD 1KU5A 4WU8D 3W97B 1P34C 3MNNA 5B2IA 2IO5C 4X23B 1S32A 3O62A 3KXBB 3WTPC 5CPKD 2W8SA 4J8VD 3WKJA 5B1LD 4NFTA 1N1JB 2DF4C 4WNNA 4Z5TC 3REJB 3LZ1D 4JJNC 2ZY3A 5JRGC 5B0YC 3AV2C 4J8WC 3MVDA 1P3OD 5AV6B 2BYKA 1KX3C 5B40D 3RELD 3AFAD 1JFIB 5B24B 1BH9A 5BT1D 2F8NH 3V9RA 3A6NA 4WU9D 3AZED 5KDMB 3EPHA 3LELB 4J8UC 5FUGA 3KUYA 4UPKA 4J8XC 2NQBB 4XZQA 5AVBB 4G92B 2CV5C 3MGSC
chains in the Genus database with same CATH topology
3AZKD 3LJAD 3AZIB 4QLCD 4ZUXD 4KGCC 1P34A 5DNMC 3WTPA 1M18B 1P3MD 5CHLB 4Z5TA 5F99D 4R8PB 4JJNA 5B0YA 3AV2A 4DRAA 4YS3B 4J8WA 3UT9D 1KX4D 4DQYB 1KX3A 3REJC 3B0DB 3NQUB 3WAAB 1ID3C 2G5HC 5AV6C 4Z66B 3REKD 5B24C 1KX5B 4J8UA 4AWLB 1F66A 2PYOA 3MGPD 4J8XA 1P3ID 4H9NB 5B31D 2F8NB 2CV5A 3MGSA 3AN2D 3LELC 5B2JD 5CPID 5GSUB 2AROD 2Y2IA 1AOID 5AVBC 2NQBC 4G92C 2XD1A 3KWQD 1EQZD 1TZYB 5DNMA 4WU8B 3AZIC 1P3FD 2HUEB 5CPKB 3KXBA 4J8VB 5B1LB 1M18C 3LZ0D 3LZ1B 4R8PC 3REJA 2JCHA 1P3OB 1P3PD 3EPJA 4YS3C 5AV6A 1A7WA 3VH6W 5B40B 3AFAB 3RELB 5AVCD 3B0DC 1JFIA 5B24A 3WAAC 3MGRD 3B6FB 1P3BD 3AZEB 3AZGD 3AL0C 5B32G 5KDMA 1KX5C 1HQ3D 3LELA 4AWLC 1P3AD 4KUDD 2NQBA 5AVBA 1P3KD 5B0ZD 3C1BD 3VH6T 3AZKB 3LJAB 4QLCB 5GT3D 4ZUXB 2ZY5A 5GSUC 3AZIA 3W98D 2FFFB 5AV9D 3AZHD 1TZYC 4KHAA 4WU8C 4CSRB 1P3MB 1M18A 3TU4D 5F99B 2Y2OA 2HUEC 5CPKC 4R8PA 1M1AD 4J8VC 3UT9B 1KX4B 5B1LC 1U35D 4YS3A 2NZDB 2L5AA 5AV8D 2Y2NA 1H3OA 4NE5A 3LZ1C 3X1VD 1P3OC 3NQUA 3WAAA 3AZJD 3REKB 5B40C 3RELC 3AFAC 4Z66A 3FDDA 3MGPB 1P3IB 1KX5A 3B6FC 4H9NA 3AZEC 3AN2B 5B2JB 5CPIB 2HIOD 1W2EA 2Y2PA 1AOIB 5GSUA 3R45B 3KWQB 1EQZB 3AYWD 4ZBJB 3AZKC 1TZYA 4QLCC 1P3FB 4Z2MH 1T3UA 4ZUXC 4WU8A 1F1EA 5CPKA 5B33D 4J8VA 5B1LA 3LZ0B 1P3MC 5F99C 3LZ1A 1P3PB 4E44A 1P3OA 3UT9C 1KX4C 2NZDC 5AVCB 5BNXB 5B40A 1F66C 3RELA 3AFAA 2PYOC 3MGRB 3H0RC 4H9RB 5AY8D 1P3BB 4H9SC 3B6FA 3AZGB 3AZEA 1HQ3B 1P3AB 4KUDB 5B1MD 3MGPC 3B6GD 2UWXA 1P3KB 5B0ZB 3C1BB 3X1TD 3AN2C 5B2JC 5GT3B 3AZKA 3W98B 4QLCA 3W97C 1AOIC 4ZUXA 4X23C 3KWQC 3MGQD 1EQZC 5AV9B 1PZRA 4ZBJC 4YM6D 3KXBC 3AZHB 3REID 3WTPE 1P3FC 3TU4B 3UTAD 4CSRA 1P3MA 4DRBA 5F99A 3AZLD 1M1AB 1U35B 5AV5D 5AV8B 3UT9A 1KX4A 3LZ0C 3AZMD 2NZDA 3X1VB 5G49B 1ULYA 1P3PC 4Z5TD 4G91B 3AZJB 5CPJD 5JRGD 4H9SA 4M6BA 5AVCC 3B0CW 3B0BA 3AV1D 4UUZB 3MGRC 3MGPA 1P3IA 5BS7C 2RVQD 3AZGC 5GXQD 2HIOB 4XUJD 3AN2A 3WA9D 1HQ3C 5B2JA 5CPIA 1P3AC 4KUDC 3W97A 5GT0D 1AOIA 3AYWB 4X23A 4J8XD 1P3KC 3R45A 5B0ZC 3KWQA 1EQZA 3AZFD 5E5AD 1B67A 5GT3C 1P3FA 3EG5B 3A1KA 3KSYA 1N1JA 4KGCD 5AV9C 3AZHC 5B33B 3C1CD 5JA4B 3TU4C 3LZ0A 2G5IC 1Z2CB 2FJ7D 1M1AC 1P3PA 1Q9CA 1U35C 4WU9B 5AV8C 1M19D 4Z66C 3X1VC 5AVCA 5BNXA 2ZY2A 4H9QB 4Z2MG 5AY8B 3MGRA 4G91C 3AZJC 4H9RA 1ZLAD 5BS7A 1P3BA 1ID3D 3AZGA 5B1MB 3B6GB 3X1SD 1TAFB 3UTBD 1HQ3A 1P3AA 4KUDA 1P3GD 3X1TB 4WJ3C 1P3KA 2VQRA 5B0ZA 2HIOC 2F8NG 1WWSA 5GT3A 2BG1A 5CP6D 3W99D 3MGQB 3AYWC 4YM6B 4HGAB 2NQBD 3REIB 5AV9A 3AZND 3AZHA 3UTAB 3TU4A 3AZLB 5C3IB 5DNND 1M1AA 5AV5B 5B33C 2F8NK 5BO0B 2CWEA 3AZMB 1U35A 5AV8A 4E45A 1BFMA 3X1VA 4EO5B 5BT1C 5G49A 5JRGB 2ZY4A 5CPJB 2LY8A 5B31B 4WU9C 3AZJA 1BH8B 2F8NA 3AV1B 3REHD 3W96D 5B32D 2Y2LA 2AROB 5AY8C 4UUZA 4LD9D 5GXQB 1WWIA 4XUJB 3WA9B 3NQJB 3LJAC 2HIOA 5B1MC 3B6GC 4CAYB 5GT0B 4J8XB 4H9OB 4NE3A 3X1UD 3X1TC 3AYWA 5E5AB 3AZFB 1P3LD 5BNVB 3MGQC 3MNND 4KGCB 