5B2IA

Human nucleosome containing cpg unmethylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iA00
4JJNC 3AZJD 3REHB 3AZNC 2NZDC 4WU8D 4J8VA 1P3IB 4H9QA 3AZIA 2AROD 5B24D 1EQZD 3REJD 1TAFA 1R4VA 3NQJB 3W97A 2YFWB 3AYWB 3REHC 3MNNA 2AROB 1P3OD 1N1JA 4J8XD 1EQZB 3RELB 4H9NB 5BS7A 1BH8B 3TU4D 5GT3D 5CPIA 4J8WC 1P3OB 3LJAC 5AV9C 1KX5C 4HGAB 4H9SA 3A6ND 3AYWC 3AZGD 5B31C 5B2IB 5GT3B 5GT0D 3RELC 5B40B 4XUJD 3A6NB 3X1SA 4JJNA 5DNMB 3AZGB 2NQBD 1ID3D 1F1EA 5GT0B 2NZDA 4HGAC 5B2IC 4XUJB 2NQBB 4ZUXD 3V9RA 3KWQD 5F99C 5B40C 3LZ0D 5E5AA 5DNMC 1S32C 5AVCB 4ZUXB 3REHA 1P3PB 1Q9CA 4E44A 3UTBB 3AZED 1P3IA 4ZBJC 1ZLAB 4Z2MG 1M19D 5B32C 3AZKD 4LD9B 4X23C 1P3LC 3NQJA 2YFWA 5AVCC 1P3PC 5B1MD 2AROA 5B24A 3UTBC 1EQZA 4QLCB 4H9NA 3RELA 3AZKB 1ZLAC 4H9OA 3VH6A 1BH8A 5B0YD 5B1MB 4LD9C 3KSYA 1P3OA 2IO5B 1TZYB 5B2IA 3C1CD 3X1VD 5GT3A 2JSSA 3WTPB 4Z5TB 1P3GD 5B0YB 5B40A 3A6NA 3REKC 5DNMA 3AZGA 4WZSB 3X1VB 4KHAB 5GT0A 2IO5C 4YS3C 5B0ZC 1TZYC 4XUJA 5DNND 1AOID 4WV4B 3WTPC 4Z5TC 1KX3D 2NQBA 1P3MB 3W99D 4XZQC 5DNNB 1KX3B 4ZUXA 1P3PA 2F8ND 3UTBA 3W99B 5BNVB 3KXBB 4UUZB 1M1AB 1ZLAA 3WA9C 4KGCD 3REID 1P3MC 4WNNB 2F8NB 2BYMB 4LD9A 3REIB 3MVDD 4QLCA 3AZKA 3KXBC 5GSUD 3KUYB 4G92B 3AZHD 1M1AC 3B6GB 1HQ3D 5B1MA 4WU9D 3WKJD 3MVDB 5CPJD 5B2JD 5CPKD 1TZYA 1HQ3B 3WTPA 4Z5TA 4E45A 5JA4B 5B0YA 4WU9B 3WKJB 3UTAB 1M18D 5CPJB 3W96D 5CPKB 3X1VA 4KHAA 4Z2MH 3W97C 3WAAD 1KX4B 3MNNC 3W96B 5BS7C 1HTAA 3UTAC 1P34B 2HIOB 1P3MA 3WAAB 5CPIC 1P3AD 5DNNA 3LZ1D 3LELB 1P3FB 1KX3A 5AVBB 4H9SC 1KX4C 3W99A 5BNVA 5B33B 4UUZA 5BO0B 5G49B 3KXBA 1M1AA 1P34C 2HIOC 4WNNA 3X1SC 2BYMA 2FJ7D 2F8NA 3B6FD 3LELC 3VH5T 5AVBC 3AV1B 3AV2D 3REIA 2FJ7B 3KUYA 5B33C 3B6GA 3AZJB 5E5AC 4WU8B 3MVDA 5AV8D 5GSUA 3AZHA 1JFIB 1HQ3A 5B24B 3AV1C 5JA4A 1P3IC 3REJB 4WU9A 4H9OB 4R8PD 3UTAA 4AWLB 3WKJA 5CPJA 5AV8B 3AZJC 5CPKA 2CV5D 4WU8C 2F8NG 4J8XB 2PYOD 3B0DB 1KX4A 3TU4B 3B0CT 2AROC 5B24C 3W96A 2CV5B 1EQZC 4AWLC 1P34A 2HIOA 2PYOB 3WAAA 3LELA 1P3OC 1P3FA 4J8XC 5AVBA 3AZLD 3TU4C 5GT3C 5B33A 5BO0A 5G49A 1ID3B 3LZ1A 2BYKB 3A6NC 3AZLB 3AZGC 3MGPD 5GT0C 1P3KD 3AZMD 3KWQB 3AV1A 4CSRB 4XUJC 3LZ0B 2FJ7A 1F66D 2NQBC 1ID3C 3AZJA 4J8UD 3AZMB 1ULYA 4WU8A 3AZEB 4ZUXC 1JFIA 3KWQC 4J8UB 1M19B 3WTPE 3LZ0C 5GXQD 3REJA 2F8NK 5AV8A 2LY8A 3NQUB 5B1LD 3AZEC 5BNXB 4J8XA 5GXQB 3TU4A 1M19C 5B1LB 4DRBA 2CV5A 4QLCC 3AZKC 5AV5D 2PYOA 3VH6W 3AN2D 3C1CB 3AFAD 5B1MC 1P3GB 5AV5B 3MGSD 1WWIA 5B0YC 1ID3A 2BYKA 4YM6D 3AZLA 5CP6D 3C1CC 3X1VC 1AOIB 3MGSB 1U35D 1P3GC 3KWQA 5AY8D 4YM6B 3C1BD 4CSRA 3O62D 3LZ0A 4Z66D 3AZMA 5AY8B 3AZEA 3C1BB 1P3BD 5DNNC 1AOIC 4KUDD 1KX3C 5BT1D 4Z66B 4KGCB 3X1UD 4J8UA 1M19A 3MGQD 3W99C 3MGRD 3UT9D 3NQUA 3X1TD 5BNXA 3MGQB 5GXQA 3AZHB 5GSUB 3R45A 5AV6D 3UT9B 4KGCC 5CHLB 5B1LA 3REIC 3KUYC 4G92C 3VH5A 3B6GC 5B2JB 5AV6B 3C1CA 4J8VD 3AZID 1P3GA 3MVDC 3AZHC 5AV5A 5GSUC 3W98D 1M18B 1HQ3C 4NE6A 5JRGD 4WU9C 3WKJC 5FUGB 5CPJC 3W98B 3VH5W 5B2JC 3AZFD 5CPKC 1AOIA 3MGSA 4NFTA 1H3OB 5JRGB 4YM6A 1M18C 1P3AB 3W96C 5CP6A 3LZ1B 5KDMB 3WAAC 5AY8A 3C1BA 3O62A 2RVQD 4G91B 1P3FC 4Z66A 1KU5A 4KGCA 4JJND 1P3AC 3AZND 1P3BA 3B6FB 3LZ1C 2NZDD 4NE5A 4KUDA 3AV2B 3B0CW 3MGQA 4G91C 3AZNB 3UT9A 1BFMA 2FJ7C 3REHD 3B6FC 5B2JA 5AV6A 3AV2C 4R8PB 1M18A 4J8WD 3LJAD 4CAYB 4H9RB 5AV9D 1KX5D 3REJC 3AYWD 5B31D 5FUGA 5AV8C 3W98A 4H9PB 4J8WB 3RELD 3LJAB 1WWSA 1B67A 1H3OA 3B0DC 5AV9B 5JRGA 4R8PC 1KX5B 5B31B 3B0BA 1P3AA 3AZFA 2CV5C 5KDMA 2PYOC 5B2ID 4DRAA 2HUEB 5F99D 5B40D 5DNMD 1S32D 3MGPB 1P3KB 3B6FA 5F99B 5C3IB 3AZLC 3AV2A 1S32B 1F66B 2HUEC 3AZNA 5B32D 4X23D 1P3LD 4ZBJB 4EO5B 5AVCD 3MGPC 1P3PD 1P3KC 1B6WA 3AZMC 3UTBD 5C3IC 5B32B 1ZLAD 4X23B 1P3LB 4R8PA 1F66C 3R45B 4J8UC 4LD9D 4CAYA 4H9RA 1BH9B 4EO5C 1A7WA 4H9PA 4J8WA 4QLCD 3LJAA 5AV9A 1KX5A 5GXQC 3AYWA 3REKD 2YFVB 5B31A 5B1LC 3AN2B 4YS3D 3AFAB 5B0ZD 1TZYD 3REKB 3WTPD 4Z5TD 4YS3B 4XZQD 2F8NH 5AV5C 5B0ZB 4NE3A 5CP6B 3AN2C 3MGPA 3AFAC 1P3KA 1U35B 5F99A 4XZQB 3WA9D 3O62B 1S32A 1F66A 3MGSC 1P3MD 4YM6C 5B31G 5CP6C 1P3BB 3WA9B 4KUDB 1U35C 5B32A 5AY8C 3X1UB 3KXBD 4X23A 1P3LA 3C1BC 1M1AD 3O62C 3MGRB 3VH6T 5AVCA 4Z66C 3X1TB 1BH9A 1P3BC 4KUDC 5BT1C 3X1UC 3KUYD 3MGQC 3B6GD 3MGRC 3UT9C 2YFVA 3AN2A 4J8VB 4H9QB 3AFAA 3X1TC 3W97D 3AZIB 3MNND 3REKA 5AV6C 5B32G 1TAFB 3UTAD 4YS3A 3W97B 5CPID 5B0ZA 3MNNB 3AZFB 1N1JB 4J8VC 1U35A 3AZIC 1KX4D 4XZQA 3W98C 5CPIB 1P34D 2HIOD 2L5AA 5JRGC 3X1SD 3LELD 3AZFC 1P3FD 3WA9A 5AVBD 2CWEA 3X1SB 3X1UA 5B33D 4JJNB 3MGRA 4M6BA 2NZDB 5E5AD 3X1TA 3V9RB 2RVQC 3AV1D 1P3ID 5E5AB
