5B2IA

Human nucleosome containing cpg unmethylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
molecule keywords Histone H3.1
molecule tags Transcription/dna
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iA00
5B31A 4JJNA 5CPID 5AV6B 3MGSC 3KWQC 3VH6W 3WTPB 3REHC 3WAAA 5GXQC 5B32A 5GT0D 4KGCA 5DNMB 3X1SC 5AY8D 4J8UB 1M18D 5B40C 4H9RA 3B6GD 3AZMC 4ZUXA 1P3GD 5AVBC 5B33A 3AZGA 3AV1C 4WU8D 2CV5D 1P3PC 3W96B 4Z2MH 3KUYA 4WU9B 3C1BC 5E5AB 3C1CC 1P3LB 5CPKD 5FUGA 4Z5TB 4Z66B 1P3MB 1AOID 3AZHB 3UTBB 1P3OC 4UUZA 1KU5A 4H9OA 1KX3D 3AFAD 3AZNA 2AROA 5DNMA 4J8UA 4WU9D 2NZDB 4CAYB 1P3AD 3NQUB 3MGQD 4X23C 4J8XB 5B0ZB 1P3BC 1KX4A 3VH6T 3AZLC 1U35A 3UT9D 4H9SA 3UTAC 2BYMB 4H9PB 5BT1D 3KWQA 3AV2C 4KUDB 1M1AC 2F8ND 1ID3D 4Z66A 3REHA 3AZJB 5GXQA 3UTBA 3WKJB 3X1SA 1HQ3C 4J8XD 5BO0A 3REJC 2LY8A 3AZFB 3LZ0B 3LZ1D 2F8NG 5CHLB 5AVBA 4J8WC 1H3OA 3WA9C 3AV1A 1P3PA 4YM6C 3AZJD 3C1BA 3C1CA 4ZBJC 1TZYD 3O62C 4YS3C 3W99D 3REIC 3B0DB 2IO5B 4R8PD 3REKD 4KUDA 3MNND 3RELD 3WKJA 3X1TD 1P3IC 5AV9C 4NE6A 1S32B 5B1LD 5B2JD 4XZQC 4WV4B 1P3BA 3MVDD 1KX5B 5B1MB 3AZLA 4CSRB 3AN2C 5CPJD 5AV5B 3UTAA 5BNVA 1M19B 5GT3C 4J8VB 4QLCB 5AVCB 1HQ3A 3REJA 4KGCC 2RVQC 3MGRB 4H9NB 4XUJB 1ZLAB 3LJAC 5GSUB 3WA9A 5BS7C 5B33C 4YM6A 5DNNB 2BYKA 3AZGC 2HUEC 1F66B 2PYOC 3X1VC 3R45B 5B1MA 1B67A 5B0YD 1P3FD 3O62A 3TU4C 4YS3A 5B2IC 3MGPB 3REIA 3X1UB 4E44A 3AZEB 3W97D 1P34D 4G91B 5AV6C 4NFTA 4QLCA 3WTPC 1HTAA 3V9RA 5DNMC 2NQBB 4J8UC 3MGRA 2HIOD 4XUJA 5CPIB 4LD9D 3KXBD 4XZQA 3A6ND 1P3KB 5GT0B 3AYWD 5GSUA 1AOIC 5JRGD 1A7WA 5AY8B 5F99D 1F66A 3AN2A 3W96C 1M18B 3KSYA 3B6GB 4WU9C 5E5AC 1N1JB 5GT3A 1P3GB 1P3LC 1TAFB 4DRAA 2YFWB 3MGPA 4Z5TC 4WU8B 2CV5B 1P3KD 4Z66C 1P3MC 5AV8D 3AZHC 3UTBC 4KHAA 4DRBA 5CPKB 2NZDC 5B31D 3LJAA 4JJND 1AOIB 1EQZD 5BS7A 1KX3B 3AFAB 5C3IB 2PYOA 4J8XC 3X1VA 5B0ZC 5B32D 3WAAD 5B31G 1P3AB 3TU4A 5B2IA 3MGQB 4ZUXD 5B32G 5AV6A 4KUDC 2CV5A 5BNXB 3B0BA 3WTPA 3AZJC 1JFIB 3UT9B 3WKJC 3VH5A 3AZFC 3LZ0C 2F8NK 2F8NB 1ID3B 1AOIA 3W96A 3AZND 3LZ1B 5CP6D 4WU9A 5E5AA 2FJ7B 3AZID 1P3LA 3AZKB 2JSSA 5KDMB 4Z5TA 3B0DC 2IO5C 1P3MA 3AZHA 1KX4D 5G49B 1TZYB 4HGAB 1U35D 3W99B 3AZMD 2NZDA 4R8PB 4CAYA 2FJ7D 3REKB 1S32C 3AZKD 3NQUA 3MNNB 3MGSD 3KWQD 4H9QB 3RELB 4J8XA 3X1TB 5GXQD 5JA4B 5B0ZA 1KX5C 3X1SD 5B1MC 5B1LB 3LELB 5B2JB 5B40D 5AV5C 2BYMA 1M19C 3MVDB 4H9PA 5AVBD 5B24D 4J8VC 3AZJA 4QLCC 3AV1D 1P3PD 5AVCC 5CPJB 3C1BD 3C1CD 3AZFA 3MGRC 4XUJC 3LZ0A 3LELD 1ZLAC 3VH6A 3B6FB 5GSUC 2F8NH 3RELA 3W98D 1P3OD 1F66C 5DNNC 5JA4A 5B2JA 3MGPC 3X1UC 4X23D 3AZEC 4G92B 4G91C 1P3BD 5B0YB 1P3FB 3B6FD 4NE3A 4H9SC 3AZLD 2NQBC 3UTAD 1S32A 1P34B 3W97B 5CPIC 1BH9B 3AV2D 1M1AD 1P3KC 5GT0C 1KX5A 1HQ3D 5AY8C 4CSRA 4LD9B 2HIOB 1M18C 3KXBB 3B6GC 5AV5A 3VH5W 3A6NB 1M19A 3AYWB 1P3GC 5JRGB 5F99B 4J8WD 4J8VA 4WU8C 3WA9D 2CV5C 1R4VA 4YM6D 5AVCA 4H9NA 3O62D 5CPKC 4YS3D 1ZLAA 3WTPE 3REID 5AV8B 2YFVB 1KX3C 5DNNA 3AFAC 5C3IC 3R45A 1P3ID 1BH8B 5AV9D 5B31B 4JJNB 1P3AC 1EQZB 3X1UA 4XZQD 3MGQC 1F1EA 3AZEA 3WAAB 5B32B 3AN2D 3UT9C 2NQBA 4ZUXB 5GT3D 5CPIA 5BT1C 4Z2MG 1P3KA 1ID3C 5AV8A 5GT0A 4KGCD 5AY8A 4NE5A 2RVQD 1M18A 1BH8A 3B6GA 3LZ1C 1N1JA 1P3GA 2FJ7C 3AZKC 1TAFA 1EQZA 2YFWA 3LJAD 4UUZB 4H9OB 1Q9CA 4WU8A 5B33D 3AZGD 3AZNB 2PYOD 2AROB 5CP6B 3X1VD 3KUYD 3AZIB 1TZYC 4HGAC 3TU4D 5CPKA 5B2ID 3W99C 1B6WA 4R8PC 3REKC 1KX4B 4EO5B 5B24C 5AV6D 4M6BA 3MNNC 3RELC 1KX3A 3AFAA 3WTPD 3X1TC 1U35B 1BFMA 2AROD 5DNMD 3AZMB 4J8UD 1P3AA 5B1LC 3LELC 3MGSB 5B2JC 3KWQB 3MGQA 3REHB 5GXQB 3W98C 3MVDC 3X1SB 5BO0B 5BNXA 1JFIA 3W96D 5CP6A 3UT9A 5B40B 5CPJC 3AZIA 5E5AD 1P3LD 5AVBB 5B24B 4Z5TD 2F8NA 1H3OB 1ID3A 3AV1B 1P3PB 4Z66D 3REHD 1P3MD 3B6FC 3C1BB 3AZHD 3UTBD 3C1CB 4WNNB 4E45A 3LZ1A 3AZMA 2FJ7A 3AZKA 2NZDD 3MGSA 3W98B 5KDMA 1P3OB 4G92C 5B0ZD 5B0YC 5G49A 1P3FC 1TZYA 5B40A 1WWSA 3W99A 