5B2ID 4YM6C 1S32D 4HGAC 3O62D 3EPLA 3REIC 3C1CB 3H0MC 5B33A 3UTAC 5JA4A 3WKJD 3AZLC 2YFWB 2FJ7B 5C3IC 5AV5C 1M19B 3MVDD 3AZMC 3REKC 4WU9A 2Y2GA 2YFVB 4EO5C 3A1IA 4H9QA 1P3IC 1ZLAB 5CPJC 5AY8A 5B31C 1ID3B 3A6ND 3X1SB 3AV1C 5CPIC 3UTBB 3LJAA 5B1MA 3B6GA 1P3GB 1TAFA 2AROC 3KUYD 2RVQC 4XZQD 5GXQC 5B31G 4XUJC 3X1TA 1R4VA 3B6FD 3WA9C 2Y2QA 5CP6B 3W99B 2Y2MA 5GT0C 3EPKA 1P34D 3MGQA 3AZNB 3AZFC 5E5AC 4YM6A 3VH5A 2XD5A 3REIA 3WTPD 3UTAA 2BYMB 5DNNB 3AZLA 3C1CC 4KHAB 4JJND 5AV5A 5B0YD 3AV2D 3H0LC 4J8WD 5BO0A 3AZMA 3REKA 2FJ7C 1KX3D 1M19C 1P3BC 5JRGA 5CPJA 5B31A 2Y2JA 3W96B 3REHB 1H3OB 5B32B 1BH8A 2NZDD 3AV1A 3VH5W 1F66D 4LD9B 4J8UD 2DQNC 2AROA 1ZLAC 2PYOD 3C1BC 5GXQA 3X1SC 4XUJA 3MGSD 2CV5D 3UTBC 2F2AC 3B0CT 3NQJA 3WA9A 3W98C 1P3GC 4CAYA 3X1UB 5GT0A 1P3LB 4H9OA 4WZSB 3AZFA 4H9PB 5E5AA 5DNMD 5CP6C 3W99C 3VH5T 5BNVA 3MNNB 5B2IB 2Y2HA 1S32B 3O62B 3W97D 3VH6A 4KGCA 4X23D 3AZNC 4WV4B 2ZM5A 3KXBD 3C1CA 3WKJB 1HTAA 4WNNB 5DNNC 2YFWA 2FJ7A 3REJD 3MVDB 1M19A 2BYKB 5AV6D 1BH9B 2YFVA 5B24D 3V9RB 3A6NB 1ZLAA 1ID3A 3W96C 3REHC 3C1BA 5B32C 3F6TA 3X1SA 5FUGB 3KUYB 3UTBA 4LD9C 3W98A 3LELD 1P3GA 4XZQB 3KFUG 5AVBD 5CP6A 3X1UC 1P34B 3W99A 3AZID 2IO5B 1P3LC 2RIQA 3AZNA 3WTPB 2JSSA 3P5JB 3MNNC 1M18D 2BYMA 2J8PA 2JE5A 5B2IC 1S32C 3O62C 4Z5TB 5DNNA 4JJNB 5B0YB 4R8PD 3AV2B 4J8WB 3WKJC 4YS3D 1KX3B 1B6WA 3MVDC 3WAAD 3W96A 3REHA 5B32A 4Z66D 1F66B 4J8UB 2PYOB 1KX5D 4LD9A 3A6NC 4NE6A 2CV5B 3MGSB 2F8ND 3KUYC 4XZQC 3X1UA 5GSUD 1P3LA 5DNMB 3IP4C 2Y2KA 4H9PA 1TZYD 1KU5A 4WU8D 3W97B 1P34C 3MNNA 5B2IA 2IO5C 4X23B 1S32A 3O62A 3KXBB 3WTPC 5CPKD 2W8SA 4J8VD 3WKJA 5B1LD 4NFTA 1N1JB 2DF4C 4WNNA 4Z5TC 3REJB 3LZ1D 4JJNC 2ZY3A 5JRGC 5B0YC 3AV2C 4J8WC 3MVDA 1P3OD 5AV6B 2BYKA 1KX3C 5B40D 3RELD 3AFAD 1JFIB 5B24B 1BH9A 5BT1D 2F8NH 3V9RA 3A6NA 4WU9D 3AZED 5KDMB 3EPHA 3LELB 4J8UC 5FUGA 3KUYA 4UPKA 4J8XC 2NQBB 4XZQA 5AVBB 4G92B 2CV5C 3MGSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK D;  3LJA D;  3AZI B;  4QLC D;  4ZUX D;  4KGC C;  1P34 A;  5DNM C;  3WTP A;  1M18 B;  1P3M D;  5CHL B;  4Z5T A;  5F99 D;  4R8P B;  4JJN A;  5B0Y A;  3AV2 A;  4DRA A;  4YS3 B;  4J8W A;  3UT9 D;  1KX4 D;  1KX3 A;  3REJ C;  3B0D B;  3NQU B;  3WAA B;  1ID3 C;  5AV6 C;  4Z66 B;  3REK D;  5B24 C;  1KX5 B;  4J8U A;  4AWL B;  1F66 A;  2PYO A;  3MGP D;  4J8X A;  1P3I D;  4H9N B;  5B31 D;  2F8N B;  2CV5 A;  3MGS A;  3AN2 D;  3LEL C;  5B2J D;  5CPI D;  5GSU B;  2ARO D;  2NQB C;  1AOI D;  5AVB C;  4G92 C;  3KWQ D;  1EQZ D;  1TZY B;  5DNM A;  4WU8 B;  3AZI C;  1P3F D;  2HUE B;  5CPK B;  3KXB A;  4J8V B;  5B1L B;  1M18 C;  3LZ0 D;  3LZ1 B;  4R8P C;  3REJ A;  1P3O B;  1P3P D;  4YS3 C;  5AV6 A;  1A7W A;  3VH6 W;  5B40 B;  3AFA B;  3REL B;  5AVC D;  3B0D C;  1JFI A;  5B24 A;  3WAA C;  3MGR D;  3B6F B;  1P3B D;  3AZE B;  3AZG D;  5B32 G;  5KDM A;  1KX5 C;  1HQ3 D;  3LEL A;  4AWL C;  1P3A D;  4KUD D;  2NQB A;  5AVB A;  1P3K D;  5B0Z D;  3C1B D;  3VH6 T;  3AZK B;  3LJA B;  4QLC B;  5GT3 D;  4ZUX B;  5GSU C;  3AZI A;  3W98 D;  5AV9 D;  3AZH D;  1TZY C;  4KHA A;  4WU8 C;  4CSR B;  1P3M B;  1M18 A;  3TU4 D;  5F99 B;  2HUE C;  5CPK C;  4R8P A;  1M1A D;  4J8V C;  3UT9 B;  1KX4 B;  5B1L C;  1U35 D;  4YS3 A;  2NZD B;  2L5A A;  5AV8 D;  1H3O A;  4NE5 A;  