chains in the Genus database with same CATH superfamily
4JJNC 3AZJD 3REHB 3AZNC 1W2EA 2NZDC 4WU8D 4J8VA 1P3IB 4H9QA 3AZIA 2AROD 5B24D 2J8PA 1EQZD 3REJD 1TAFA 3EPKA 1R4VA 3NQJB 3W97A 2YFWB 3AYWB 3REHC 3MNNA 2AROB 1P3OD 1N1JA 4J8XD 1EQZB 3RELB 4H9NB 5BS7A 1BH8B 3TU4D 5GT3D 5CPIA 4J8WC 1P3OB 3LJAC 5AV9C 1KX5C 4HGAB 4H9SA 3A6ND 3AYWC 3AZGD 5B31C 5B2IB 5GT3B 5GT0D 3RELC 5B40B 4XUJD 3A6NB 3X1SA 2DF4C 5DNMB 4JJNA 3AZGB 2NQBD 1ID3D 1F1EA 5GT0B 3AL0C 2NZDA 4HGAC 5B2IC 4XUJB 2NQBB 4ZUXD 3V9RA 3KWQD 5F99C 5B40C 3LZ0D 5E5AA 5DNMC 1S32C 5AVCB 4ZUXB 3REHA 1P3PB 1Q9CA 4E44A 3UTBB 3AZED 1P3IA 4ZBJC 2Y2QA 1ZLAB 2Y2MA 4Z2MG 1M19D 5B32C 3AZKD 4LD9B 4X23C 1P3LC 3NQJA 2YFWA 5AVCC 1P3PC 5B1MD 2AROA 5B24A 3UTBC 1EQZA 4QLCB 4H9NA 3RELA 3AZKB 1ZLAC 4H9OA 3VH6A 1BH8A 5B0YD 5B1MB 4LD9C 3KSYA 1P3OA 2IO5B 1TZYB 5B2IA 3C1CD 3X1VD 5GT3A 2JSSA 3WTPB 4Z5TB 1P3GD 5B0YB 5B40A 3A6NA 3REKC 5DNMA 3AZGA 4WZSB 3X1VB 4KHAB 5GT0A 2IO5C 4YS3C 5B0ZC 1TZYC 4XUJA 5DNND 4UPKA 1AOID 4WV4B 2Y2JA 4Z5TC 3WTPC 1KX3D 2NQBA 2Y2NA 1P3MB 3A1KA 3W99D 4XZQC 5DNNB 1KX3B 4ZUXA 1P3PA 2F8ND 3UTBA 3W99B 5BNVB 3KXBB 4UUZB 1M1AB 1ZLAA 3WA9C 3H0LC 4KGCD 3REID 1P3MC 4WNNB 2F8NB 2BYMB 4LD9A 2JCHA 3REIB 3MVDD 4QLCA 3AZKA 3KXBC 5GSUD 3KUYB 4G92B 3AZHD 1M1AC 3B6GB 1HQ3D 2BG1A 5B1MA 4WU9D 3WKJD 3MVDB 5CPJD 5B2JD 5CPKD 1TZYA 1HQ3B 3EPLA 3WTPA 4Z5TA 4E45A 5JA4B 5B0YA 4WU9B 3WKJB 3UTAB 1M18D 5CPJB 3W96D 5CPKB 3X1VA 4KHAA 4Z2MH 3W97C 3WAAD 2Y2GA 1KX4B 3MNNC 3W96B 5BS7C 1HTAA 3UTAC 1P34B 2HIOB 1P3MA 3WAAB 5CPIC 1P3AD 5DNNA 3LZ1D 3LELB 1P3FB 1KX3A 5AVBB 4H9SC 1KX4C 3W99A 5BNVA 5B33B 4UUZA 5BO0B 5G49B 3KXBA 1M1AA 1P34C 2HIOC 4WNNA 3X1SC 2BYMA 2FJ7D 2F8NA 3B6FD 3LELC 3VH5T 5AVBC 3AV1B 3AV2D 3REIA 2FJ7B 3KUYA 5B33C 3B6GA 3AZJB 5E5AC 4WU8B 3MVDA 5AV8D 1T3UA 5GSUA 3AZHA 1JFIB 1HQ3A 5B24B 3AV1C 5JA4A 1P3IC 3REJB 4WU9A 4H9OB 4R8PD 3UTAA 4AWLB 3WKJA 5CPJA 5AV8B 3AZJC 5CPKA 2CV5D 4WU8C 2F8NG 4J8XB 2PYOD 3EG5B 3B0DB 1Z2CB 1KX4A 3TU4B 3B0CT 2AROC 5B24C 3W96A 2CV5B 1EQZC 4AWLC 1P34A 2HIOA 2PYOB 3WAAA 2Y2LA 3LELA 1P3OC 1P3FA 4J8XC 5AVBA 3AZLD 3TU4C 5GT3C 5B33A 5BO0A 5G49A 1ID3B 3LZ1A 2BYKB 2VQRA 3A6NC 2G5HC 3AZLB 3AZGC 3MGPD 5GT0C 1P3KD 2Y2IA 3AZMD 3KWQB 3AV1A 4CSRB 4XUJC 3LZ0B 2FJ7A 1F66D 2NQBC 1ID3C 3AZJA 4J8UD 3AZMB 1ULYA 4WU8A 3AZEB 4ZUXC 1JFIA 3KWQC 4J8UB 1M19B 3WTPE 3LZ0C 5GXQD 3REJA 2F8NK 2G5IC 2FFFB 5AV8A 2LY8A 3NQUB 5B1LD 3AZEC 5BNXB 4J8XA 5GXQB 3TU4A 1M19C 5B1LB 4DRBA 2CV5A 4QLCC 3AZKC 5AV5D 2PYOA 3VH6W 3AN2D 3C1CB 3AFAD 5B1MC 1P3GB 5AV5B 3P5JB 3MGSD 1WWIA 5B0YC 1ID3A 2BYKA 4YM6D 3AZLA 5CP6D 3C1CC 3X1VC 1AOIB 3MGSB 2RIQA 1U35D 1P3GC 3KFUG 3KWQA 5AY8D 4YM6B 3C1BD 4CSRA 2Y2HA 3O62D 3LZ0A 4Z66D 3AZMA 5AY8B 3AZEA 3C1BB 1P3BD 5DNNC 1AOIC 4KUDD 1KX3C 5BT1D 4DQYB 4Z66B 2W8SA 4KGCB 3X1UD 4J8UA 1M19A 4WJ3C 3MGQD 3W99C 3MGRD 3UT9D 3NQUA 3X1TD 5BNXA 3MGQB 5GXQA 3AZHB 5GSUB 3R45A 5AV6D 3UT9B 4KGCC 3IP4C 5CHLB 5B1LA 3REIC 3KUYC 4G92C 3VH5A 2XD5A 3B6GC 5B2JB 5AV6B 3C1CA 4J8VD 3AZID 1P3GA 3MVDC 3AZHC 5AV5A 5GSUC 3W98D 1M18B 1HQ3C 4NE6A 2ZY5A 5JRGD 4WU9C 3WKJC 5FUGB 5CPJC 3W98B 3VH5W 5B2JC 3AZFD 5CPKC 1AOIA 3MGSA 4NFTA 1H3OB 5JRGB 4YM6A 1M18C 1P3AB 3W96C 5CP6A 3LZ1B 5KDMB 3WAAC 5AY8A 3C1BA 3O62A 2RVQD 4G91B 1P3FC 4Z66A 1KU5A 4KGCA 4JJND 3FDDA 1P3AC 3AZND 1P3BA 3B6FB 3LZ1C 2NZDD 4NE5A 4KUDA 3AV2B 3B0CW 3MGQA 4G91C 3AZNB 3UT9A 1BFMA 2FJ7C 3REHD 3H0RC 3B6FC 5B2JA 5AV6A 3AV2C 4R8PB 1M18A 4J8WD 3LJAD 4CAYB 4H9RB 5AV9D 1KX5D 3REJC 3AYWD 5B31D 5FUGA 5AV8C 3W98A 4H9PB 4J8WB 3RELD 3LJAB 1WWSA 1B67A 1H3OA 3B0DC 5AV9B 5JRGA 4R8PC 1KX5B 5B31B 3B0BA 1P3AA 3AZFA 2CV5C 5KDMA 2PYOC 5B2ID 4DRAA 2HUEB 5F99D 5B40D 5DNMD 1S32D 3A1IA 3MGPB 1P3KB 3B6FA 5F99B 5C3IB 3AZLC 3AV2A 1S32B 1F66B 2HUEC 3AZNA 5B32D 4X23D 1P3LD 4ZBJB 4EO5B 2JE5A 5AVCD 3MGPC 1P3PD 1P3KC 1B6WA 3AZMC 3UTBD 3H0MC 5C3IC 5B32B 1ZLAD 4X23B 1P3LB 2XD1A 4R8PA 2Y2KA 3R45B 1F66C 4J8UC 4LD9D 4CAYA 4H9RA 1BH9B 4EO5C 1A7WA 2ZY4A 4H9PA 4J8WA 4QLCD 2ZY3A 3LJAA 5AV9A 1KX5A 5GXQC 3AYWA 2Y2OA 3REKD 2YFVB 5B31A 5B1LC 3AN2B 4YS3D 3AFAB 5B0ZD 1TZYD 3REKB 1PZRA 4Z5TD 3WTPD 3EPJA 2ZY2A 4YS3B 4XZQD 2F8NH 5AV5C 5B0ZB 4NE3A 5CP6B 3AN2C 3MGPA 3AFAC 1P3KA 1U35B 5F99A 4XZQB 3WA9D 3O62B 1S32A 1F66A 3MGSC 1P3MD 2DQNC 4YM6C 5B31G 5CP6C 1P3BB 3WA9B 4KUDB 1U35C 5B32A 5AY8C 3X1UB 3KXBD 4X23A 1P3LA 3C1BC 1M1AD 3O62C 3MGRB 3VH6T 5AVCA 4Z66C 3X1TB 1BH9A 1P3BC 4KUDC 5BT1C 3X1UC 3KUYD 3MGQC 3B6GD 3MGRC 3UT9C 2YFVA 3AN2A 4J8VB 4H9QB 3AFAA 3X1TC 3W97D 3AZIB 3MNND 3REKA 5AV6C 5B32G 1TAFB 3UTAD 4YS3A 3W97B 5CPID 5B0ZA 3EPHA 3MNNB 3AZFB 1N1JB 4J8VC 1U35A 3AZIC 1KX4D 4XZQA 3W98C 5CPIB 1P34D 5JRGC 2HIOD 2L5AA 3X1SD 2UWXA 2Y2PA 3LELD 3AZFC 1P3FD 3WA9A 5AVBD 2CWEA 3X1SB 3X1UA 3F6TA 5B33D 4JJNB 3MGRA 4M6BA 2NZDB 5E5AD 2F2AC 3X1TA 2ZM5A 3V9RB 2RVQC 3AV1D 1P3ID 5E5AB