2CWEA 4X23B 4R8PA 3REKA 1P34C 3W97C 1P3BB 5B24A 3MNNA 4H9QA 4KUDD 3AZLB 3X1TA 3WKJD 4WNNA 5BNVB 3UTAB 4LD9C 2HIOC 5B1LA 3LELA 3KXBC 3AZFD 3AV2B 3LZ0D 1M1AB 3A6NC 3AYWC 3W98A 3MVDA 5JRGC 1P3OA 1HQ3B 3REJB 5F99C 3B0CW 5CPJA 4WZSB 4J8WB 4X23A 3WA9B 4YM6B 2BYKB 5AV8C 3B6FA 4ZBJB 3REJD 3O62B 4YS3B 4AWLC 3REIB 5B31C 4JJNC 3AV2A 1S32D 1M1AA 1EQZC 3WAAC 5B32C 1P3IB 5AV9B 3V9RB 5B0YA 1KX5D 1P3FA 5B1MD 4XZQB 5AV5D 4ZUXC 1M19D 3W97A 1P34A 4J8WA 1BH9A 3AN2B 4J8VD 4QLCD 5AVCD 3KUYC 3NQJB 4AWLB 3B0CT 2HIOA 5GT3B 4LD9A 3KXBA 1ULYA 3MGRD 4XUJD 1ZLAD 3A6NA 3AYWA 5JRGA 4KGCB 5F99A 5GSUD 4KHAB 1F66D 5DNND 3AZNC 5AV9A 1P3IA 2AROC 5CP6C 4H9RB 3AZIC 3LJAB 3VH5T 3MGPD 5B33B 3X1UD 3AZGB 1WWIA 2PYOB 2HUEB 3AZED 3X1VB 1KX4C 4EO5C 3KUYB 2YFVA 3TU4B 1U35C 5B2IB 3NQJA 2L5AA 5FUGB 2NQBD
chains in the Genus database with same CATH superfamily
5B31A 4JJNA 5CPID 5AV6B 3MGSC 3KWQC 3VH6W 3WTPB 3REHC 3WAAA 5GXQC 5B32A 5GT0D 4KGCA 5DNMB 3X1SC 5AY8D 4J8UB 1M18D 5B40C 4H9RA 3B6GD 3AZMC 4ZUXA 2XD5A 1P3GD 2Y2GA 5AVBC 5B33A 3AZGA 3AV1C 4WU8D 2CV5D 1P3PC 3W96B 4Z2MH 3KUYA 4WU9B 3C1BC 5E5AB 3C1CC 1P3LB 5CPKD 5FUGA 4Z5TB 4Z66B 1P3MB 1AOID 3AZHB 3UTBB 1P3OC 4UUZA 1KU5A 4H9OA 1KX3D 3AFAD 3AZNA 2Y2IA 2AROA 5DNMA 4J8UA 4WU9D 2NZDB 4CAYB 1P3AD 3NQUB 3MGQD 4X23C 4J8XB 5B0ZB 1P3BC 1KX4A 3VH6T 3AZLC 1U35A 3UT9D 4H9SA 3UTAC 2BYMB 4H9PB 5BT1D 3KWQA 3AV2C 4KUDB 1M1AC 2F8ND 1ID3D 4Z66A 3REHA 3AZJB 5GXQA 3UTBA 3WKJB 3X1SA 1HQ3C 4J8XD 5BO0A 3REJC 2LY8A 3AZFB 3LZ0B 3LZ1D 2F8NG 5CHLB 5AVBA 4J8WC 1H3OA 3WA9C 3AV1A 1P3PA 4YM6C 3AZJD 3C1BA 3C1CA 4ZBJC 1TZYD 3O62C 4YS3C 3W99D 3REIC 3B0DB 2IO5B 2ZM5A 4R8PD 3REKD 4KUDA 3MNND 3RELD 3WKJA 3X1TD 1P3IC 5AV9C 4NE6A 1S32B 5B1LD 2XD1A 5B2JD 2ZY3A 4XZQC 4WV4B 1P3BA 3MVDD 1KX5B 5B1MB 3AZLA 4CSRB 3AN2C 5CPJD 5AV5B 3UTAA 5BNVA 1M19B 5GT3C 4J8VB 4QLCB 2Y2QA 5AVCB 1HQ3A 3REJA 4KGCC 3EPJA 2RVQC 3MGRB 4H9NB 4XUJB 1ZLAB 3LJAC 5GSUB 3WA9A 5BS7C 5B33C 5DNNB 4YM6A 2BYKA 3AZGC 2HUEC 1F66B 2PYOC 3X1VC 3R45B 5B1MA 1B67A 5B0YD 1P3FD 3P5JB 3O62A 3TU4C 4YS3A 2ZY2A 5B2IC 3MGPB 3REIA 3X1UB 4E44A 3AZEB 3W97D 1P34D 4G91B 5AV6C 4NFTA 4QLCA 3WTPC 1HTAA 3V9RA 3H0LC 5DNMC 2NQBB 4J8UC 2DQNC 3MGRA 2HIOD 4XUJA 5CPIB 4LD9D 3KXBD 4XZQA 3A6ND 1P3KB 5GT0B 3AYWD 5GSUA 1AOIC 5JRGD 1A7WA 5AY8B 5F99D 1F66A 3AN2A 2G5IC 3W96C 1M18B 3KSYA 3B6GB 4WU9C 5E5AC 1N1JB 5GT3A 1P3GB 1P3LC 1TAFB 4DRAA 2YFWB 3MGPA 4Z5TC 4WU8B 2CV5B 1P3KD 4Z66C 1P3MC 5AV8D 3AZHC 3UTBC 4KHAA 4DRBA 5CPKB 2NZDC 5B31D 3LJAA 4JJND 1AOIB 1EQZD 5BS7A 1KX3B 3AFAB 5C3IB 2PYOA 4J8XC 3X1VA 5B0ZC 5B32D 3WAAD 5B31G 1P3AB 3TU4A 5B2IA 3MGQB 3EPLA 4ZUXD 5B32G 5AV6A 2ZY4A 4KUDC 2CV5A 5BNXB 3B0BA 3WTPA 3AZJC 1JFIB 3UT9B 3WKJC 2JCHA 3VH5A 3AZFC 3LZ0C 2F8NK 2F8NB 1ID3B 1AOIA 2DF4C 3W96A 3AZND 3LZ1B 5CP6D 4WU9A 5E5AA 2FJ7B 3AZID 1P3LA 3AZKB 2JSSA 2Y2PA 5KDMB 4Z5TA 3B0DC 2IO5C 1P3MA 3AZHA 3FDDA 1KX4D 5G49B 1TZYB 2Y2OA 4HGAB 1U35D 3W99B 2VQRA 3AZMD 2NZDA 4R8PB 4CAYA 2FJ7D 3REKB 1S32C 3AZKD 3NQUA 3MNNB 3MGSD 3KWQD 4H9QB 3RELB 4J8XA 3X1TB 5GXQD 5JA4B 5B0ZA 1KX5C 3X1SD 5B1MC 3EPKA 2ZY5A 5B1LB 3LELB 5B2JB 5B40D 5AV5C 2BYMA 2Y2JA 1M19C 2Y2HA 3MVDB 4H9PA 5AVBD 5B24D 4J8VC 3AZJA 4QLCC 3AV1D 1P3PD 5AVCC 5CPJB 3C1BD 3C1CD 3AZFA 3MGRC 4XUJC 3LZ0A 3LELD 1ZLAC 3VH6A 3B6FB 5GSUC 2F8NH 3RELA 3W98D 1P3OD 1F66C 5DNNC 5JA4A 5B2JA 3MGPC 1PZRA 3X1UC 4X23D 3AZEC 4G92B 4G91C 1P3BD 5B0YB 1P3FB 3B6FD 4NE3A 3AZLD 2NQBC 3UTAD 3KFUG 1S32A 1P34B 3W97B 5CPIC 1BH9B 3AV2D 1M1AD 1P3KC 5GT0C 1KX5A 1HQ3D 5AY8C 2J8PA 4CSRA 4LD9B 2HIOB 1M18C 3KXBB 3B6GC 2W8SA 5AV5A 3VH5W 3A6NB 1M19A 3AYWB 1P3GC 5JRGB 5F99B 4J8WD 4J8VA 4WU8C 3WA9D 2CV5C 1R4VA 3F6TA 4YM6D 5AVCA 4H9NA 3O62D 5CPKC 4YS3D 1ZLAA 3WTPE 3REID 5AV8B 2YFVB 1KX3C 5DNNA 3AFAC 5C3IC 3R45A 1P3ID 1BH8B 5AV9D 5B31B 4JJNB 1P3AC 1EQZB 3X1UA 2BG1A 4XZQD 3MGQC 