3LZ1 C;  3X1V D;  1P3O C;  3NQU A;  3WAA A;  3AZJ D;  3REK B;  5B40 C;  3REL C;  3AFA C;  4Z66 A;  3MGP B;  1P3I B;  1KX5 A;  3B6F C;  4H9N A;  3AZE C;  3AN2 B;  5B2J B;  5CPI B;  2HIO D;  1AOI B;  5GSU A;  3R45 B;  3KWQ B;  1EQZ B;  3AYW D;  4ZBJ B;  3AZK C;  1TZY A;  4QLC C;  1P3F B;  4Z2M H;  4ZUX C;  4WU8 A;  1F1E A;  5CPK A;  5B33 D;  4J8V A;  5B1L A;  3LZ0 B;  1P3M C;  5F99 C;  3LZ1 A;  1P3P B;  4E44 A;  1P3O A;  3UT9 C;  1KX4 C;  2NZD C;  5AVC B;  5BNX B;  5B40 A;  1F66 C;  3REL A;  3AFA A;  2PYO C;  3MGR B;  4H9R B;  5AY8 D;  1P3B B;  4H9S C;  3B6F A;  3AZG B;  3AZE A;  1HQ3 B;  1P3A B;  4KUD B;  5B1M D;  3MGP C;  3B6G D;  1P3K B;  5B0Z B;  3C1B B;  3X1T D;  3AN2 C;  5B2J C;  5GT3 B;  3AZK A;  3W98 B;  4QLC A;  3W97 C;  1AOI C;  4ZUX A;  4X23 C;  3KWQ C;  3MGQ D;  1EQZ C;  5AV9 B;  3KXB C;  4ZBJ C;  4YM6 D;  3AZH B;  3REI D;  3WTP E;  1P3F C;  3TU4 B;  3UTA D;  4CSR A;  1P3M A;  4DRB A;  5F99 A;  3AZL D;  1M1A B;  1U35 B;  5AV5 D;  5AV8 B;  3UT9 A;  1KX4 A;  3LZ0 C;  3AZM D;  2NZD A;  3X1V B;  5G49 B;  1ULY A;  1P3P C;  4Z5T D;  4G91 B;  3AZJ B;  5CPJ D;  5JRG D;  4H9S A;  4M6B A;  5AVC C;  3B0C W;  3B0B A;  3AV1 D;  4UUZ B;  3MGR C;  3MGP A;  1P3I A;  5BS7 C;  2RVQ D;  3AZG C;  5GXQ D;  2HIO B;  4XUJ D;  3AN2 A;  3WA9 D;  1HQ3 C;  5B2J A;  5CPI A;  1P3A C;  4KUD C;  3W97 A;  5GT0 D;  1AOI A;  3AYW B;  4X23 A;  4J8X D;  1P3K C;  3R45 A;  5B0Z C;  3KWQ A;  1EQZ A;  3AZF D;  5E5A D;  1B67 A;  5GT3 C;  1P3F A;  3KSY A;  1N1J A;  4KGC D;  5AV9 C;  3AZH C;  5B33 B;  3C1C D;  5JA4 B;  3TU4 C;  3LZ0 A;  2FJ7 D;  1M1A C;  1P3P A;  1Q9C A;  1U35 C;  4WU9 B;  5AV8 C;  1M19 D;  4Z66 C;  3X1V C;  5AVC A;  5BNX A;  4H9Q B;  4Z2M G;  5AY8 B;  3MGR A;  4G91 C;  3AZJ C;  4H9R A;  1ZLA D;  5BS7 A;  1P3B A;  1ID3 D;  3AZG A;  5B1M B;  3B6G B;  3X1S D;  1TAF B;  3UTB D;  1HQ3 A;  1P3A A;  4KUD A;  1P3G D;  3X1T B;  1P3K A;  5B0Z A;  2HIO C;  2F8N G;  1WWS A;  5GT3 A;  5CP6 D;  3W99 D;  3MGQ B;  3AYW C;  4YM6 B;  4HGA B;  2NQB D;  3REI B;  5AV9 A;  3AZN D;  3AZH A;  3UTA B;  3TU4 A;  3AZL B;  5C3I B;  5DNN D;  1M1A A;  5AV5 B;  5B33 C;  2F8N K;  5BO0 B;  2CWE A;  3AZM B;  1U35 A;  5AV8 A;  4E45 A;  1BFM A;  3X1V A;  4EO5 B;  5BT1 C;  5G49 A;  5JRG B;  5CPJ B;  2LY8 A;  5B31 B;  4WU9 C;  3AZJ A;  1BH8 B;  2F8N A;  3AV1 B;  3REH D;  3W96 D;  5B32 D;  2ARO B;  5AY8 C;  4UUZ A;  4LD9 D;  5GXQ B;  1WWI A;  4XUJ B;  3WA9 B;  3NQJ B;  3LJA C;  2HIO A;  5B1M C;  3B6G C;  4CAY B;  5GT0 B;  4J8X B;  4H9O B;  4NE3 A;  3X1U D;  3X1T C;  3AYW A;  5E5A B;  3AZF B;  1P3L D;  5BNV B;  3MGQ C;  3MNN D;  4KGC B;  5B2I D;  4YM6 C;  1S32 D;  4HGA C;  3O62 D;  3REI C;  3C1C B;  5B33 A;  3UTA C;  5JA4 A;  3WKJ D;  3AZL C;  2YFW B;  2FJ7 B;  5C3I C;  5AV5 C;  1M19 B;  3MVD D;  3AZM C;  3REK C;  4WU9 A;  2YFV B;  4EO5 C;  4H9Q A;  1P3I C;  1ZLA B;  5CPJ C;  5AY8 A;  5B31 C;  1ID3 B;  3A6N D;  3X1S B;  3AV1 C;  5CPI C;  3UTB B;  3LJA A;  5B1M A;  3B6G A;  1P3G B;  1TAF A;  2ARO C;  3KUY D;  2RVQ C;  4XZQ D;  5GXQ C;  5B31 G;  4XUJ C;  3X1T A;  1R4V A;  3B6F D;  3WA9 C;  5CP6 B;  3W99 B;  5GT0 C;  1P34 D;  3MGQ A;  3AZN B;  3AZF C;  5E5A C;  4YM6 A;  3VH5 A;  3REI A;  3WTP D;  3UTA A;  2BYM