chains in the Genus database with same CATH topology
4JJNC 3AZJD 3REHB 3AZNC 1W2EA 2NZDC 4WU8D 4J8VA 1P3IB 4H9QA 3AZIA 2AROD 5B24D 2J8PA 1EQZD 3REJD 1TAFA 3EPKA 1R4VA 3NQJB 3W97A 2YFWB 3AYWB 3REHC 3MNNA 2AROB 1P3OD 1N1JA 4J8XD 1EQZB 3RELB 4H9NB 5BS7A 1BH8B 3TU4D 5GT3D 5CPIA 4J8WC 1P3OB 3LJAC 5AV9C 1KX5C 4HGAB 4H9SA 3A6ND 3AYWC 3AZGD 5B31C 5B2IB 5GT3B 5GT0D 3RELC 5B40B 4XUJD 3A6NB 3X1SA 2DF4C 5DNMB 4JJNA 3AZGB 2NQBD 1ID3D 1F1EA 5GT0B 3AL0C 2NZDA 4HGAC 5B2IC 4XUJB 2NQBB 4ZUXD 3V9RA 3KWQD 5F99C 5B40C 3LZ0D 5E5AA 5DNMC 1S32C 5AVCB 4ZUXB 3REHA 1P3PB 1Q9CA 4E44A 3UTBB 3AZED 1P3IA 4ZBJC 2Y2QA 1ZLAB 2Y2MA 4Z2MG 1M19D 5B32C 3AZKD 4LD9B 4X23C 1P3LC 3NQJA 2YFWA 5AVCC 1P3PC 5B1MD 2AROA 5B24A 3UTBC 1EQZA 4QLCB 4H9NA 3RELA 3AZKB 1ZLAC 4H9OA 3VH6A 1BH8A 5B0YD 5B1MB 4LD9C 3KSYA 1P3OA 2IO5B 1TZYB 5B2IA 3C1CD 3X1VD 5GT3A 2JSSA 3WTPB 4Z5TB 1P3GD 5B0YB 5B40A 3A6NA 3REKC 5DNMA 3AZGA 4WZSB 3X1VB 4KHAB 5GT0A 2IO5C 4YS3C 5B0ZC 1TZYC 4XUJA 5DNND 4UPKA 1AOID 4WV4B 2Y2JA 4Z5TC 3WTPC 1KX3D 2NQBA 2Y2NA 1P3MB 3A1KA 3W99D 4XZQC 5DNNB 1KX3B 4ZUXA 1P3PA 2F8ND 3UTBA 3W99B 5BNVB 3KXBB 4UUZB 1M1AB 1ZLAA 3WA9C 3H0LC 4KGCD 3REID 1P3MC 4WNNB 2F8NB 2BYMB 4LD9A 2JCHA 3REIB 3MVDD 4QLCA 3AZKA 3KXBC 5GSUD 3KUYB 4G92B 3AZHD 1M1AC 3B6GB 1HQ3D 2BG1A 5B1MA 4WU9D 3WKJD 3MVDB 5CPJD 5B2JD 5CPKD 1TZYA 1HQ3B 3EPLA 3WTPA 4Z5TA 4E45A 5JA4B 5B0YA 4WU9B 3WKJB 3UTAB 1M18D 5CPJB 3W96D 5CPKB 3X1VA 4KHAA 4Z2MH 3W97C 3WAAD 2Y2GA 1KX4B 3MNNC 3W96B 5BS7C 1HTAA 3UTAC 1P34B 2HIOB 1P3MA 3WAAB 5CPIC 1P3AD 5DNNA 3LZ1D 3LELB 1P3FB 1KX3A 5AVBB 4H9SC 1KX4C 3W99A 5BNVA 5B33B 4UUZA 5BO0B 5G49B 3KXBA 1M1AA 1P34C 2HIOC 4WNNA 3X1SC 2BYMA 2FJ7D 2F8NA 3B6FD 3LELC 3VH5T 5AVBC 3AV1B 3AV2D 3REIA 2FJ7B 3KUYA 5B33C 3B6GA 3AZJB 5E5AC 4WU8B 3MVDA 5AV8D 1T3UA 5GSUA 3AZHA 1JFIB 1HQ3A 5B24B 3AV1C 5JA4A 1P3IC 3REJB 4WU9A 4H9OB 4R8PD 3UTAA 4AWLB 3WKJA 5CPJA 5AV8B 3AZJC 5CPKA 2CV5D 4WU8C 2F8NG 4J8XB 2PYOD 3EG5B 3B0DB 1Z2CB 1KX4A 3TU4B 3B0CT 2AROC 5B24C 3W96A 2CV5B 1EQZC 4AWLC 1P34A 2HIOA 2PYOB 3WAAA 2Y2LA 3LELA 1P3OC 1P3FA 4J8XC 5AVBA 3AZLD 3TU4C 5GT3C 5B33A 5BO0A 5G49A 1ID3B 3LZ1A 2BYKB 2VQRA 3A6NC 2G5HC 3AZLB 3AZGC 3MGPD 5GT0C 1P3KD 2Y2IA 3AZMD 3KWQB 3AV1A 4CSRB 4XUJC 3LZ0B 2FJ7A 1F66D 2NQBC 1ID3C 3AZJA 4J8UD 3AZMB 1ULYA 4WU8A 3AZEB 4ZUXC 1JFIA 3KWQC 4J8UB 1M19B 3WTPE 3LZ0C 5GXQD 3REJA 2F8NK 2G5IC 2FFFB 5AV8A 2LY8A 3NQUB 5B1LD 3AZEC 5BNXB 4J8XA 5GXQB 3TU4A 1M19C 5B1LB 4DRBA 2CV5A 4QLCC 3AZKC 5AV5D 2PYOA 3VH6W 3AN2D 3C1CB 3AFAD 5B1MC 1P3GB 5AV5B 3P5JB 3MGSD 1WWIA 5B0YC 1ID3A 2BYKA 4YM6D 3AZLA 5CP6D 3C1CC 3X1VC 1AOIB 3MGSB 2RIQA 1U35D 1P3GC 3KFUG 3KWQA 5AY8D 4YM6B 3C1BD 4CSRA 2Y2HA 3O62D 3LZ0A 4Z66D 3AZMA 5AY8B 3AZEA 3C1BB 1P3BD 5DNNC 1AOIC 4KUDD 1KX3C 5BT1D 4DQYB 4Z66B 2W8SA 4KGCB 3X1UD 4J8UA 1M19A 4WJ3C 3MGQD 3W99C 3MGRD 3UT9D 3NQUA 3X1TD 5BNXA 3MGQB 5GXQA 3AZHB 5GSUB 3R45A 5AV6D 3UT9B 4KGCC 3IP4C 5CHLB 5B1LA 3REIC 3KUYC 4G92C 3VH5A 2XD5A 3B6GC 5B2JB 5AV6B 3C1CA 4J8VD 3AZID 1P3GA 3MVDC 3AZHC 5AV5A 5GSUC 3W98D 1M18B 1HQ3C 4NE6A 2ZY5A 5JRGD 4WU9C 3WKJC 5FUGB 5CPJC 3W98B 3VH5W 5B2JC 3AZFD 5CPKC 1AOIA 3MGSA 4NFTA 1H3OB 5JRGB 4YM6A 1M18C 1P3AB 3W96C 5CP6A 3LZ1B 5KDMB 3WAAC 5AY8A 3C1BA 3O62A 2RVQD 4G91B 1P3FC 4Z66A 1KU5A 4KGCA 4JJND 3FDDA 1P3AC 3AZND 1P3BA 3B6FB 3LZ1C 2NZDD 4NE5A 4KUDA 3AV2B 3B0CW 3MGQA 4G91C 3AZNB 3UT9A 1BFMA 2FJ7C 3REHD 3H0RC 3B6FC 5B2JA 5AV6A 3AV2C 4R8PB 1M18A 4J8WD 3LJAD 4CAYB 4H9RB 5AV9D 1KX5D 3REJC 3AYWD 5B31D 5FUGA 5AV8C 3W98A 4H9PB 4J8WB 3RELD 3LJAB 1WWSA 1B67A 1H3OA 3B0DC 5AV9B 5JRGA 4R8PC 1KX5B 5B31B 3B0BA 1P3AA 3AZFA 2CV5C 5KDMA 2PYOC 5B2ID 4DRAA 2HUEB 5F99D 5B40D 5DNMD 1S32D 3A1IA 3MGPB 1P3KB 3B6FA 5F99B 5C3IB 3AZLC 3AV2A 1S32B 1F66B 2HUEC 3AZNA 5B32D 4X23D 1P3LD 4ZBJB 4EO5B 2JE5A 5AVCD 3MGPC 1P3PD 1P3KC 1B6WA 3AZMC 3UTBD 3H0MC 5C3IC 5B32B 1ZLAD 4X23B 1P3LB 2XD1A 4R8PA 