1F1EA 3AZEA 3WAAB 1W2EA 5B32B 3AN2D 3UT9C 2NQBA 4ZUXB 5GT3D 5CPIA 5BT1C 4Z2MG 3A1IA 1P3KA 1ID3C 5AV8A 5GT0A 4KGCD 5AY8A 4NE5A 2RVQD 1M18A 1BH8A 3B6GA 3LZ1C 1N1JA 1P3GA 2FJ7C 3AZKC 1TAFA 1EQZA 2YFWA 3LJAD 4UUZB 4H9OB 1Q9CA 4WU8A 5B33D 3AZGD 3AZNB 2PYOD 3H0MC 2AROB 5CP6B 3X1VD 2UWXA 3KUYD 3AZIB 1TZYC 4HGAC 3TU4D 5CPKA 5B2ID 3W99C 1B6WA 4R8PC 3REKC 1KX4B 4EO5B 5B24C 5AV6D 4M6BA 3MNNC 3RELC 1KX3A 3AFAA 3WTPD 3X1TC 1U35B 1BFMA 2AROD 5DNMD 3AZMB 4WJ3C 4J8UD 1P3AA 5B1LC 3LELC 3MGSB 5B2JC 3KWQB 3MGQA 3REHB 5GXQB 3W98C 3MVDC 3A1KA 3X1SB 3EPHA 5BO0B 5BNXA 1JFIA 3W96D 5CP6A 3UT9A 5B40B 5CPJC 3AZIA 5E5AD 1P3LD 5AVBB 5B24B 4Z5TD 2F8NA 1H3OB 1ID3A 3AV1B 1P3PB 4Z66D 3REHD 1P3MD 3B6FC 3C1BB 3AZHD 3UTBD 3C1CB 4WNNB 4E45A 3LZ1A 3AZMA 2FJ7A 3AZKA 2FFFB 3MGSA 2NZDD 3W98B 5KDMA 1P3OB 2F2AC 4G92C 5B0ZD 5B0YC 5G49A 1P3FC 3EG5B 1TZYA 5B40A 1WWSA 3W99A 2CWEA 4X23B 4R8PA 3REKA 1P34C 3W97C 1P3BB 5B24A 3NQJA 3MNNA 4H9QA 4KUDD 2Y2NA 3AZLB 3X1TA 3WKJD 4WNNA 5BNVB 3UTAB 4LD9C 2HIOC 5B1LA 3LELA 3KXBC 3AZFD 2RIQA 3AV2B 3LZ0D 1M1AB 3A6NC 3AYWC 3W98A 3MVDA 5JRGC 1P3OA 1HQ3B 3REJB 5F99C 2G5HC 3B0CW 5CPJA 1Z2CB 4WZSB 4J8WB 4X23A 3WA9B 4YM6B 2BYKB 5AV8C 3B6FA 4ZBJB 3REJD 3O62B 3H0RC 4YS3B 4AWLC 3REIB 2Y2LA 5B31C 4JJNC 3AV2A 1S32D 1M1AA 1EQZC 4UPKA 3WAAC 5B32C 1P3IB 5AV9B 3V9RB 5B0YA 1KX5D 1P3FA 2Y2KA 5B1MD 3IP4C 4XZQB 5AV5D 4ZUXC 1M19D 3W97A 1P34A 4J8WA 1BH9A 3AL0C 3AN2B 4J8VD 4QLCD 5AVCD 3KUYC 3NQJB 4AWLB 3B0CT 2HIOA 5GT3B 4LD9A 3KXBA 1ULYA 3MGRD 4XUJD 1ZLAD 3A6NA 3AYWA 5JRGA 1T3UA 4KGCB 5F99A 5GSUD 4KHAB 1F66D 5DNND 3AZNC 5AV9A 1P3IA 2AROC 5CP6C 4H9RB 4DQYB 3AZIC 3LJAB 2Y2MA 3VH5T 3MGPD 5B33B 3X1UD 3AZGB 1WWIA 2PYOB 2HUEB 3AZED 3X1VB 1KX4C 4EO5C 2JE5A 3KUYB 2YFVA 3TU4B 1U35C 5B2IB 4H9SC 2L5AA 5FUGB 2NQBD
chains in the Genus database with same CATH topology
5B31A 4JJNA 5CPID 5AV6B 3MGSC 3KWQC 3VH6W 3WTPB 3REHC 3WAAA 5GXQC 5B32A 5GT0D 4KGCA 5DNMB 3X1SC 5AY8D 4J8UB 1M18D 5B40C 4H9RA 3B6GD 3AZMC 4ZUXA 2XD5A 1P3GD 2Y2GA 5AVBC 5B33A 3AZGA 3AV1C 4WU8D 2CV5D 1P3PC 3W96B 4Z2MH 3KUYA 4WU9B 3C1BC 5E5AB 3C1CC 1P3LB 5CPKD 5FUGA 4Z5TB 4Z66B 1P3MB 1AOID 3AZHB 3UTBB 1P3OC 4UUZA 1KU5A 4H9OA 1KX3D 3AFAD 3AZNA 2Y2IA 2AROA 5DNMA 4J8UA 4WU9D 2NZDB 4CAYB 1P3AD 3NQUB 3MGQD 4X23C 4J8XB 5B0ZB 1P3BC 1KX4A 3VH6T 3AZLC 1U35A 3UT9D 4H9SA 3UTAC 2BYMB 4H9PB 5BT1D 3KWQA 3AV2C 4KUDB 1M1AC 2F8ND 1ID3D 4Z66A 3REHA 3AZJB 5GXQA 3UTBA 3WKJB 3X1SA 1HQ3C 4J8XD 5BO0A 3REJC 2LY8A 3AZFB 3LZ0B 3LZ1D 2F8NG 5CHLB 5AVBA 4J8WC 1H3OA 3WA9C 3AV1A 1P3PA 4YM6C 3AZJD 3C1BA 3C1CA 4ZBJC 1TZYD 3O62C 4YS3C 3W99D 3REIC 3B0DB 2IO5B 2ZM5A 4R8PD 3REKD 4KUDA 3MNND 3RELD 3WKJA 3X1TD 1P3IC 5AV9C 4NE6A 1S32B 5B1LD 2XD1A 5B2JD 2ZY3A 4XZQC 4WV4B 1P3BA 3MVDD 1KX5B 5B1MB 3AZLA 4CSRB 3AN2C 5CPJD 5AV5B 3UTAA 5BNVA 1M19B 5GT3C 4J8VB 4QLCB 2Y2QA 5AVCB 1HQ3A 3REJA 4KGCC 3EPJA 2RVQC 3MGRB 4H9NB 4XUJB 1ZLAB 3LJAC 5GSUB 3WA9A 5BS7C 5B33C 5DNNB 4YM6A 2BYKA 3AZGC 2HUEC 1F66B 2PYOC 3X1VC 3R45B 5B1MA 1B67A 5B0YD 1P3FD 3P5JB 3O62A 3TU4C 4YS3A 2ZY2A 5B2IC 3MGPB 3REIA 3X1UB 4E44A 3AZEB 3W97D 1P34D 4G91B 5AV6C 4NFTA 4QLCA 3WTPC 1HTAA 3V9RA 3H0LC 5DNMC 2NQBB 4J8UC 2DQNC 3MGRA 2HIOD 4XUJA 5CPIB 4LD9D 3KXBD 4XZQA 3A6ND 1P3KB 5GT0B 3AYWD 5GSUA 1AOIC 5JRGD 1A7WA 5AY8B 5F99D 1F66A 3AN2A 2G5IC 3W96C 1M18B 3KSYA 3B6GB 4WU9C 5E5AC 1N1JB 5GT3A 1P3GB 1P3LC 1TAFB 4DRAA 2YFWB 3MGPA 4Z5TC 4WU8B 2CV5B 1P3KD 4Z66C 1P3MC 5AV8D 3AZHC 3UTBC 4KHAA 4DRBA 5CPKB 2NZDC 5B31D 3LJAA 4JJND 1AOIB 1EQZD 5BS7A 1KX3B 3AFAB 5C3IB 2PYOA 4J8XC 3X1VA 5B0ZC 5B32D 3WAAD 5B31G 1P3AB 3TU4A 5B2IA 3MGQB 3EPLA 4ZUXD 5B32G 5AV6A 2ZY4A 4KUDC 2CV5A 5BNXB 3B0BA 3WTPA 3AZJC 1JFIB 3UT9B 3WKJC 2JCHA 3VH5A 3AZFC 3LZ0C 2F8NK 2F8NB 1ID3B 1AOIA 2DF4C 3W96A 3AZND 3LZ1B 5CP6D 4WU9A 5E5AA 2FJ7B 3AZID 1P3LA 3AZKB 2JSSA 2Y2PA 5KDMB 