B;  5DNN B;  3AZL A;  3C1C C;  4KHA B;  4JJN D;  5AV5 A;  5B0Y D;  3AV2 D;  4J8W D;  5BO0 A;  3AZM A;  3REK A;  2FJ7 C;  1KX3 D;  1M19 C;  1P3B C;  5JRG A;  5CPJ A;  5B31 A;  3W96 B;  3REH B;  1H3O B;  5B32 B;  1BH8 A;  2NZD D;  3AV1 A;  3VH5 W;  1F66 D;  4LD9 B;  4J8U D;  2ARO A;  1ZLA C;  2PYO D;  3C1B C;  5GXQ A;  3X1S C;  4XUJ A;  3MGS D;  2CV5 D;  3UTB C;  3NQJ A;  3B0C T;  3WA9 A;  3W98 C;  1P3G C;  4CAY A;  3X1U B;  5GT0 A;  1P3L B;  4H9O A;  4WZS B;  3AZF A;  4H9P B;  5E5A A;  5DNM D;  5CP6 C;  3W99 C;  3VH5 T;  5BNV A;  3MNN B;  5B2I B;  1S32 B;  3O62 B;  3W97 D;  3VH6 A;  4KGC A;  4X23 D;  3AZN C;  4WV4 B;  3KXB D;  3C1C A;  3WKJ B;  1HTA A;  4WNN B;  5DNN C;  2YFW A;  2FJ7 A;  3REJ D;  3MVD B;  1M19 A;  2BYK B;  5AV6 D;  1BH9 B;  2YFV A;  5B24 D;  3V9R B;  3A6N B;  1ZLA A;  1ID3 A;  3W96 C;  3REH C;  3C1B A;  5B32 C;  3X1S A;  5FUG B;  3KUY B;  3UTB A;  4LD9 C;  3W98 A;  3LEL D;  1P3G A;  4XZQ B;  5AVB D;  5CP6 A;  3X1U C;  1P34 B;  3W99 A;  3AZI D;  2IO5 B;  1P3L C;  3AZN A;  3WTP B;  2JSS A;  3MNN C;  1M18 D;  2BYM A;  5B2I C;  1S32 C;  3O62 C;  4Z5T B;  5DNN A;  4JJN B;  5B0Y B;  4R8P D;  3AV2 B;  4J8W B;  3WKJ C;  4YS3 D;  1KX3 B;  1B6W A;  3MVD C;  3WAA D;  3W96 A;  3REH A;  5B32 A;  4Z66 D;  1F66 B;  4J8U B;  2PYO B;  1KX5 D;  4LD9 A;  3A6N C;  4NE6 A;  2CV5 B;  3MGS B;  2F8N D;  3KUY C;  4XZQ C;  3X1U A;  5GSU D;  1P3L A;  5DNM B;  4H9P A;  1TZY D;  1KU5 A;  4WU8 D;  3W97 B;  1P34 C;  3MNN A;  5B2I A;  2IO5 C;  4X23 B;  1S32 A;  3O62 A;  3KXB B;  3WTP C;  5CPK D;  4J8V D;  3WKJ A;  5B1L D;  4NFT A;  1N1J B;  4WNN A;  4Z5T C;  3REJ B;  3LZ1 D;  4JJN C;  5JRG C;  5B0Y C;  3AV2 C;  4J8W C;  3MVD A;  1P3O D;  5AV6 B;  2BYK A;  1KX3 C;  5B40 D;  3REL D;  3AFA D;  1JFI B;  5B24 B;  1BH9 A;  5BT1 D;  2F8N H;  3V9R A;  3A6N A;  4WU9 D;  3AZE D;  5KDM B;  3LEL B;  4J8U C;  5FUG A;  3KUY A;  4J8X C;  2NQB B;  4XZQ A;  5AVB B;  4G92 B;  2CV5 C;  3MGS C; 
#chains in the Genus database with same CATH topology
 3AZK D;  3LJA D;  3AZI B;  4QLC D;  4ZUX D;  4KGC C;  1P34 A;  5DNM C;  3WTP A;  1M18 B;  1P3M D;  5CHL B;  4Z5T A;  5F99 D;  4R8P B;  4JJN A;  5B0Y A;  3AV2 A;  4DRA A;  4YS3 B;  4J8W A;  3UT9 D;  1KX4 D;  4DQY B;  1KX3 A;  3REJ C;  3B0D B;  3NQU B;  3WAA B;  1ID3 C;  2G5H C;  5AV6 C;  4Z66 B;  3REK D;  5B24 C;  1KX5 B;  4J8U A;  4AWL B;  1F66 A;  2PYO A;  3MGP D;  4J8X A;  1P3I D;  4H9N B;  5B31 D;  2F8N B;  2CV5 A;  3MGS A;  3AN2 D;  3LEL C;  5B2J D;  5CPI D;  5GSU B;  2ARO D;  2Y2I A;  1AOI D;  5AVB C;  2NQB C;  4G92 C;  2XD1 A;  3KWQ D;  1EQZ D;  1TZY B;  5DNM A;  4WU8 B;  3AZI C;  1P3F D;  2HUE B;  5CPK B;  3KXB A;  4J8V B;  5B1L B;  1M18 C;  3LZ0 D;  3LZ1 B;  4R8P C;  3REJ A;  2JCH A;  1P3O B;  1P3P D;  3EPJ A;  4YS3 C;  5AV6 A;  1A7W A;  3VH6 W;  5B40 B;  3AFA B;  3REL B;  5AVC D;  3B0D C;  1JFI A;  5B24 A;  3WAA C;  3MGR D;  3B6F B;  1P3B D;  3AZE B;  3AZG D;  3AL0 C;  5B32 G;  5KDM A;  1KX5 C;  1HQ3 D;  3LEL A;  4AWL C;  1P3A D;  4KUD D;  2NQB A;  5AVB A;  1P3K D;  5B0Z D;  3C1B D;  3VH6 T;  3AZK B;  3LJA B;  4QLC B;  5GT3 D;  4ZUX B;  2ZY5 A;  5GSU C;  3AZI A;  3W98 D;  2FFF B;  5AV9 D;  3AZH D;  1TZY C;  4KHA A;  4WU8 C;  4CSR B;  