2Y2KA 3R45B 1F66C 4J8UC 4LD9D 4CAYA 4H9RA 1BH9B 4EO5C 1A7WA 2ZY4A 4H9PA 4J8WA 4QLCD 2ZY3A 3LJAA 5AV9A 1KX5A 5GXQC 3AYWA 2Y2OA 3REKD 2YFVB 5B31A 5B1LC 3AN2B 4YS3D 3AFAB 5B0ZD 1TZYD 3REKB 1PZRA 4Z5TD 3WTPD 3EPJA 2ZY2A 4YS3B 4XZQD 2F8NH 5AV5C 5B0ZB 4NE3A 5CP6B 3AN2C 3MGPA 3AFAC 1P3KA 1U35B 5F99A 4XZQB 3WA9D 3O62B 1S32A 1F66A 3MGSC 1P3MD 2DQNC 4YM6C 5B31G 5CP6C 1P3BB 3WA9B 4KUDB 1U35C 5B32A 5AY8C 3X1UB 3KXBD 4X23A 1P3LA 3C1BC 1M1AD 3O62C 3MGRB 3VH6T 5AVCA 4Z66C 3X1TB 1BH9A 1P3BC 4KUDC 5BT1C 3X1UC 3KUYD 3MGQC 3B6GD 3MGRC 3UT9C 2YFVA 3AN2A 4J8VB 4H9QB 3AFAA 3X1TC 3W97D 3AZIB 3MNND 3REKA 5AV6C 5B32G 1TAFB 3UTAD 4YS3A 3W97B 5CPID 5B0ZA 3EPHA 3MNNB 3AZFB 1N1JB 4J8VC 1U35A 3AZIC 1KX4D 4XZQA 3W98C 5CPIB 1P34D 5JRGC 2HIOD 2L5AA 3X1SD 2UWXA 2Y2PA 3LELD 3AZFC 1P3FD 3WA9A 5AVBD 2CWEA 3X1SB 3X1UA 3F6TA 5B33D 4JJNB 3MGRA 4M6BA 2NZDB 5E5AD 2F2AC 3X1TA 2ZM5A 3V9RB 2RVQC 3AV1D 1P3ID 5E5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN C;  3AZJ D;  3REH B;  3AZN C;  2NZD C;  4WU8 D;  4J8V A;  1P3I B;  4H9Q A;  3AZI A;  2ARO D;  5B24 D;  1EQZ D;  3REJ D;  1TAF A;  1R4V A;  3NQJ B;  3W97 A;  2YFW B;  3AYW B;  3REH C;  3MNN A;  2ARO B;  1P3O D;  1N1J A;  4J8X D;  1EQZ B;  3REL B;  4H9N B;  5BS7 A;  1BH8 B;  3TU4 D;  5GT3 D;  5CPI A;  4J8W C;  1P3O B;  3LJA C;  5AV9 C;  1KX5 C;  4HGA B;  4H9S A;  3A6N D;  3AYW C;  3AZG D;  5B31 C;  5B2I B;  5GT3 B;  5GT0 D;  3REL C;  5B40 B;  4XUJ D;  3A6N B;  3X1S A;  4JJN A;  5DNM B;  3AZG B;  2NQB D;  1ID3 D;  1F1E A;  5GT0 B;  2NZD A;  4HGA C;  5B2I C;  4XUJ B;  2NQB B;  4ZUX D;  3V9R A;  3KWQ D;  5F99 C;  5B40 C;  3LZ0 D;  5E5A A;  5DNM C;  1S32 C;  5AVC B;  4ZUX B;  3REH A;  1P3P B;  1Q9C A;  4E44 A;  3UTB B;  3AZE D;  1P3I A;  4ZBJ C;  1ZLA B;  4Z2M G;  1M19 D;  5B32 C;  3AZK D;  4LD9 B;  4X23 C;  1P3L C;  3NQJ A;  2YFW A;  5AVC C;  1P3P C;  5B1M D;  2ARO A;  5B24 A;  3UTB C;  1EQZ A;  4QLC B;  4H9N A;  3REL A;  3AZK B;  1ZLA C;  4H9O A;  3VH6 A;  1BH8 A;  5B0Y D;  5B1M B;  4LD9 C;  3KSY A;  1P3O A;  2IO5 B;  1TZY B;  5B2I A;  3C1C D;  3X1V D;  5GT3 A;  2JSS A;  3WTP B;  4Z5T B;  1P3G D;  5B0Y B;  5B40 A;  3A6N A;  3REK C;  5DNM A;  3AZG A;  4WZS B;  3X1V B;  4KHA B;  5GT0 A;  2IO5 C;  4YS3 C;  5B0Z C;  1TZY C;  4XUJ A;  5DNN D;  1AOI D;  4WV4 B;  3WTP C;  4Z5T C;  1KX3 D;  2NQB A;  1P3M B;  3W99 D;  4XZQ C;  5DNN B;  1KX3 B;  4ZUX A;  1P3P A;  2F8N D;  3UTB A;  3W99 B;  5BNV B;  3KXB B;  4UUZ B;  1M1A B;  1ZLA A;  3WA9 C;  4KGC D;  3REI D;  1P3M C;  4WNN B;  2F8N B;  2BYM B;  4LD9 A;  3REI B;  3MVD D;  4QLC A;  3AZK A;  3KXB C;  5GSU D;  3KUY B;  4G92 B;  3AZH D;  1M1A C;  3B6G B;  1HQ3 D;  5B1M A;  4WU9 D;  3WKJ D;  3MVD B;  5CPJ D;  5B2J D;  5CPK D;  1TZY A;  1HQ3 B;  3WTP A;  4Z5T A;  4E45 A;  5JA4 B;  5B0Y A;  4WU9 B;  3WKJ B;  3UTA B;  1M18 D;  5CPJ B;  3W96 D;  5CPK B;  3X1V A;  4KHA A;  4Z2M H;  3W97 C;  3WAA D;  1KX4 B;  3MNN C;  3W96 B;  5BS7 C;  1HTA A;  3UTA C;  1P34 B;  2HIO B;  1P3M A;  3WAA B;  5CPI C;  1P3A D;  5DNN A;  3LZ1 D;  3LEL B;  1P3F B;  1KX3 A;  5AVB B;  4H9S C;  1KX4 C;  3W99 A;  5BNV A;  5B33 B;  4UUZ A;  5BO0 B;  5G49 B;  3KXB A;  1M1A A;  1P34 C;  2HIO C;  4WNN A;  3X1S C;  2BYM A;  2FJ7 D;  2F8N A;  3B6F D;  3LEL C;  3VH5 T;  5AVB C;  3AV1 B;  3AV2 D;  3REI A;  2FJ7 B;  3KUY A;  5B33 C;  3B6G A;  3AZJ B;  5E5A C;  4WU8 B;  3MVD A;  5AV8 D;  5GSU A;  3AZH A;  1JFI B;  1HQ3 A;  5B24 B;  3AV1 C;  5JA4 A;  1P3I C;  3REJ B;  4WU9 A;  4H9O B;  4R8P D;  3UTA A;  4AWL B;  3WKJ A;  5CPJ A;  5AV8 B;  3AZJ C;  5CPK A;  2CV5 D;  4WU8 C;  2F8N G;  4J8X B;  2PYO D;  3B0D B;  1KX4 A;  3TU4 B;  3B0C T;  2ARO C;  5B24 C;  3W96 A;  2CV5 B;  1EQZ C;  4AWL C;  1P34 A;  2HIO A;  2PYO B;  3WAA A;  3LEL A;  1P3O C;  1P3F A;  4J8X C;  5AVB A;  3AZL D;  3TU4 C;  5GT3 C;  5B33 A;  5BO0 A;  5G49 A;  1ID3 B;  3LZ1 A;  2BYK B;  3A6N C;  3AZL B;  3AZG C;  3MGP D;  5GT0 C;  1P3K D;  3AZM D;  3KWQ B;  3AV1 A;  4CSR B;  4XUJ C;  3LZ0 B;  2FJ7 A;  1F66 D;  2NQB C;  1ID3 C;  3AZJ A;  4J8U D;  3AZM B;  1ULY A;  4WU8 A;  3AZE B;  4ZUX C;  1JFI A;  3KWQ C;  4J8U B;  1M19 B;  3WTP E;  3LZ0 C;  5GXQ D;  3REJ A;  2F8N K;  5AV8 A;  2LY8 A;  3NQU B;  5B1L D;  3AZE C;  5BNX B;  4J8X A;  5GXQ B;  3TU4 A;  1M19 C;  5B1L B;  4DRB A;  2CV5 A;  4QLC C;  3AZK C;  5AV5 D;  2PYO A;  3VH6 W;  