4Z5TA 3B0DC 2IO5C 1P3MA 3AZHA 3FDDA 1KX4D 5G49B 1TZYB 2Y2OA 4HGAB 1U35D 3W99B 2VQRA 3AZMD 2NZDA 4R8PB 4CAYA 2FJ7D 3REKB 1S32C 3AZKD 3NQUA 3MNNB 3MGSD 3KWQD 4H9QB 3RELB 4J8XA 3X1TB 5GXQD 5JA4B 5B0ZA 1KX5C 3X1SD 5B1MC 3EPKA 2ZY5A 5B1LB 3LELB 5B2JB 5B40D 5AV5C 2BYMA 2Y2JA 1M19C 2Y2HA 3MVDB 4H9PA 5AVBD 5B24D 4J8VC 3AZJA 4QLCC 3AV1D 1P3PD 5AVCC 5CPJB 3C1BD 3C1CD 3AZFA 3MGRC 4XUJC 3LZ0A 3LELD 1ZLAC 3VH6A 3B6FB 5GSUC 2F8NH 3RELA 3W98D 1P3OD 1F66C 5DNNC 5JA4A 5B2JA 3MGPC 1PZRA 3X1UC 4X23D 3AZEC 4G92B 4G91C 1P3BD 5B0YB 1P3FB 3B6FD 4NE3A 3AZLD 2NQBC 3UTAD 3KFUG 1S32A 1P34B 3W97B 5CPIC 1BH9B 3AV2D 1M1AD 1P3KC 5GT0C 1KX5A 1HQ3D 5AY8C 2J8PA 4CSRA 4LD9B 2HIOB 1M18C 3KXBB 3B6GC 2W8SA 5AV5A 3VH5W 3A6NB 1M19A 3AYWB 1P3GC 5JRGB 5F99B 4J8WD 4J8VA 4WU8C 3WA9D 2CV5C 1R4VA 3F6TA 4YM6D 5AVCA 4H9NA 3O62D 5CPKC 4YS3D 1ZLAA 3WTPE 3REID 5AV8B 2YFVB 1KX3C 5DNNA 3AFAC 5C3IC 3R45A 1P3ID 1BH8B 5AV9D 5B31B 4JJNB 1P3AC 1EQZB 3X1UA 2BG1A 4XZQD 3MGQC 1F1EA 3AZEA 3WAAB 1W2EA 5B32B 3AN2D 3UT9C 2NQBA 4ZUXB 5GT3D 5CPIA 5BT1C 4Z2MG 3A1IA 1P3KA 1ID3C 5AV8A 5GT0A 4KGCD 5AY8A 4NE5A 2RVQD 1M18A 1BH8A 3B6GA 3LZ1C 1N1JA 1P3GA 2FJ7C 3AZKC 1TAFA 1EQZA 2YFWA 3LJAD 4UUZB 4H9OB 1Q9CA 4WU8A 5B33D 3AZGD 3AZNB 2PYOD 3H0MC 2AROB 5CP6B 3X1VD 2UWXA 3KUYD 3AZIB 1TZYC 4HGAC 3TU4D 5CPKA 5B2ID 3W99C 1B6WA 4R8PC 3REKC 1KX4B 4EO5B 5B24C 5AV6D 4M6BA 3MNNC 3RELC 1KX3A 3AFAA 3WTPD 3X1TC 1U35B 1BFMA 2AROD 5DNMD 3AZMB 4WJ3C 4J8UD 1P3AA 5B1LC 3LELC 3MGSB 5B2JC 3KWQB 3MGQA 3REHB 5GXQB 3W98C 3MVDC 3A1KA 3X1SB 3EPHA 5BO0B 5BNXA 1JFIA 3W96D 5CP6A 3UT9A 5B40B 5CPJC 3AZIA 5E5AD 1P3LD 5AVBB 5B24B 4Z5TD 2F8NA 1H3OB 1ID3A 3AV1B 1P3PB 4Z66D 3REHD 1P3MD 3B6FC 3C1BB 3AZHD 3UTBD 3C1CB 4WNNB 4E45A 3LZ1A 3AZMA 2FJ7A 3AZKA 2FFFB 3MGSA 2NZDD 3W98B 5KDMA 1P3OB 2F2AC 4G92C 5B0ZD 5B0YC 5G49A 1P3FC 3EG5B 1TZYA 5B40A 1WWSA 3W99A 2CWEA 4X23B 4R8PA 3REKA 1P34C 3W97C 1P3BB 5B24A 3NQJA 3MNNA 4H9QA 4KUDD 2Y2NA 3AZLB 3X1TA 3WKJD 4WNNA 5BNVB 3UTAB 4LD9C 2HIOC 5B1LA 3LELA 3KXBC 3AZFD 2RIQA 3AV2B 3LZ0D 1M1AB 3A6NC 3AYWC 3W98A 3MVDA 5JRGC 1P3OA 1HQ3B 3REJB 5F99C 2G5HC 3B0CW 5CPJA 1Z2CB 4WZSB 4J8WB 4X23A 3WA9B 4YM6B 2BYKB 5AV8C 3B6FA 4ZBJB 3REJD 3O62B 3H0RC 4YS3B 4AWLC 3REIB 2Y2LA 5B31C 4JJNC 3AV2A 1S32D 1M1AA 1EQZC 4UPKA 3WAAC 5B32C 1P3IB 5AV9B 3V9RB 5B0YA 1KX5D 1P3FA 2Y2KA 5B1MD 3IP4C 4XZQB 5AV5D 4ZUXC 1M19D 3W97A 1P34A 4J8WA 1BH9A 3AL0C 3AN2B 4J8VD 4QLCD 5AVCD 3KUYC 3NQJB 4AWLB 3B0CT 2HIOA 5GT3B 4LD9A 3KXBA 1ULYA 3MGRD 4XUJD 1ZLAD 3A6NA 3AYWA 5JRGA 1T3UA 4KGCB 5F99A 5GSUD 4KHAB 1F66D 5DNND 3AZNC 5AV9A 1P3IA 2AROC 5CP6C 4H9RB 4DQYB 3AZIC 3LJAB 2Y2MA 3VH5T 3MGPD 5B33B 3X1UD 3AZGB 1WWIA 2PYOB 2HUEB 3AZED 3X1VB 1KX4C 4EO5C 2JE5A 3KUYB 2YFVA 3TU4B 1U35C 5B2IB 4H9SC 2L5AA 5FUGB 2NQBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 A;  4JJN A;  5CPI D;  5AV6 B;  3MGS C;  3KWQ C;  3VH6 W;  3WTP B;  3REH C;  3WAA A;  5GXQ C;  5B32 A;  5GT0 D;  4KGC A;  5DNM B;  3X1S C;  5AY8 D;  4J8U B;  1M18 D;  5B40 C;  4H9R A;  3B6G D;  3AZM C;  4ZUX A;  1P3G D;  5AVB C;  5B33 A;  3AZG A;  3AV1 C;  4WU8 D;  2CV5 D;  1P3P C;  3W96 B;  4Z2M H;  3KUY A;  4WU9 B;  3C1B C;  5E5A B;  3C1C C;  1P3L B;  5CPK D;  5FUG A;  4Z5T B;  4Z66 B;  1P3M B;  1AOI D;  3AZH B;  3UTB B;  1P3O C;  4UUZ A;  1KU5 A;  4H9O A;  1KX3 D;  3AFA D;  3AZN A;  2ARO A;  5DNM A;  4J8U A;  4WU9 D;  2NZD B;  4CAY B;  1P3A D;  3NQU B;  3MGQ D;  4X23 C;  4J8X B;  5B0Z B;  1P3B C;  1KX4 A;  3VH6 T;  3AZL C;  1U35 A;  3UT9 D;  4H9S A;  3UTA C;  2BYM B;  4H9P B;  5BT1 D;  3KWQ A;  3AV2 C;  4KUD B;  1M1A C;  2F8N D;  1ID3 D;  4Z66 A;  3REH A;  3AZJ B;  5GXQ A;  3UTB A;  3WKJ B;  3X1S A;  1HQ3 C;  4J8X D;  5BO0 A;  3REJ C;  2LY8 A;  3AZF B;  3LZ0 B;  3LZ1 D;  2F8N G;  5CHL B;  5AVB A;  4J8W C;  1H3O A;  3WA9 C;  