1P3M B;  1M18 A;  3TU4 D;  5F99 B;  2Y2O A;  2HUE C;  5CPK C;  4R8P A;  1M1A D;  4J8V C;  3UT9 B;  1KX4 B;  5B1L C;  1U35 D;  4YS3 A;  2NZD B;  2L5A A;  5AV8 D;  2Y2N A;  1H3O A;  4NE5 A;  3LZ1 C;  3X1V D;  1P3O C;  3NQU A;  3WAA A;  3AZJ D;  3REK B;  5B40 C;  3REL C;  3AFA C;  4Z66 A;  3FDD A;  3MGP B;  1P3I B;  1KX5 A;  3B6F C;  4H9N A;  3AZE C;  3AN2 B;  5B2J B;  5CPI B;  2HIO D;  1W2E A;  2Y2P A;  1AOI B;  5GSU A;  3R45 B;  3KWQ B;  1EQZ B;  3AYW D;  4ZBJ B;  3AZK C;  1TZY A;  4QLC C;  1P3F B;  4Z2M H;  1T3U A;  4ZUX C;  4WU8 A;  1F1E A;  5CPK A;  5B33 D;  4J8V A;  5B1L A;  3LZ0 B;  1P3M C;  5F99 C;  3LZ1 A;  1P3P B;  4E44 A;  1P3O A;  3UT9 C;  1KX4 C;  2NZD C;  5AVC B;  5BNX B;  5B40 A;  1F66 C;  3REL A;  3AFA A;  2PYO C;  3MGR B;  3H0R C;  4H9R B;  5AY8 D;  1P3B B;  4H9S C;  3B6F A;  3AZG B;  3AZE A;  1HQ3 B;  1P3A B;  4KUD B;  5B1M D;  3MGP C;  3B6G D;  2UWX A;  1P3K B;  5B0Z B;  3C1B B;  3X1T D;  3AN2 C;  5B2J C;  5GT3 B;  3AZK A;  3W98 B;  4QLC A;  3W97 C;  1AOI C;  4ZUX A;  4X23 C;  3KWQ C;  3MGQ D;  1EQZ C;  5AV9 B;  1PZR A;  4ZBJ C;  4YM6 D;  3KXB C;  3AZH B;  3REI D;  3WTP E;  1P3F C;  3TU4 B;  3UTA D;  4CSR A;  1P3M A;  4DRB A;  5F99 A;  3AZL D;  1M1A B;  1U35 B;  5AV5 D;  5AV8 B;  3UT9 A;  1KX4 A;  3LZ0 C;  3AZM D;  2NZD A;  3X1V B;  5G49 B;  1ULY A;  1P3P C;  4Z5T D;  4G91 B;  3AZJ B;  5CPJ D;  5JRG D;  4H9S A;  4M6B A;  5AVC C;  3B0C W;  3B0B A;  3AV1 D;  4UUZ B;  3MGR C;  3MGP A;  1P3I A;  5BS7 C;  2RVQ D;  3AZG C;  5GXQ D;  2HIO B;  4XUJ D;  3AN2 A;  3WA9 D;  1HQ3 C;  5B2J A;  5CPI A;  1P3A C;  4KUD C;  3W97 A;  5GT0 D;  1AOI A;  3AYW B;  4X23 A;  4J8X D;  1P3K C;  3R45 A;  5B0Z C;  3KWQ A;  1EQZ A;  3AZF D;  5E5A D;  1B67 A;  5GT3 C;  1P3F A;  3EG5 B;  3A1K A;  3KSY A;  1N1J A;  4KGC D;  5AV9 C;  3AZH C;  5B33 B;  3C1C D;  5JA4 B;  3TU4 C;  3LZ0 A;  2G5I C;  1Z2C B;  2FJ7 D;  1M1A C;  1P3P A;  1Q9C A;  1U35 C;  4WU9 B;  5AV8 C;  1M19 D;  4Z66 C;  3X1V C;  5AVC A;  5BNX A;  2ZY2 A;  4H9Q B;  4Z2M G;  5AY8 B;  3MGR A;  4G91 C;  3AZJ C;  4H9R A;  1ZLA D;  5BS7 A;  1P3B A;  1ID3 D;  3AZG A;  5B1M B;  3B6G B;  3X1S D;  1TAF B;  3UTB D;  1HQ3 A;  1P3A A;  4KUD A;  1P3G D;  3X1T B;  4WJ3 C;  1P3K A;  2VQR A;  5B0Z A;  2HIO C;  2F8N G;  1WWS A;  5GT3 A;  2BG1 A;  5CP6 D;  3W99 D;  3MGQ B;  3AYW C;  4YM6 B;  4HGA B;  2NQB D;  3REI B;  5AV9 A;  3AZN D;  3AZH A;  3UTA B;  3TU4 A;  3AZL B;  5C3I B;  5DNN D;  1M1A A;  5AV5 B;  5B33 C;  2F8N K;  5BO0 B;  2CWE A;  3AZM B;  1U35 A;  5AV8 A;  4E45 A;  1BFM A;  3X1V A;  4EO5 B;  5BT1 C;  5G49 A;  5JRG B;  2ZY4 A;  5CPJ B;  2LY8 A;  5B31 B;  4WU9 C;  3AZJ A;  1BH8 B;  2F8N A;  3AV1 B;  3REH D;  3W96 D;  5B32 D;  2Y2L A;  2ARO B;  5AY8 C;  4UUZ A;  4LD9 D;  5GXQ B;  1WWI A;  4XUJ B;  3WA9 B;  3NQJ B;  3LJA C;  2HIO A;  5B1M C;  3B6G C;  4CAY B;  5GT0 B;  4J8X B;  4H9O B;  4NE3 A;  3X1U D;  3X1T C;  3AYW A;  5E5A B;  3AZF B;  1P3L D;  5BNV B;  3MGQ C;  3MNN D;  4KGC B;  5B2I D;  4YM6 C;  1S32 D;  4HGA C;  3O62 D;  3EPL A;  3REI C;  3C1C B;  3H0M C;  5B33 A;  3UTA C;  5JA4 A;  3WKJ D;  3AZL C;  2YFW B;  2FJ7 B;  5C3I C;  5AV5 C;  1M19 B;  3MVD D;  3AZM C;  3REK C;  4WU9 A;  2Y2G A;  2YFV B;  4EO5 C;  3A1I A;  