3AN2 D;  3C1C B;  3AFA D;  5B1M C;  1P3G B;  5AV5 B;  3MGS D;  1WWI A;  5B0Y C;  1ID3 A;  2BYK A;  4YM6 D;  3AZL A;  5CP6 D;  3C1C C;  3X1V C;  1AOI B;  3MGS B;  1U35 D;  1P3G C;  3KWQ A;  5AY8 D;  4YM6 B;  3C1B D;  4CSR A;  3O62 D;  3LZ0 A;  4Z66 D;  3AZM A;  5AY8 B;  3AZE A;  3C1B B;  1P3B D;  5DNN C;  1AOI C;  4KUD D;  1KX3 C;  5BT1 D;  4Z66 B;  4KGC B;  3X1U D;  4J8U A;  1M19 A;  3MGQ D;  3W99 C;  3MGR D;  3UT9 D;  3NQU A;  3X1T D;  5BNX A;  3MGQ B;  5GXQ A;  3AZH B;  5GSU B;  3R45 A;  5AV6 D;  3UT9 B;  4KGC C;  5CHL B;  5B1L A;  3REI C;  3KUY C;  4G92 C;  3VH5 A;  3B6G C;  5B2J B;  5AV6 B;  3C1C A;  4J8V D;  3AZI D;  1P3G A;  3MVD C;  3AZH C;  5AV5 A;  5GSU C;  3W98 D;  1M18 B;  1HQ3 C;  4NE6 A;  5JRG D;  4WU9 C;  3WKJ C;  5FUG B;  5CPJ C;  3W98 B;  3VH5 W;  5B2J C;  3AZF D;  5CPK C;  1AOI A;  3MGS A;  4NFT A;  1H3O B;  5JRG B;  4YM6 A;  1M18 C;  1P3A B;  3W96 C;  5CP6 A;  3LZ1 B;  5KDM B;  3WAA C;  5AY8 A;  3C1B A;  3O62 A;  2RVQ D;  4G91 B;  1P3F C;  4Z66 A;  1KU5 A;  4KGC A;  4JJN D;  1P3A C;  3AZN D;  1P3B A;  3B6F B;  3LZ1 C;  2NZD D;  4NE5 A;  4KUD A;  3AV2 B;  3B0C W;  3MGQ A;  4G91 C;  3AZN B;  3UT9 A;  1BFM A;  2FJ7 C;  3REH D;  3B6F C;  5B2J A;  5AV6 A;  3AV2 C;  4R8P B;  1M18 A;  4J8W D;  3LJA D;  4CAY B;  4H9R B;  5AV9 D;  1KX5 D;  3REJ C;  3AYW D;  5B31 D;  5FUG A;  5AV8 C;  3W98 A;  4H9P B;  4J8W B;  3REL D;  3LJA B;  1WWS A;  1B67 A;  1H3O A;  3B0D C;  5AV9 B;  5JRG A;  4R8P C;  1KX5 B;  5B31 B;  3B0B A;  1P3A A;  3AZF A;  2CV5 C;  5KDM A;  2PYO C;  5B2I D;  4DRA A;  2HUE B;  5F99 D;  5B40 D;  5DNM D;  1S32 D;  3MGP B;  1P3K B;  3B6F A;  5F99 B;  5C3I B;  3AZL C;  3AV2 A;  1S32 B;  1F66 B;  2HUE C;  3AZN A;  5B32 D;  4X23 D;  1P3L D;  4ZBJ B;  4EO5 B;  5AVC D;  3MGP C;  1P3P D;  1P3K C;  1B6W A;  3AZM C;  3UTB D;  5C3I C;  5B32 B;  1ZLA D;  4X23 B;  1P3L B;  4R8P A;  1F66 C;  3R45 B;  4J8U C;  4LD9 D;  4CAY A;  4H9R A;  1BH9 B;  4EO5 C;  1A7W A;  4H9P A;  4J8W A;  4QLC D;  3LJA A;  5AV9 A;  1KX5 A;  5GXQ C;  3AYW A;  3REK D;  2YFV B;  5B31 A;  5B1L C;  3AN2 B;  4YS3 D;  3AFA B;  5B0Z D;  1TZY D;  3REK B;  3WTP D;  4Z5T D;  4YS3 B;  4XZQ D;  2F8N H;  5AV5 C;  5B0Z B;  4NE3 A;  5CP6 B;  3AN2 C;  3MGP A;  3AFA C;  1P3K A;  1U35 B;  5F99 A;  4XZQ B;  3WA9 D;  3O62 B;  1S32 A;  1F66 A;  3MGS C;  1P3M D;  4YM6 C;  5B31 G;  5CP6 C;  1P3B B;  3WA9 B;  4KUD B;  1U35 C;  5B32 A;  5AY8 C;  3X1U B;  3KXB D;  4X23 A;  1P3L A;  3C1B C;  1M1A D;  3O62 C;  3MGR B;  3VH6 T;  5AVC A;  4Z66 C;  3X1T B;  1BH9 A;  1P3B C;  4KUD C;  5BT1 C;  3X1U C;  3KUY D;  3MGQ C;  3B6G D;  3MGR C;  3UT9 C;  2YFV A;  3AN2 A;  4J8V B;  4H9Q B;  3AFA A;  3X1T C;  3W97 D;  3AZI B;  3MNN D;  3REK A;  5AV6 C;  5B32 G;  1TAF B;  3UTA D;  4YS3 A;  3W97 B;  5CPI D;  5B0Z A;  3MNN B;  3AZF B;  1N1J B;  4J8V C;  1U35 A;  3AZI C;  1KX4 D;  4XZQ A;  3W98 C;  5CPI B;  1P34 D;  2HIO D;  2L5A A;  5JRG C;  3X1S D;  3LEL D;  3AZF C;  1P3F D;  3WA9 A;  5AVB D;  2CWE A;  3X1S B;  3X1U A;  5B33 D;  4JJN B;  3MGR A;  4M6B A;  2NZD B;  5E5A D;  3X1T A;  3V9R B;  2RVQ C;  3AV1 D;  1P3I D;  5E5A B; 
#chains in the Genus database with same CATH topology
 4JJN C;  3AZJ D;  3REH B;  3AZN C;  1W2E A;  2NZD C;  4WU8 D;  4J8V A;  1P3I B;  4H9Q A;  3AZI A;  2ARO D;  5B24 D;  2J8P A;  1EQZ D;  3REJ D;  1TAF A;  3EPK A;  1R4V A;  3NQJ B;  3W97 A;  2YFW B;  3AYW B;  3REH C;  3MNN A;  2ARO B;  1P3O D;  1N1J A;  4J8X D;  1EQZ B;  3REL B;  4H9N B;  5BS7 A;  1BH8 B;  3TU4 D;  5GT3 D;  5CPI A;  4J8W C;  1P3O B;  3LJA C;  5AV9 C;  1KX5 C;  4HGA B;  4H9S A;  3A6N D;  3AYW C;  3AZG D;  5B31 C;  5B2I B;  5GT3 B;  5GT0 D;  3REL C;  5B40 B;  4XUJ D;  3A6N B;  3X1S A;  2DF4 C;  5DNM B;  4JJN A;  3AZG B;  2NQB D;  1ID3 D;  1F1E A;  5GT0 B;  3AL0 C;  2NZD A;  4HGA C;  5B2I C;  4XUJ B;  2NQB B;  4ZUX D;  3V9R A;  3KWQ D;  5F99 C;  5B40 C;  3LZ0 D;  5E5A A;  5DNM C;  1S32 C;  5AVC B;  4ZUX B;  3REH A;  1P3P B;  1Q9C A;  4E44 A;  3UTB B;  3AZE D;  1P3I A;  4ZBJ C;  2Y2Q A;  1ZLA B;  2Y2M A;  4Z2M G;  1M19 D;  5B32 C;  3AZK D;  4LD9 B;  4X23 C;  1P3L C;  3NQJ A;  2YFW A;  5AVC C;  1P3P C;  5B1M D;  2ARO A;  5B24 A;  3UTB C;  1EQZ A;  4QLC B;  4H9N A;  3REL A;  3AZK B;  1ZLA C;  4H9O A;  3VH6 A;  1BH8 A;  5B0Y D;  5B1M B;  4LD9 C;  3KSY A;  1P3O A;  2IO5 B;  