3AV1 A;  1P3P A;  4YM6 C;  3AZJ D;  3C1B A;  3C1C A;  4ZBJ C;  1TZY D;  3O62 C;  4YS3 C;  3W99 D;  3REI C;  3B0D B;  2IO5 B;  4R8P D;  3REK D;  4KUD A;  3MNN D;  3REL D;  3WKJ A;  3X1T D;  1P3I C;  5AV9 C;  4NE6 A;  1S32 B;  5B1L D;  5B2J D;  4XZQ C;  4WV4 B;  1P3B A;  3MVD D;  1KX5 B;  5B1M B;  3AZL A;  4CSR B;  3AN2 C;  5CPJ D;  5AV5 B;  3UTA A;  5BNV A;  1M19 B;  5GT3 C;  4J8V B;  4QLC B;  5AVC B;  1HQ3 A;  3REJ A;  4KGC C;  2RVQ C;  3MGR B;  4H9N B;  4XUJ B;  1ZLA B;  3LJA C;  5GSU B;  3WA9 A;  5BS7 C;  5B33 C;  4YM6 A;  5DNN B;  2BYK A;  3AZG C;  2HUE C;  1F66 B;  2PYO C;  3X1V C;  3R45 B;  5B1M A;  1B67 A;  5B0Y D;  1P3F D;  3O62 A;  3TU4 C;  4YS3 A;  5B2I C;  3MGP B;  3REI A;  3X1U B;  4E44 A;  3AZE B;  3W97 D;  1P34 D;  4G91 B;  5AV6 C;  4NFT A;  4QLC A;  3WTP C;  1HTA A;  3V9R A;  5DNM C;  2NQB B;  4J8U C;  3MGR A;  2HIO D;  4XUJ A;  5CPI B;  4LD9 D;  3KXB D;  4XZQ A;  3A6N D;  1P3K B;  5GT0 B;  3AYW D;  5GSU A;  1AOI C;  5JRG D;  1A7W A;  5AY8 B;  5F99 D;  1F66 A;  3AN2 A;  3W96 C;  1M18 B;  3KSY A;  3B6G B;  4WU9 C;  5E5A C;  1N1J B;  5GT3 A;  1P3G B;  1P3L C;  1TAF B;  4DRA A;  2YFW B;  3MGP A;  4Z5T C;  4WU8 B;  2CV5 B;  1P3K D;  4Z66 C;  1P3M C;  5AV8 D;  3AZH C;  3UTB C;  4KHA A;  4DRB A;  5CPK B;  2NZD C;  5B31 D;  3LJA A;  4JJN D;  1AOI B;  1EQZ D;  5BS7 A;  1KX3 B;  3AFA B;  5C3I B;  2PYO A;  4J8X C;  3X1V A;  5B0Z C;  5B32 D;  3WAA D;  5B31 G;  1P3A B;  3TU4 A;  5B2I A;  3MGQ B;  4ZUX D;  5B32 G;  5AV6 A;  4KUD C;  2CV5 A;  5BNX B;  3B0B A;  3WTP A;  3AZJ C;  1JFI B;  3UT9 B;  3WKJ C;  3VH5 A;  3AZF C;  3LZ0 C;  2F8N K;  2F8N B;  1ID3 B;  1AOI A;  3W96 A;  3AZN D;  3LZ1 B;  5CP6 D;  4WU9 A;  5E5A A;  2FJ7 B;  3AZI D;  1P3L A;  3AZK B;  2JSS A;  5KDM B;  4Z5T A;  3B0D C;  2IO5 C;  1P3M A;  3AZH A;  1KX4 D;  5G49 B;  1TZY B;  4HGA B;  1U35 D;  3W99 B;  3AZM D;  2NZD A;  4R8P B;  4CAY A;  2FJ7 D;  3REK B;  1S32 C;  3AZK D;  3NQU A;  3MNN B;  3MGS D;  3KWQ D;  4H9Q B;  3REL B;  4J8X A;  3X1T B;  5GXQ D;  5JA4 B;  5B0Z A;  1KX5 C;  3X1S D;  5B1M C;  5B1L B;  3LEL B;  5B2J B;  5B40 D;  5AV5 C;  2BYM A;  1M19 C;  3MVD B;  4H9P A;  5AVB D;  5B24 D;  4J8V C;  3AZJ A;  4QLC C;  3AV1 D;  1P3P D;  5AVC C;  5CPJ B;  3C1B D;  3C1C D;  3AZF A;  3MGR C;  4XUJ C;  3LZ0 A;  3LEL D;  1ZLA C;  3VH6 A;  3B6F B;  5GSU C;  2F8N H;  3REL A;  3W98 D;  1P3O D;  1F66 C;  5DNN C;  5JA4 A;  5B2J A;  3MGP C;  3X1U C;  4X23 D;  3AZE C;  4G92 B;  4G91 C;  1P3B D;  5B0Y B;  1P3F B;  3B6F D;  4NE3 A;  4H9S C;  3AZL D;  2NQB C;  3UTA D;  1S32 A;  1P34 B;  3W97 B;  5CPI C;  1BH9 B;  3AV2 D;  1M1A D;  1P3K C;  5GT0 C;  1KX5 A;  1HQ3 D;  5AY8 C;  4CSR A;  4LD9 B;  2HIO B;  1M18 C;  3KXB B;  3B6G C;  5AV5 A;  3VH5 W;  3A6N B;  1M19 A;  3AYW B;  1P3G C;  5JRG B;  5F99 B;  4J8W D;  4J8V A;  4WU8 C;  3WA9 D;  2CV5 C;  1R4V A;  4YM6 D;  5AVC A;  4H9N A;  3O62 D;  5CPK C;  4YS3 D;  1ZLA A;  3WTP E;  3REI D;  5AV8 B;  2YFV B;  1KX3 C;  5DNN A;  3AFA C;  5C3I C;  3R45 A;  1P3I D;  1BH8 B;  5AV9 D;  5B31 B;  4JJN B;  1P3A C;  1EQZ B;  3X1U A;  4XZQ D;  3MGQ C;  1F1E A;  3AZE A;  3WAA B;  5B32 B;  3AN2 D;  3UT9 C;  2NQB A;  4ZUX B;  5GT3 D;  5CPI A;  5BT1 C;  4Z2M G;  1P3K A;  1ID3 C;  5AV8 A;  5GT0 A;  4KGC D;  5AY8 A;  4NE5 A;  2RVQ D;  1M18 A;  1BH8 A;  3B6G A;  3LZ1 C;  1N1J A;  1P3G A;  2FJ7 C;  3AZK C;  1TAF A;  1EQZ A;  2YFW A;  3LJA D;  4UUZ B;  4H9O B;  1Q9C A;  4WU8 A;  5B33 D;  3AZG D;  3AZN B;  2PYO D;  2ARO B;  5CP6 B;  3X1V D;  3KUY D;  3AZI B;  1TZY C;  4HGA C;  3TU4 D;  5CPK A;  5B2I D;  3W99 C;  1B6W A;  4R8P C;  3REK C;  1KX4 B;  4EO5 B;  5B24 C;  5AV6 D;  4M6B A;  3MNN C;  3REL C;  1KX3 A;  3AFA A;  3WTP D;  3X1T C;  1U35 B;  1BFM A;  2ARO D;  5DNM D;  3AZM B;  4J8U D;  