4H9Q A;  1P3I C;  1ZLA B;  5CPJ C;  5AY8 A;  5B31 C;  1ID3 B;  3A6N D;  3X1S B;  3AV1 C;  5CPI C;  3UTB B;  3LJA A;  5B1M A;  3B6G A;  1P3G B;  1TAF A;  2ARO C;  3KUY D;  2RVQ C;  4XZQ D;  5GXQ C;  5B31 G;  4XUJ C;  3X1T A;  1R4V A;  3B6F D;  3WA9 C;  2Y2Q A;  5CP6 B;  3W99 B;  2Y2M A;  5GT0 C;  3EPK A;  1P34 D;  3MGQ A;  3AZN B;  3AZF C;  5E5A C;  4YM6 A;  3VH5 A;  2XD5 A;  3REI A;  3WTP D;  3UTA A;  2BYM B;  5DNN B;  3AZL A;  3C1C C;  4KHA B;  4JJN D;  5AV5 A;  5B0Y D;  3AV2 D;  3H0L C;  4J8W D;  5BO0 A;  3AZM A;  3REK A;  2FJ7 C;  1KX3 D;  1M19 C;  1P3B C;  5JRG A;  5CPJ A;  5B31 A;  2Y2J A;  3W96 B;  3REH B;  1H3O B;  5B32 B;  1BH8 A;  2NZD D;  3AV1 A;  3VH5 W;  1F66 D;  4LD9 B;  4J8U D;  2DQN C;  2ARO A;  1ZLA C;  2PYO D;  3C1B C;  5GXQ A;  3X1S C;  4XUJ A;  3MGS D;  2CV5 D;  3UTB C;  2F2A C;  3B0C T;  3NQJ A;  3WA9 A;  3W98 C;  1P3G C;  4CAY A;  3X1U B;  5GT0 A;  1P3L B;  4H9O A;  4WZS B;  3AZF A;  4H9P B;  5E5A A;  5DNM D;  5CP6 C;  3W99 C;  3VH5 T;  5BNV A;  3MNN B;  5B2I B;  2Y2H A;  1S32 B;  3O62 B;  3W97 D;  3VH6 A;  4KGC A;  4X23 D;  3AZN C;  4WV4 B;  2ZM5 A;  3KXB D;  3C1C A;  3WKJ B;  1HTA A;  4WNN B;  5DNN C;  2YFW A;  2FJ7 A;  3REJ D;  3MVD B;  1M19 A;  2BYK B;  5AV6 D;  1BH9 B;  2YFV A;  5B24 D;  3V9R B;  3A6N B;  1ZLA A;  1ID3 A;  3W96 C;  3REH C;  3C1B A;  5B32 C;  3F6T A;  3X1S A;  5FUG B;  3KUY B;  3UTB A;  4LD9 C;  3W98 A;  3LEL D;  1P3G A;  4XZQ B;  3KFU G;  5AVB D;  5CP6 A;  3X1U C;  1P34 B;  3W99 A;  3AZI D;  2IO5 B;  1P3L C;  2RIQ A;  3AZN A;  3WTP B;  2JSS A;  3P5J B;  3MNN C;  1M18 D;  2BYM A;  2J8P A;  2JE5 A;  5B2I C;  1S32 C;  3O62 C;  4Z5T B;  5DNN A;  4JJN B;  5B0Y B;  4R8P D;  3AV2 B;  4J8W B;  3WKJ C;  4YS3 D;  1KX3 B;  1B6W A;  3MVD C;  3WAA D;  3W96 A;  3REH A;  5B32 A;  4Z66 D;  1F66 B;  4J8U B;  2PYO B;  1KX5 D;  4LD9 A;  3A6N C;  4NE6 A;  2CV5 B;  3MGS B;  2F8N D;  3KUY C;  4XZQ C;  3X1U A;  5GSU D;  1P3L A;  5DNM B;  3IP4 C;  2Y2K A;  4H9P A;  1TZY D;  1KU5 A;  4WU8 D;  3W97 B;  1P34 C;  3MNN A;  5B2I A;  2IO5 C;  4X23 B;  1S32 A;  3O62 A;  3KXB B;  3WTP C;  5CPK D;  2W8S A;  4J8V D;  3WKJ A;  5B1L D;  4NFT A;  1N1J B;  2DF4 C;  4WNN A;  4Z5T C;  3REJ B;  3LZ1 D;  4JJN C;  2ZY3 A;  5JRG C;  5B0Y C;  3AV2 C;  4J8W C;  3MVD A;  1P3O D;  5AV6 B;  2BYK A;  1KX3 C;  5B40 D;  3REL D;  3AFA D;  1JFI B;  5B24 B;  1BH9 A;  5BT1 D;  2F8N H;  3V9R A;  3A6N A;  4WU9 D;  3AZE D;  5KDM B;  3EPH A;  3LEL B;  4J8U C;  5FUG A;  3KUY A;  4UPK A;  4J8X C;  2NQB B;  4XZQ A;  5AVB B;  4G92 B;  2CV5 C;  3MGS C; 
#chains in the Genus database with same CATH homology
 3AZK D;  3LJA D;  3AZI B;  4QLC D;  4ZUX D;  4KGC C;  1P34 A;  5DNM C;  3WTP A;  1M18 B;  1P3M D;  5CHL B;  4Z5T A;  5F99 D;  4R8P B;  4JJN A;  5B0Y A;  3AV2 A;  4DRA A;  4YS3 B;  4J8W A;  3UT9 D;  1KX4 D;  4DQY B;  1KX3 A;  3REJ C;  3B0D B;  3NQU B;  3WAA B;  1ID3 C;  2G5H C;  5AV6 C;  4Z66 B;  3REK D;  5B24 C;  1KX5 B;  4J8U A;  4AWL B;  1F66 A;  2PYO A;  3MGP D;  4J8X A;  1P3I D;  4H9N B;  5B31 D;  2F8N B;  2CV5 A;  3MGS A;  3AN2 D;  3LEL C;  5B2J D;  5CPI D;  5GSU B;  2ARO D;  2Y2I A;  1AOI D;  5AVB C;  2NQB C;  4G92 C;  2XD1 A;  3KWQ D;  1EQZ D;  1TZY B;  5DNM A;  4WU8 B;  3AZI C;  1P3F D;  2HUE B;  5CPK B;  3KXB A;  4J8V B;  5B1L B;  1M18 C;  3LZ0 D;  3LZ1 B;  4R8P C;  3REJ A;  2JCH A;  1P3O B;  1P3P D;  3EPJ A;  4YS3 C;  5AV6 A;  1A7W A;  3VH6 W;  5B40 B;  3AFA B;  3REL B;  5AVC D;  3B0D C;  1JFI A;  5B24 A;  3WAA C;  3MGR D;  3B6F B;  1P3B D;  3AZE B;  3AZG D;  3AL0 C;  5B32 G;  5KDM A;  1KX5 C;  1HQ3 D;  3LEL A;  4AWL C;  1P3A D;  4KUD D;  2NQB A;  5AVB A;  1P3K D;  5B0Z D;  3C1B D;  3VH6 T;  3AZK B;  3LJA B;  4QLC B;  5GT3 D;  4ZUX B;  2ZY5 A;  5GSU C;  3AZI A;  3W98 D;  2FFF B;  5AV9 D;  3AZH D;  1TZY C;  4KHA A;  4WU8 C;  4CSR B;  1P3M B;  1M18 A;  3TU4 D;  5F99 B;  2Y2O A;  2HUE C;  5CPK C;  4R8P A;  1M1A D;  4J8V C;  3UT9 B;  1KX4 B;  5B1L C;  1U35 D;  4YS3 A;  2NZD B;  2L5A A;  5AV8 D;  2Y2N A;  1H3O A;  4NE5 A;  3LZ1 C;  3X1V D;  1P3O C;  3NQU A;  3WAA A;  3AZJ D;  3REK B;  5B40 C;  3REL C;  3AFA C;  4Z66 A;  3FDD A;  3MGP B;  1P3I B;  1KX5 A;  3B6F C;  4H9N A;  3AZE C;  3AN2 B;  5B2J B;  5CPI B;  2HIO D;  1W2E A;  2Y2P A;  1AOI B;  5GSU A;  3R45 B;  3KWQ B;  1EQZ B;  3AYW D;  4ZBJ B;  3AZK C;  1TZY A;  4QLC C;  1P3F B;  4Z2M H;  1T3U A;  4ZUX C;  4WU8 A;  1F1E A;  5CPK A;  5B33 D;  4J8V A;  5B1L A;  3LZ0 B;  1P3M C;  5F99 C;  3LZ1 A;  1P3P B;  4E44 A;  1P3O A;  3UT9 C;  1KX4 C;  2NZD C;  5AVC B;  5BNX B;  5B40 A;  1F66 C;  3REL A;  3AFA A;  2PYO C;  3MGR B;  3H0R C;  4H9R B;  5AY8 D;  1P3B B;  4H9S C;  3B6F A;  3AZG B;  3AZE A;  1HQ3 B;  1P3A B;  4KUD B;  5B1M D;  3MGP C;  3B6G D;  2UWX A;  1P3K B;  5B0Z B;  3C1B B;  3X1T D;  3AN2 C;  5B2J C;  5GT3 B;  3AZK A;  3W98 B;  4QLC A;  3W97 C;  1AOI C;  4ZUX A;  4X23 C;  3KWQ C;  3MGQ D;  1EQZ C;  5AV9 B;  1PZR A;  4ZBJ C;  4YM6 D;  3KXB C;  3AZH B;  3REI D;  3WTP E;  1P3F C;  3TU4 B;  3UTA D;  4CSR A;  1P3M A;  4DRB A;  5F99 A;  3AZL D;  1M1A B;  1U35 B;  5AV5 D;  5AV8 B;  3UT9 A;  1KX4 A;  3LZ0 C;  3AZM D;  2NZD A;  3X1V B;  5G49 B;  1ULY A;  1P3P C;  4Z5T D;  4G91 B;  3AZJ B;  5CPJ D;  5JRG D;  4H9S A;  4M6B A;  5AVC C;  3B0C W;  3B0B A;  3AV1 D;  4UUZ B;  3MGR C;  3MGP A;  1P3I A;  5BS7 C;  2RVQ D;  3AZG C;  5GXQ D;  2HIO B;  4XUJ D;  3AN2 A;  3WA9 D;  1HQ3 C;  5B2J A;  5CPI A;  1P3A C;  4KUD C;  3W97 A;  5GT0 D;  1AOI A;  3AYW B;  4X23 A;  4J8X D;  1P3K C;  3R45 A;  5B0Z C;  3KWQ A;  1EQZ A;  3AZF D;  5E5A D;  1B67 A;  5GT3 C;  1P3F A;  3EG5 B;  3A1K A;  3KSY A;  1N1J A;  4KGC D;  5AV9 C;  3AZH C;  5B33 B;  3C1C D;  5JA4 B;  3TU4 C;  3LZ0 A;  2G5I C;  1Z2C B;  2FJ7 D;  1M1A C;  1P3P A;  1Q9C A;  1U35 C;  4WU9 B;  5AV8 C;  1M19 D;  4Z66 C;  3X1V C;  5AVC A;  5BNX A;  2ZY2 A;  4H9Q B;  4Z2M G;  5AY8 B;  3MGR A;  4G91 C;  3AZJ C;  4H9R A;  1ZLA D;  5BS7 A;  1P3B A;  1ID3 D;  3AZG A;  5B1M B;  3B6G B;  3X1S D;  1TAF B;  3UTB D;  1HQ3 A;  1P3A A;  4KUD A;  1P3G D;  3X1T B;  4WJ3 C;  1P3K A;  2VQR A;  5B0Z A;  2HIO C;  2F8N G;  1WWS A;  5GT3 A;  2BG1 A;  5CP6 D;  3W99 D;  3MGQ B;  3AYW C;  4YM6 B;  4HGA B;  2NQB D;  3REI B;  5AV9 A;  3AZN D;  3AZH A;  3UTA B;  3TU4 A;  3AZL B;  5C3I B;  5DNN D;  1M1A A;  5AV5 B;  5B33 C;  2F8N K;  5BO0 B;  2CWE A;  3AZM B;  1U35 A;  5AV8 A;  4E45 A;  1BFM A;  3X1V A;  4EO5 B;  5BT1 C;  5G49 A;  5JRG B;  2ZY4 A;  5CPJ B;  2LY8 A;  5B31 B;  4WU9 C;  3AZJ A;  1BH8 B;  2F8N A;  3AV1 B;  3REH D;  3W96 D;  5B32 D;  2Y2L A;  2ARO B;  5AY8 C;  4UUZ A;  4LD9 D;  5GXQ B;  1WWI A;  4XUJ B;  3WA9 B;  3NQJ B;  3LJA C;  2HIO A;  5B1M C;  3B6G C;  4CAY B;  5GT0 B;  4J8X B;  4H9O B;  4NE3 A;  3X1U D;  3X1T C;  3AYW A;  5E5A B;  3AZF B;  1P3L D;  5BNV B;  3MGQ C;  3MNN D;  4KGC B;  5B2I D;  4YM6 C;  1S32 D;  4HGA C;  3O62 D;  3EPL A;  3REI C;  3C1C B;  3H0M C;  5B33 A;  3UTA C;  5JA4 A;  3WKJ D;  3AZL C;  2YFW B;  2FJ7 B;  5C3I C;  5AV5 C;  1M19 B;  3MVD D;  3AZM C;  3REK C;  4WU9 A;  2Y2G A;  2YFV B;  4EO5 C;  3A1I A;  4H9Q A;  1P3I C;  1ZLA B;  5CPJ C;  5AY8 A;  5B31 C;  1ID3 B;  3A6N D;  3X1S B;  3AV1 C;  5CPI C;  3UTB B;  3LJA A;  5B1M A;  3B6G A;  1P3G B;  1TAF A;  2ARO C;  3KUY D;  2RVQ C;  4XZQ D;  5GXQ C;  5B31 G;  4XUJ C;  3X1T A;  1R4V A;  3B6F D;  3WA9 C;  2Y2Q A;  5CP6 B;  3W99 B;  2Y2M A;  5GT0 C;  3EPK A;  1P34 D;  3MGQ A;  3AZN B;  3AZF C;  5E5A C;  4YM6 A;  3VH5 A;  2XD5 A;  3REI A;  3WTP D;  3UTA A;  2BYM B;  5DNN B;  3AZL A;  3C1C C;  4KHA B;  4JJN D;  5AV5 A;  5B0Y D;  3AV2 D;  3H0L C;  4J8W D;  5BO0 A;  3AZM A;  3REK A;  2FJ7 C;  1KX3 D;  1M19 C;  1P3B C;  5JRG A;  5CPJ A;  5B31 A;  2Y2J A;  3W96 B;  3REH B;  1H3O B;  5B32 B;  1BH8 A;  2NZD D;  3AV1 A;  3VH5 W;  1F66 D;  4LD9 B;  4J8U D;  2DQN C;  2ARO A;  1ZLA C;  2PYO D;  3C1B C;  5GXQ A;  3X1S C;  4XUJ A;  3MGS D;  2CV5 D;  3UTB C;  2F2A C;  3B0C T;  3NQJ A;  3WA9 A;  3W98 C;  1P3G C;  4CAY A;  3X1U B;  5GT0 A;  1P3L B;  4H9O A;  4WZS B;  3AZF A;  4H9P B;  5E5A A;  5DNM D;  5CP6 C;  3W99 C;  3VH5 T;  5BNV A;  3MNN B;  5B2I B;  2Y2H A;  1S32 B;  3O62 B;  3W97 D;  3VH6 A;  4KGC A;  4X23 D;  3AZN C;  4WV4 B;  2ZM5 A;  3KXB D;  3C1C A;  3WKJ B;  1HTA A;  4WNN B;  5DNN C;  2YFW A;  2FJ7 A;  3REJ D;  3MVD B;  1M19 A;  2BYK B;  5AV6 D;  1BH9 B;  2YFV A;  5B24 D;  3V9R B;  3A6N B;  1ZLA A;  1ID3 A;  3W96 C;  3REH C;  3C1B A;  5B32 C;  3F6T A;  3X1S A;  5FUG B;  3KUY B;  3UTB A;  4LD9 C;  3W98 A;  3LEL D;  1P3G A;  4XZQ B;  3KFU G;  5AVB D;  5CP6 A;  3X1U C;  1P34 B;  3W99 A;  3AZI D;  2IO5 B;  1P3L C;  2RIQ A;  3AZN A;  3WTP B;  2JSS A;  3P5J B;  3MNN C;  1M18 D;  2BYM A;  2J8P A;  2JE5 A;  5B2I C;  1S32 C;  3O62 C;  4Z5T B;  5DNN A;  4JJN B;  5B0Y B;  4R8P D;  3AV2 B;  4J8W B;  3WKJ C;  4YS3 D;  1KX3 B;  1B6W A;  3MVD C;  3WAA D;  3W96 A;  3REH A;  5B32 A;  4Z66 D;  1F66 B;  4J8U B;  2PYO B;  1KX5 D;  4LD9 A;  3A6N C;  4NE6 A;  2CV5 B;  3MGS B;  2F8N D;  3KUY C;  4XZQ C;  3X1U A;  5GSU D;  1P3L A;  5DNM B;  3IP4 C;  2Y2K A;  4H9P A;  1TZY D;  1KU5 A;  4WU8 D;  3W97 B;  1P34 C;  3MNN A;  5B2I A;  2IO5 C;  4X23 B;  1S32 A;  3O62 A;  3KXB B;  3WTP C;  5CPK D;  2W8S A;  4J8V D;  3WKJ A;  5B1L D;  4NFT A;  1N1J B;  2DF4 C;  4WNN A;  4Z5T C;  3REJ B;  3LZ1 D;  4JJN C;  2ZY3 A;  5JRG C;  5B0Y C;  3AV2 C;  4J8W C;  3MVD A;  1P3O D;  5AV6 B;  2BYK A;  1KX3 C;  5B40 D;  3REL D;  3AFA D;  1JFI B;  5B24 B;  1BH9 A;  5BT1 D;  2F8N H;  3V9R A;  3A6N A;  4WU9 D;  3AZE D;  5KDM B;  3EPH A;  3LEL B;  4J8U C;  5FUG A;  3KUY A;  4UPK A;  4J8X C;  2NQB B;  4XZQ A;  5AVB B;  4G92 B;  2CV5 C;  3MGS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...