1TZY B;  5B2I A;  3C1C D;  3X1V D;  5GT3 A;  2JSS A;  3WTP B;  4Z5T B;  1P3G D;  5B0Y B;  5B40 A;  3A6N A;  3REK C;  5DNM A;  3AZG A;  4WZS B;  3X1V B;  4KHA B;  5GT0 A;  2IO5 C;  4YS3 C;  5B0Z C;  1TZY C;  4XUJ A;  5DNN D;  4UPK A;  1AOI D;  4WV4 B;  2Y2J A;  4Z5T C;  3WTP C;  1KX3 D;  2NQB A;  2Y2N A;  1P3M B;  3A1K A;  3W99 D;  4XZQ C;  5DNN B;  1KX3 B;  4ZUX A;  1P3P A;  2F8N D;  3UTB A;  3W99 B;  5BNV B;  3KXB B;  4UUZ B;  1M1A B;  1ZLA A;  3WA9 C;  3H0L C;  4KGC D;  3REI D;  1P3M C;  4WNN B;  2F8N B;  2BYM B;  4LD9 A;  2JCH A;  3REI B;  3MVD D;  4QLC A;  3AZK A;  3KXB C;  5GSU D;  3KUY B;  4G92 B;  3AZH D;  1M1A C;  3B6G B;  1HQ3 D;  2BG1 A;  5B1M A;  4WU9 D;  3WKJ D;  3MVD B;  5CPJ D;  5B2J D;  5CPK D;  1TZY A;  1HQ3 B;  3EPL A;  3WTP A;  4Z5T A;  4E45 A;  5JA4 B;  5B0Y A;  4WU9 B;  3WKJ B;  3UTA B;  1M18 D;  5CPJ B;  3W96 D;  5CPK B;  3X1V A;  4KHA A;  4Z2M H;  3W97 C;  3WAA D;  2Y2G A;  1KX4 B;  3MNN C;  3W96 B;  5BS7 C;  1HTA A;  3UTA C;  1P34 B;  2HIO B;  1P3M A;  3WAA B;  5CPI C;  1P3A D;  5DNN A;  3LZ1 D;  3LEL B;  1P3F B;  1KX3 A;  5AVB B;  4H9S C;  1KX4 C;  3W99 A;  5BNV A;  5B33 B;  4UUZ A;  5BO0 B;  5G49 B;  3KXB A;  1M1A A;  1P34 C;  2HIO C;  4WNN A;  3X1S C;  2BYM A;  2FJ7 D;  2F8N A;  3B6F D;  3LEL C;  3VH5 T;  5AVB C;  3AV1 B;  3AV2 D;  3REI A;  2FJ7 B;  3KUY A;  5B33 C;  3B6G A;  3AZJ B;  5E5A C;  4WU8 B;  3MVD A;  5AV8 D;  1T3U A;  5GSU A;  3AZH A;  1JFI B;  1HQ3 A;  5B24 B;  3AV1 C;  5JA4 A;  1P3I C;  3REJ B;  4WU9 A;  4H9O B;  4R8P D;  3UTA A;  4AWL B;  3WKJ A;  5CPJ A;  5AV8 B;  3AZJ C;  5CPK A;  2CV5 D;  4WU8 C;  2F8N G;  4J8X B;  2PYO D;  3EG5 B;  3B0D B;  1Z2C B;  1KX4 A;  3TU4 B;  3B0C T;  2ARO C;  5B24 C;  3W96 A;  2CV5 B;  1EQZ C;  4AWL C;  1P34 A;  2HIO A;  2PYO B;  3WAA A;  2Y2L A;  3LEL A;  1P3O C;  1P3F A;  4J8X C;  5AVB A;  3AZL D;  3TU4 C;  5GT3 C;  5B33 A;  5BO0 A;  5G49 A;  1ID3 B;  3LZ1 A;  2BYK B;  2VQR A;  3A6N C;  2G5H C;  3AZL B;  3AZG C;  3MGP D;  5GT0 C;  1P3K D;  2Y2I A;  3AZM D;  3KWQ B;  3AV1 A;  4CSR B;  4XUJ C;  3LZ0 B;  2FJ7 A;  1F66 D;  2NQB C;  1ID3 C;  3AZJ A;  4J8U D;  3AZM B;  1ULY A;  4WU8 A;  3AZE B;  4ZUX C;  1JFI A;  3KWQ C;  4J8U B;  1M19 B;  3WTP E;  3LZ0 C;  5GXQ D;  3REJ A;  2F8N K;  2G5I C;  2FFF B;  5AV8 A;  2LY8 A;  3NQU B;  5B1L D;  3AZE C;  5BNX B;  4J8X A;  5GXQ B;  3TU4 A;  1M19 C;  5B1L B;  4DRB A;  2CV5 A;  4QLC C;  3AZK C;  5AV5 D;  2PYO A;  3VH6 W;  3AN2 D;  3C1C B;  3AFA D;  5B1M C;  1P3G B;  5AV5 B;  3P5J B;  3MGS D;  1WWI A;  5B0Y C;  1ID3 A;  2BYK A;  4YM6 D;  3AZL A;  5CP6 D;  3C1C C;  3X1V C;  1AOI B;  3MGS B;  2RIQ A;  1U35 D;  1P3G C;  3KFU G;  3KWQ A;  5AY8 D;  4YM6 B;  3C1B D;  4CSR A;  2Y2H A;  3O62 D;  3LZ0 A;  4Z66 D;  3AZM A;  5AY8 B;  3AZE A;  3C1B B;  1P3B D;  5DNN C;  1AOI C;  4KUD D;  1KX3 C;  5BT1 D;  4DQY B;  4Z66 B;  2W8S A;  4KGC B;  3X1U D;  4J8U A;  1M19 A;  4WJ3 C;  3MGQ D;  3W99 C;  3MGR D;  3UT9 D;  3NQU A;  3X1T D;  5BNX A;  3MGQ B;  5GXQ A;  3AZH B;  5GSU B;  3R45 A;  5AV6 D;  3UT9 B;  4KGC C;  3IP4 C;  5CHL B;  5B1L A;  3REI C;  3KUY C;  4G92 C;  3VH5 A;  2XD5 A;  3B6G C;  5B2J B;  5AV6 B;  3C1C A;  4J8V D;  3AZI D;  1P3G A;  3MVD C;  3AZH C;  5AV5 A;  5GSU C;  3W98 D;  1M18 B;  1HQ3 C;  4NE6 A;  2ZY5 A;  5JRG D;  4WU9 C;  3WKJ C;  5FUG B;  5CPJ C;  3W98 B;  3VH5 W;  5B2J C;  3AZF D;  5CPK C;  1AOI A;  3MGS A;  4NFT A;  1H3O B;  5JRG B;  4YM6 A;  1M18 C;  1P3A B;  3W96 C;  5CP6 A;  3LZ1 B;  5KDM B;  3WAA C;  5AY8 A;  3C1B A;  3O62 A;  2RVQ D;  4G91 B;  1P3F C;  4Z66 A;  1KU5 A;  4KGC A;  4JJN D;  3FDD A;  1P3A C;  3AZN D;  1P3B A;  3B6F B;  3LZ1 C;  2NZD D;  4NE5 A;  4KUD A;  3AV2 B;  3B0C W;  3MGQ A;  4G91 C;  3AZN B;  3UT9 A;  1BFM A;  2FJ7 C;  3REH D;  3H0R C;  3B6F C;  5B2J A;  5AV6 A;  3AV2 C;  4R8P B;  1M18 A;  4J8W D;  3LJA D;  4CAY B;  4H9R B;  5AV9 D;  1KX5 D;  3REJ C;  3AYW D;  5B31 D;  5FUG A;  5AV8 C;  3W98 A;  4H9P B;  4J8W B;  3REL D;  3LJA B;  1WWS A;  1B67 A;  1H3O A;  3B0D C;  5AV9 B;  5JRG A;  4R8P C;  1KX5 B;  5B31 B;  3B0B A;  1P3A A;  3AZF A;  2CV5 C;  5KDM A;  2PYO C;  5B2I D;  4DRA A;  2HUE B;  5F99 D;  5B40 D;  5DNM D;  1S32 D;  3A1I A;  3MGP B;  1P3K B;  3B6F A;  5F99 B;  5C3I B;  3AZL C;  3AV2 A;  1S32 B;  1F66 B;  2HUE C;  3AZN A;  5B32 D;  4X23 D;  1P3L D;  4ZBJ B;  4EO5 B;  2JE5 A;  5AVC D;  3MGP C;  1P3P D;  1P3K C;  1B6W A;  3AZM C;  3UTB D;  3H0M C;  5C3I C;  5B32 B;  1ZLA D;  4X23 B;  1P3L B;  2XD1 A;  4R8P A;  2Y2K A;  3R45 B;  1F66 C;  4J8U C;  4LD9 D;  4CAY A;  4H9R A;  1BH9 B;  4EO5 C;  1A7W A;  2ZY4 A;  4H9P A;  4J8W A;  4QLC D;  2ZY3 A;  3LJA A;  5AV9 A;  1KX5 A;  5GXQ C;  3AYW A;  2Y2O A;  3REK D;  2YFV B;  5B31 A;  5B1L C;  3AN2 B;  4YS3 D;  3AFA B;  5B0Z D;  1TZY D;  3REK B;  1PZR A;  4Z5T D;  3WTP D;  3EPJ A;  2ZY2 A;  4YS3 B;  4XZQ D;  2F8N H;  5AV5 C;  5B0Z B;  4NE3 A;  5CP6 B;  3AN2 C;  3MGP A;  3AFA C;  1P3K A;  1U35 B;  5F99 A;  4XZQ B;  3WA9 D;  3O62 B;  1S32 A;  1F66 A;  3MGS C;  1P3M D;  2DQN C;  4YM6 C;  5B31 G;  5CP6 C;  1P3B B;  3WA9 B;  4KUD B;  1U35 C;  5B32 A;  5AY8 C;  3X1U B;  3KXB D;  4X23 A;  1P3L A;  3C1B C;  1M1A D;  3O62 C;  3MGR B;  3VH6 T;  5AVC A;  4Z66 C;  3X1T B;  1BH9 A;  1P3B C;  4KUD C;  5BT1 C;  3X1U C;  3KUY D;  3MGQ C;  3B6G D;  3MGR C;  3UT9 C;  2YFV A;  3AN2 A;  4J8V B;  4H9Q B;  3AFA A;  3X1T C;  3W97 D;  3AZI B;  3MNN D;  3REK A;  5AV6 C;  5B32 G;  1TAF B;  3UTA D;  4YS3 A;  3W97 B;  5CPI D;  5B0Z A;  3EPH A;  3MNN B;  3AZF B;  1N1J B;  4J8V C;  1U35 A;  3AZI C;  1KX4 D;  4XZQ A;  3W98 C;  5CPI B;  1P34 D;  5JRG C;  2HIO D;  2L5A A;  3X1S D;  2UWX A;  2Y2P A;  3LEL D;  3AZF C;  1P3F D;  3WA9 A;  5AVB D;  2CWE A;  3X1S B;  3X1U A;  3F6T A;  5B33 D;  4JJN B;  3MGR A;  4M6B A;  2NZD B;  5E5A D;  2F2A C;  3X1T A;  2ZM5 A;  3V9R B;  2RVQ C;  3AV1 D;  1P3I D;  5E5A B; 
#chains in the Genus database with same CATH homology
 4JJN C;  3AZJ D;  3REH B;  3AZN C;  1W2E A;  2NZD C;  4WU8 D;  4J8V A;  1P3I B;  4H9Q A;  3AZI A;  2ARO D;  5B24 D;  2J8P A;  1EQZ D;  3REJ D;  1TAF A;  3EPK A;  1R4V A;  3NQJ B;  3W97 A;  2YFW B;  3AYW B;  3REH C;  3MNN A;  2ARO B;  1P3O D;  1N1J A;  4J8X D;  1EQZ B;  3REL B;  4H9N B;  5BS7 A;  1BH8 B;  3TU4 D;  5GT3 D;  5CPI A;  4J8W C;  1P3O B;  3LJA C;  5AV9 C;  1KX5 C;  4HGA B;  4H9S A;  3A6N D;  3AYW C;  3AZG D;  5B31 C;  5B2I B;  5GT3 B;  5GT0 D;  3REL C;  5B40 B;  4XUJ D;  3A6N B;  3X1S A;  2DF4 C;  5DNM B;  4JJN A;  3AZG B;  2NQB D;  1ID3 D;  1F1E A;  5GT0 B;  3AL0 C;  2NZD A;  4HGA C;  5B2I C;  4XUJ B;  2NQB B;  4ZUX D;  3V9R A;  3KWQ D;  5F99 C;  5B40 C;  3LZ0 D;  5E5A A;  5DNM C;  1S32 C;  5AVC B;  4ZUX B;  3REH A;  1P3P B;  1Q9C A;  4E44 A;  3UTB B;  3AZE D;  1P3I A;  4ZBJ C;  2Y2Q A;  1ZLA B;  2Y2M A;  4Z2M G;  1M19 D;  5B32 C;  3AZK D;  4LD9 B;  4X23 C;  1P3L C;  3NQJ A;  2YFW A;  5AVC C;  1P3P C;  5B1M D;  2ARO A;  5B24 A;  3UTB C;  1EQZ A;  4QLC B;  4H9N A;  3REL A;  3AZK B;  1ZLA C;  4H9O A;  3VH6 A;  1BH8 A;  5B0Y D;  5B1M B;  4LD9 C;  3KSY A;  1P3O A;  2IO5 B;  1TZY B;  5B2I A;  3C1C D;  3X1V D;  5GT3 A;  2JSS A;  3WTP B;  4Z5T B;  1P3G D;  5B0Y B;  5B40 A;  3A6N A;  3REK C;  5DNM A;  3AZG A;  4WZS B;  3X1V B;  4KHA B;  5GT0 A;  2IO5 C;  4YS3 C;  5B0Z C;  1TZY C;  4XUJ A;  5DNN D;  4UPK A;  1AOI D;  4WV4 B;  2Y2J A;  4Z5T C;  3WTP C;  1KX3 D;  2NQB A;  2Y2N A;  1P3M B;  3A1K A;  3W99 D;  4XZQ C;  5DNN B;  1KX3 B;  4ZUX A;  1P3P A;  2F8N D;  3UTB A;  3W99 B;  5BNV B;  3KXB B;  4UUZ B;  1M1A B;  1ZLA A;  3WA9 C;  3H0L C;  4KGC D;  3REI D;  1P3M C;  4WNN B;  2F8N B;  2BYM B;  4LD9 A;  2JCH A;  3REI B;  3MVD D;  4QLC A;  3AZK A;  3KXB C;  5GSU D;  3KUY B;  4G92 B;  3AZH D;  1M1A C;  3B6G B;  1HQ3 D;  2BG1 A;  5B1M A;  4WU9 D;  3WKJ D;  3MVD B;  5CPJ D;  5B2J D;  5CPK D;  1TZY A;  1HQ3 B;  3EPL A;  3WTP A;  4Z5T A;  4E45 A;  5JA4 B;  5B0Y A;  4WU9 B;  3WKJ B;  3UTA B;  1M18 D;  5CPJ B;  3W96 D;  5CPK B;  3X1V A;  4KHA A;  4Z2M H;  3W97 C;  3WAA D;  2Y2G A;  1KX4 B;  3MNN C;  3W96 B;  5BS7 C;  1HTA A;  3UTA C;  1P34 B;  2HIO B;  1P3M A;  3WAA B;  5CPI C;  1P3A D;  5DNN A;  3LZ1 D;  3LEL B;  1P3F B;  1KX3 A;  5AVB B;  4H9S C;  1KX4 C;  3W99 A;  5BNV A;  5B33 B;  4UUZ A;  5BO0 B;  5G49 B;  3KXB A;  1M1A A;  1P34 C;  2HIO C;  4WNN A;  3X1S C;  2BYM A;  2FJ7 D;  2F8N A;  3B6F D;  3LEL C;  3VH5 T;  5AVB C;  3AV1 B;  3AV2 D;  3REI A;  2FJ7 B;  3KUY A;  5B33 C;  3B6G A;  3AZJ B;  5E5A C;  4WU8 B;  3MVD A;  5AV8 D;  1T3U A;  5GSU A;  3AZH A;  1JFI B;  1HQ3 A;  5B24 B;  3AV1 C;  5JA4 A;  1P3I C;  3REJ B;  4WU9 A;  4H9O B;  4R8P D;  3UTA A;  4AWL B;  3WKJ A;  5CPJ A;  5AV8 B;  3AZJ C;  5CPK A;  2CV5 D;  4WU8 C;  2F8N G;  4J8X B;  2PYO D;  3EG5 B;  3B0D B;  1Z2C B;  1KX4 A;  3TU4 B;  3B0C T;  2ARO C;  5B24 C;  3W96 A;  2CV5 B;  1EQZ C;  4AWL C;  1P34 A;  2HIO A;  2PYO B;  3WAA A;  2Y2L A;  3LEL A;  1P3O C;  1P3F A;  4J8X C;  5AVB A;  3AZL D;  3TU4 C;  5GT3 C;  5B33 A;  5BO0 A;  5G49 A;  1ID3 B;  3LZ1 A;  2BYK B;  2VQR A;  3A6N C;  2G5H C;  3AZL B;  3AZG C;  3MGP D;  5GT0 C;  1P3K D;  2Y2I A;  3AZM D;  3KWQ B;  3AV1 A;  4CSR B;  4XUJ C;  3LZ0 B;  2FJ7 A;  1F66 D;  2NQB C;  1ID3 C;  3AZJ A;  4J8U D;  3AZM B;  1ULY A;  4WU8 A;  3AZE B;  4ZUX C;  1JFI A;  3KWQ C;  4J8U B;  1M19 B;  3WTP E;  3LZ0 C;  5GXQ D;  3REJ A;  2F8N K;  2G5I C;  2FFF B;  5AV8 A;  2LY8 A;  3NQU B;  5B1L D;  3AZE C;  5BNX B;  4J8X A;  5GXQ B;  3TU4 A;  1M19 C;  5B1L B;  4DRB A;  2CV5 A;  4QLC C;  3AZK C;  5AV5 D;  2PYO A;  3VH6 W;  3AN2 D;  3C1C B;  3AFA D;  5B1M C;  1P3G B;  5AV5 B;  3P5J B;  3MGS D;  1WWI A;  5B0Y C;  1ID3 A;  2BYK A;  4YM6 D;  3AZL A;  5CP6 D;  3C1C C;  3X1V C;  1AOI B;  3MGS B;  2RIQ A;  1U35 D;  1P3G C;  3KFU G;  3KWQ A;  5AY8 D;  4YM6 B;  3C1B D;  4CSR A;  2Y2H A;  3O62 D;  3LZ0 A;  4Z66 D;  3AZM A;  5AY8 B;  3AZE A;  3C1B B;  1P3B D;  5DNN C;  1AOI C;  4KUD D;  1KX3 C;  5BT1 D;  4DQY B;  4Z66 B;  2W8S A;  4KGC B;  3X1U D;  4J8U A;  1M19 A;  4WJ3 C;  3MGQ D;  3W99 C;  3MGR D;  3UT9 D;  3NQU A;  3X1T D;  5BNX A;  3MGQ B;  5GXQ A;  3AZH B;  5GSU B;  3R45 A;  5AV6 D;  3UT9 B;  4KGC C;  3IP4 C;  5CHL B;  5B1L A;  3REI C;  3KUY C;  4G92 C;  3VH5 A;  2XD5 A;  3B6G C;  5B2J B;  5AV6 B;  3C1C A;  4J8V D;  3AZI D;  1P3G A;  3MVD C;  3AZH C;  5AV5 A;  5GSU C;  3W98 D;  1M18 B;  1HQ3 C;  4NE6 A;  2ZY5 A;  5JRG D;  4WU9 C;  3WKJ C;  5FUG B;  5CPJ C;  3W98 B;  3VH5 W;  5B2J C;  3AZF D;  5CPK C;  1AOI A;  3MGS A;  4NFT A;  1H3O B;  5JRG B;  4YM6 A;  1M18 C;  1P3A B;  3W96 C;  5CP6 A;  3LZ1 B;  5KDM B;  3WAA C;  5AY8 A;  3C1B A;  3O62 A;  2RVQ D;  4G91 B;  1P3F C;  4Z66 A;  1KU5 A;  4KGC A;  4JJN D;  3FDD A;  1P3A C;  3AZN D;  1P3B A;  3B6F B;  3LZ1 C;  2NZD D;  4NE5 A;  4KUD A;  3AV2 B;  3B0C W;  3MGQ A;  4G91 C;  3AZN B;  3UT9 A;  1BFM A;  2FJ7 C;  3REH D;  3H0R C;  3B6F C;  5B2J A;  5AV6 A;  3AV2 C;  4R8P B;  1M18 A;  4J8W D;  3LJA D;  4CAY B;  4H9R B;  5AV9 D;  1KX5 D;  3REJ C;  3AYW D;  5B31 D;  5FUG A;  5AV8 C;  3W98 A;  4H9P B;  4J8W B;  3REL D;  3LJA B;  1WWS A;  1B67 A;  1H3O A;  3B0D C;  5AV9 B;  5JRG A;  4R8P C;  1KX5 B;  5B31 B;  3B0B A;  1P3A A;  3AZF A;  2CV5 C;  5KDM A;  2PYO C;  5B2I D;  4DRA A;  2HUE B;  5F99 D;  5B40 D;  5DNM D;  1S32 D;  3A1I A;  3MGP B;  1P3K B;  3B6F A;  5F99 B;  5C3I B;  3AZL C;  3AV2 A;  1S32 B;  1F66 B;  2HUE C;  3AZN A;  5B32 D;  4X23 D;  1P3L D;  4ZBJ B;  4EO5 B;  2JE5 A;  5AVC D;  3MGP C;  1P3P D;  1P3K C;  1B6W A;  3AZM C;  3UTB D;  3H0M C;  5C3I C;  5B32 B;  1ZLA D;  4X23 B;  1P3L B;  2XD1 A;  4R8P A;  2Y2K A;  3R45 B;  1F66 C;  4J8U C;  4LD9 D;  4CAY A;  4H9R A;  1BH9 B;  4EO5 C;  1A7W A;  2ZY4 A;  4H9P A;  4J8W A;  4QLC D;  2ZY3 A;  3LJA A;  5AV9 A;  1KX5 A;  5GXQ C;  3AYW A;  2Y2O A;  3REK D;  2YFV B;  5B31 A;  5B1L C;  3AN2 B;  4YS3 D;  3AFA B;  5B0Z D;  1TZY D;  3REK B;  1PZR A;  4Z5T D;  3WTP D;  3EPJ A;  2ZY2 A;  4YS3 B;  4XZQ D;  2F8N H;  5AV5 C;  5B0Z B;  4NE3 A;  5CP6 B;  3AN2 C;  3MGP A;  3AFA C;  1P3K A;  1U35 B;  5F99 A;  4XZQ B;  3WA9 D;  3O62 B;  1S32 A;  1F66 A;  3MGS C;  1P3M D;  2DQN C;  4YM6 C;  5B31 G;  5CP6 C;  1P3B B;  3WA9 B;  4KUD B;  1U35 C;  5B32 A;  5AY8 C;  3X1U B;  3KXB D;  4X23 A;  1P3L A;  3C1B C;  1M1A D;  3O62 C;  3MGR B;  3VH6 T;  5AVC A;  4Z66 C;  3X1T B;  1BH9 A;  1P3B C;  4KUD C;  5BT1 C;  3X1U C;  3KUY D;  3MGQ C;  3B6G D;  3MGR C;  3UT9 C;  2YFV A;  3AN2 A;  4J8V B;  4H9Q B;  3AFA A;  3X1T C;  3W97 D;  3AZI B;  3MNN D;  3REK A;  5AV6 C;  5B32 G;  1TAF B;  3UTA D;  4YS3 A;  3W97 B;  5CPI D;  5B0Z A;  3EPH A;  3MNN B;  3AZF B;  1N1J B;  4J8V C;  1U35 A;  3AZI C;  1KX4 D;  4XZQ A;  3W98 C;  5CPI B;  1P34 D;  5JRG C;  2HIO D;  2L5A A;  3X1S D;  2UWX A;  2Y2P A;  3LEL D;  3AZF C;  1P3F D;  3WA9 A;  5AVB D;  2CWE A;  3X1S B;  3X1U A;  3F6T A;  5B33 D;  4JJN B;  3MGR A;  4M6B A;  2NZD B;  5E5A D;  2F2A C;  3X1T A;  2ZM5 A;  3V9R B;  2RVQ C;  3AV1 D;  1P3I D;  5E5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...