1P3A A;  5B1L C;  3LEL C;  3MGS B;  5B2J C;  3KWQ B;  3MGQ A;  3REH B;  5GXQ B;  3W98 C;  3MVD C;  3X1S B;  5BO0 B;  5BNX A;  1JFI A;  3W96 D;  5CP6 A;  3UT9 A;  5B40 B;  5CPJ C;  3AZI A;  5E5A D;  1P3L D;  5AVB B;  5B24 B;  4Z5T D;  2F8N A;  1H3O B;  1ID3 A;  3AV1 B;  1P3P B;  4Z66 D;  3REH D;  1P3M D;  3B6F C;  3C1B B;  3AZH D;  3UTB D;  3C1C B;  4WNN B;  4E45 A;  3LZ1 A;  3AZM A;  2FJ7 A;  3AZK A;  2NZD D;  3MGS A;  3W98 B;  5KDM A;  1P3O B;  4G92 C;  5B0Z D;  5B0Y C;  5G49 A;  1P3F C;  1TZY A;  5B40 A;  1WWS A;  3W99 A;  2CWE A;  4X23 B;  4R8P A;  3REK A;  1P34 C;  3W97 C;  1P3B B;  5B24 A;  3MNN A;  4H9Q A;  4KUD D;  3AZL B;  3X1T A;  3WKJ D;  4WNN A;  5BNV B;  3UTA B;  4LD9 C;  2HIO C;  5B1L A;  3LEL A;  3KXB C;  3AZF D;  3AV2 B;  3LZ0 D;  1M1A B;  3A6N C;  3AYW C;  3W98 A;  3MVD A;  5JRG C;  1P3O A;  1HQ3 B;  3REJ B;  5F99 C;  3B0C W;  5CPJ A;  4WZS B;  4J8W B;  4X23 A;  3WA9 B;  4YM6 B;  2BYK B;  5AV8 C;  3B6F A;  4ZBJ B;  3REJ D;  3O62 B;  4YS3 B;  4AWL C;  3REI B;  5B31 C;  4JJN C;  3AV2 A;  1S32 D;  1M1A A;  1EQZ C;  3WAA C;  5B32 C;  1P3I B;  5AV9 B;  3V9R B;  5B0Y A;  1KX5 D;  1P3F A;  5B1M D;  4XZQ B;  5AV5 D;  4ZUX C;  1M19 D;  3W97 A;  1P34 A;  4J8W A;  1BH9 A;  3AN2 B;  4J8V D;  4QLC D;  5AVC D;  3KUY C;  3NQJ B;  4AWL B;  3B0C T;  2HIO A;  5GT3 B;  4LD9 A;  3KXB A;  1ULY A;  3MGR D;  4XUJ D;  1ZLA D;  3A6N A;  3AYW A;  5JRG A;  4KGC B;  5F99 A;  5GSU D;  4KHA B;  1F66 D;  5DNN D;  3AZN C;  5AV9 A;  1P3I A;  2ARO C;  5CP6 C;  4H9R B;  3AZI C;  3LJA B;  3VH5 T;  3MGP D;  5B33 B;  3X1U D;  3AZG B;  1WWI A;  2PYO B;  2HUE B;  3AZE D;  3X1V B;  1KX4 C;  4EO5 C;  3KUY B;  2YFV A;  3TU4 B;  1U35 C;  5B2I B;  3NQJ A;  2L5A A;  5FUG B;  2NQB D; 
#chains in the Genus database with same CATH topology
 5B31 A;  4JJN A;  5CPI D;  5AV6 B;  3MGS C;  3KWQ C;  3VH6 W;  3WTP B;  3REH C;  3WAA A;  5GXQ C;  5B32 A;  5GT0 D;  4KGC A;  5DNM B;  3X1S C;  5AY8 D;  4J8U B;  1M18 D;  5B40 C;  4H9R A;  3B6G D;  3AZM C;  4ZUX A;  2XD5 A;  1P3G D;  2Y2G A;  5AVB C;  5B33 A;  3AZG A;  3AV1 C;  4WU8 D;  2CV5 D;  1P3P C;  3W96 B;  4Z2M H;  3KUY A;  4WU9 B;  3C1B C;  5E5A B;  3C1C C;  1P3L B;  5CPK D;  5FUG A;  4Z5T B;  4Z66 B;  1P3M B;  1AOI D;  3AZH B;  3UTB B;  1P3O C;  4UUZ A;  1KU5 A;  4H9O A;  1KX3 D;  3AFA D;  3AZN A;  2Y2I A;  2ARO A;  5DNM A;  4J8U A;  4WU9 D;  2NZD B;  4CAY B;  1P3A D;  3NQU B;  3MGQ D;  4X23 C;  4J8X B;  5B0Z B;  1P3B C;  1KX4 A;  3VH6 T;  3AZL C;  1U35 A;  3UT9 D;  4H9S A;  3UTA C;  2BYM B;  4H9P B;  5BT1 D;  3KWQ A;  3AV2 C;  4KUD B;  1M1A C;  2F8N D;  1ID3 D;  4Z66 A;  3REH A;  3AZJ B;  5GXQ A;  3UTB A;  3WKJ B;  3X1S A;  1HQ3 C;  4J8X D;  5BO0 A;  3REJ C;  2LY8 A;  3AZF B;  3LZ0 B;  3LZ1 D;  2F8N G;  5CHL B;  5AVB A;  4J8W C;  1H3O A;  3WA9 C;  3AV1 A;  1P3P A;  4YM6 C;  3AZJ D;  3C1B A;  3C1C A;  4ZBJ C;  1TZY D;  3O62 C;  4YS3 C;  3W99 D;  3REI C;  3B0D B;  2IO5 B;  2ZM5 A;  4R8P D;  3REK D;  4KUD A;  3MNN D;  3REL D;  3WKJ A;  3X1T D;  1P3I C;  5AV9 C;  4NE6 A;  1S32 B;  5B1L D;  2XD1 A;  5B2J D;  2ZY3 A;  4XZQ C;  4WV4 B;  1P3B A;  3MVD D;  1KX5 B;  5B1M B;  3AZL A;  4CSR B;  3AN2 C;  5CPJ D;  5AV5 B;  3UTA A;  5BNV A;  1M19 B;  5GT3 C;  4J8V B;  4QLC B;  2Y2Q A;  5AVC B;  1HQ3 A;  3REJ A;  4KGC C;  3EPJ A;  2RVQ C;  3MGR B;  4H9N B;  4XUJ B;  1ZLA B;  3LJA C;  5GSU B;  3WA9 A;  5BS7 C;  5B33 C;  5DNN B;  4YM6 A;  2BYK A;  3AZG C;  2HUE C;  1F66 B;  2PYO C;  3X1V C;  3R45 B;  5B1M A;  1B67 A;  5B0Y D;  1P3F D;  3P5J B;  3O62 A;  3TU4 C;  4YS3 A;  2ZY2 A;  5B2I C;  3MGP B;  3REI A;  3X1U B;  4E44 A;  3AZE B;  3W97 D;  1P34 D;  4G91 B;  5AV6 C;  4NFT A;  4QLC A;  3WTP C;  1HTA A;  3V9R A;  3H0L C;  5DNM C;  2NQB B;  4J8U C;  2DQN C;  3MGR A;  2HIO D;  4XUJ A;  5CPI B;  4LD9 D;  3KXB D;  4XZQ A;  3A6N D;  1P3K B;  5GT0 B;  3AYW D;  5GSU A;  1AOI C;  5JRG D;  1A7W A;  5AY8 B;  5F99 D;  1F66 A;  3AN2 A;  2G5I C;  3W96 C;  1M18 B;  3KSY A;  3B6G B;  4WU9 C;  5E5A C;  1N1J B;  5GT3 A;  1P3G B;  1P3L C;  1TAF B;  4DRA A;  2YFW B;  3MGP A;  4Z5T C;  4WU8 B;  2CV5 B;  1P3K D;  4Z66 C;  1P3M C;  5AV8 D;  3AZH C;  3UTB C;  4KHA A;  4DRB A;  5CPK B;  2NZD C;  5B31 D;  3LJA A;  4JJN D;  1AOI B;  1EQZ D;  5BS7 A;  1KX3 B;  3AFA B;  5C3I B;  2PYO A;  4J8X C;  3X1V A;  5B0Z C;  5B32 D;  3WAA D;  5B31 G;  1P3A B;  3TU4 A;  5B2I A;  3MGQ B;  3EPL A;  4ZUX D;  5B32 G;  5AV6 A;  2ZY4 A;  4KUD C;  2CV5 A;  5BNX B;  3B0B A;  3WTP A;  3AZJ C;  1JFI B;  3UT9 B;  3WKJ C;  2JCH A;  3VH5 A;  3AZF C;  3LZ0 C;  2F8N K;  2F8N B;  1ID3 B;  1AOI A;  2DF4 C;  3W96 A;  3AZN D;  3LZ1 B;  5CP6 D;  4WU9 A;  5E5A A;  2FJ7 B;  3AZI D;  1P3L A;  3AZK B;  2JSS A;  2Y2P A;  5KDM B;  4Z5T A;  3B0D C;  2IO5 C;  1P3M A;  3AZH A;  3FDD A;  1KX4 D;  5G49 B;  1TZY B;  2Y2O A;  4HGA B;  1U35 D;  3W99 B;  2VQR A;  3AZM D;  2NZD A;  4R8P B;  4CAY A;  2FJ7 D;  3REK B;  1S32 C;  3AZK D;  3NQU A;  3MNN B;  3MGS D;  3KWQ D;  4H9Q B;  3REL B;  4J8X A;  3X1T B;  5GXQ D;  5JA4 B;  5B0Z A;  1KX5 C;  3X1S D;  5B1M C;  3EPK A;  2ZY5 A;  5B1L B;  3LEL B;  5B2J B;  5B40 D;  5AV5 C;  2BYM A;  2Y2J A;  1M19 C;  2Y2H A;  3MVD B;  4H9P A;  5AVB D;  5B24 D;  4J8V C;  3AZJ A;  4QLC C;  3AV1 D;  1P3P D;  5AVC C;  5CPJ B;  3C1B D;  3C1C D;  3AZF A;  3MGR C;  4XUJ C;  3LZ0 A;  3LEL D;  1ZLA C;  3VH6 A;  3B6F B;  5GSU C;  2F8N H;  3REL A;  3W98 D;  1P3O D;  1F66 C;  5DNN C;  5JA4 A;  5B2J A;  3MGP C;  1PZR A;  3X1U C;  4X23 D;  3AZE C;  4G92 B;  4G91 C;  1P3B D;  5B0Y B;  1P3F B;  3B6F D;  4NE3 A;  3AZL D;  2NQB C;  3UTA D;  3KFU G;  1S32 A;  1P34 B;  3W97 B;  5CPI C;  1BH9 B;  3AV2 D;  1M1A D;  1P3K C;  5GT0 C;  1KX5 A;  1HQ3 D;  5AY8 C;  2J8P A;  4CSR A;  4LD9 B;  2HIO B;  1M18 C;  3KXB B;  3B6G C;  2W8S A;  5AV5 A;  3VH5 W;  3A6N B;  1M19 A;  3AYW B;  1P3G C;  5JRG B;  5F99 B;  4J8W D;  4J8V A;  4WU8 C;  3WA9 D;  2CV5 C;  1R4V A;  3F6T A;  4YM6 D;  5AVC A;  4H9N A;  3O62 D;  5CPK C;  4YS3 D;  1ZLA A;  3WTP E;  3REI D;  5AV8 B;  2YFV B;  1KX3 C;  5DNN A;  3AFA C;  5C3I C;  3R45 A;  1P3I D;  1BH8 B;  5AV9 D;  5B31 B;  4JJN B;  1P3A C;  1EQZ B;  3X1U A;  2BG1 A;  4XZQ D;  3MGQ C;  1F1E A;  3AZE A;  3WAA B;  1W2E A;  5B32 B;  3AN2 D;  3UT9 C;  2NQB A;  4ZUX B;  5GT3 D;  5CPI A;  5BT1 C;  4Z2M G;  3A1I A;  1P3K A;  1ID3 C;  5AV8 A;  5GT0 A;  4KGC D;  5AY8 A;  4NE5 A;  2RVQ D;  1M18 A;  1BH8 A;  3B6G A;  3LZ1 C;  1N1J A;  1P3G A;  2FJ7 C;  3AZK C;  1TAF A;  1EQZ A;  2YFW A;  3LJA D;  4UUZ B;  4H9O B;  1Q9C A;  4WU8 A;  5B33 D;  3AZG D;  3AZN B;  2PYO D;  3H0M C;  2ARO B;  5CP6 B;  3X1V D;  2UWX A;  3KUY D;  3AZI B;  1TZY C;  4HGA C;  3TU4 D;  5CPK A;  5B2I D;  3W99 C;  1B6W A;  4R8P C;  3REK C;  1KX4 B;  4EO5 B;  5B24 C;  5AV6 D;  4M6B A;  3MNN C;  3REL C;  1KX3 A;  3AFA A;  3WTP D;  3X1T C;  1U35 B;  1BFM A;  2ARO D;  5DNM D;  3AZM B;  4WJ3 C;  4J8U D;  1P3A A;  5B1L C;  3LEL C;  3MGS B;  5B2J C;  3KWQ B;  3MGQ A;  3REH B;  5GXQ B;  3W98 C;  3MVD C;  3A1K A;  3X1S B;  3EPH A;  5BO0 B;  5BNX A;  1JFI A;  3W96 D;  5CP6 A;  3UT9 A;  5B40 B;  5CPJ C;  3AZI A;  5E5A D;  1P3L D;  5AVB B;  5B24 B;  4Z5T D;  2F8N A;  1H3O B;  1ID3 A;  3AV1 B;  1P3P B;  4Z66 D;  3REH D;  1P3M D;  3B6F C;  3C1B B;  3AZH D;  3UTB D;  3C1C B;  4WNN B;  4E45 A;  3LZ1 A;  3AZM A;  2FJ7 A;  3AZK A;  2FFF B;  3MGS A;  2NZD D;  3W98 B;  5KDM A;  1P3O B;  2F2A C;  4G92 C;  5B0Z D;  5B0Y C;  5G49 A;  1P3F C;  3EG5 B;  1TZY A;  5B40 A;  1WWS A;  3W99 A;  2CWE A;  4X23 B;  4R8P A;  3REK A;  1P34 C;  3W97 C;  1P3B B;  5B24 A;  3NQJ A;  3MNN A;  4H9Q A;  4KUD D;  2Y2N A;  3AZL B;  3X1T A;  3WKJ D;  4WNN A;  5BNV B;  3UTA B;  4LD9 C;  2HIO C;  5B1L A;  3LEL A;  3KXB C;  3AZF D;  2RIQ A;  3AV2 B;  3LZ0 D;  1M1A B;  3A6N C;  3AYW C;  3W98 A;  3MVD A;  5JRG C;  1P3O A;  1HQ3 B;  3REJ B;  5F99 C;  2G5H C;  3B0C W;  5CPJ A;  1Z2C B;  4WZS B;  4J8W B;  4X23 A;  3WA9 B;  4YM6 B;  2BYK B;  5AV8 C;  3B6F A;  4ZBJ B;  3REJ D;  3O62 B;  3H0R C;  4YS3 B;  4AWL C;  3REI B;  2Y2L A;  5B31 C;  4JJN C;  3AV2 A;  1S32 D;  1M1A A;  1EQZ C;  4UPK A;  3WAA C;  5B32 C;  1P3I B;  5AV9 B;  3V9R B;  5B0Y A;  1KX5 D;  1P3F A;  2Y2K A;  5B1M D;  3IP4 C;  4XZQ B;  5AV5 D;  4ZUX C;  1M19 D;  3W97 A;  1P34 A;  4J8W A;  1BH9 A;  3AL0 C;  3AN2 B;  4J8V D;  4QLC D;  5AVC D;  3KUY C;  3NQJ B;  4AWL B;  3B0C T;  2HIO A;  5GT3 B;  4LD9 A;  3KXB A;  1ULY A;  3MGR D;  4XUJ D;  1ZLA D;  3A6N A;  3AYW A;  5JRG A;  1T3U A;  4KGC B;  5F99 A;  5GSU D;  4KHA B;  1F66 D;  5DNN D;  3AZN C;  5AV9 A;  1P3I A;  2ARO C;  5CP6 C;  4H9R B;  4DQY B;  3AZI C;  3LJA B;  2Y2M A;  3VH5 T;  3MGP D;  5B33 B;  3X1U D;  3AZG B;  1WWI A;  2PYO B;  2HUE B;  3AZE D;  3X1V B;  1KX4 C;  4EO5 C;  2JE5 A;  3KUY B;  2YFV A;  3TU4 B;  1U35 C;  5B2I B;  4H9S C;  2L5A A;  5FUG B;  2NQB D; 
#chains in the Genus database with same CATH homology
 5B31 A;  4JJN A;  5CPI D;  5AV6 B;  3MGS C;  3KWQ C;  3VH6 W;  3WTP B;  3REH C;  3WAA A;  5GXQ C;  5B32 A;  5GT0 D;  4KGC A;  5DNM B;  3X1S C;  5AY8 D;  4J8U B;  1M18 D;  5B40 C;  4H9R A;  3B6G D;  3AZM C;  4ZUX A;  2XD5 A;  1P3G D;  2Y2G A;  5AVB C;  5B33 A;  3AZG A;  3AV1 C;  4WU8 D;  2CV5 D;  1P3P C;  3W96 B;  4Z2M H;  3KUY A;  4WU9 B;  3C1B C;  5E5A B;  3C1C C;  1P3L B;  5CPK D;  5FUG A;  4Z5T B;  4Z66 B;  1P3M B;  1AOI D;  3AZH B;  3UTB B;  1P3O C;  4UUZ A;  1KU5 A;  4H9O A;  1KX3 D;  3AFA D;  3AZN A;  2Y2I A;  2ARO A;  5DNM A;  4J8U A;  4WU9 D;  2NZD B;  4CAY B;  1P3A D;  3NQU B;  3MGQ D;  4X23 C;  4J8X B;  5B0Z B;  1P3B C;  1KX4 A;  3VH6 T;  3AZL C;  1U35 A;  3UT9 D;  4H9S A;  3UTA C;  2BYM B;  4H9P B;  5BT1 D;  3KWQ A;  3AV2 C;  4KUD B;  1M1A C;  2F8N D;  1ID3 D;  4Z66 A;  3REH A;  3AZJ B;  5GXQ A;  3UTB A;  3WKJ B;  3X1S A;  1HQ3 C;  4J8X D;  5BO0 A;  3REJ C;  2LY8 A;  3AZF B;  3LZ0 B;  3LZ1 D;  2F8N G;  5CHL B;  5AVB A;  4J8W C;  1H3O A;  3WA9 C;  3AV1 A;  1P3P A;  4YM6 C;  3AZJ D;  3C1B A;  3C1C A;  4ZBJ C;  1TZY D;  3O62 C;  4YS3 C;  3W99 D;  3REI C;  3B0D B;  2IO5 B;  2ZM5 A;  4R8P D;  3REK D;  4KUD A;  3MNN D;  3REL D;  3WKJ A;  3X1T D;  1P3I C;  5AV9 C;  4NE6 A;  1S32 B;  5B1L D;  2XD1 A;  5B2J D;  2ZY3 A;  4XZQ C;  4WV4 B;  1P3B A;  3MVD D;  1KX5 B;  5B1M B;  3AZL A;  4CSR B;  3AN2 C;  5CPJ D;  5AV5 B;  3UTA A;  5BNV A;  1M19 B;  5GT3 C;  4J8V B;  4QLC B;  2Y2Q A;  5AVC B;  1HQ3 A;  3REJ A;  4KGC C;  3EPJ A;  2RVQ C;  3MGR B;  4H9N B;  4XUJ B;  1ZLA B;  3LJA C;  5GSU B;  3WA9 A;  5BS7 C;  5B33 C;  5DNN B;  4YM6 A;  2BYK A;  3AZG C;  2HUE C;  1F66 B;  2PYO C;  3X1V C;  3R45 B;  5B1M A;  1B67 A;  5B0Y D;  1P3F D;  3P5J B;  3O62 A;  3TU4 C;  4YS3 A;  2ZY2 A;  5B2I C;  3MGP B;  3REI A;  3X1U B;  4E44 A;  3AZE B;  3W97 D;  1P34 D;  4G91 B;  5AV6 C;  4NFT A;  4QLC A;  3WTP C;  1HTA A;  3V9R A;  3H0L C;  5DNM C;  2NQB B;  4J8U C;  2DQN C;  3MGR A;  2HIO D;  4XUJ A;  5CPI B;  4LD9 D;  3KXB D;  4XZQ A;  3A6N D;  1P3K B;  5GT0 B;  3AYW D;  5GSU A;  1AOI C;  5JRG D;  1A7W A;  5AY8 B;  5F99 D;  1F66 A;  3AN2 A;  2G5I C;  3W96 C;  1M18 B;  3KSY A;  3B6G B;  4WU9 C;  5E5A C;  1N1J B;  5GT3 A;  1P3G B;  1P3L C;  1TAF B;  4DRA A;  2YFW B;  3MGP A;  4Z5T C;  4WU8 B;  2CV5 B;  1P3K D;  4Z66 C;  1P3M C;  5AV8 D;  3AZH C;  3UTB C;  4KHA A;  4DRB A;  5CPK B;  2NZD C;  5B31 D;  3LJA A;  4JJN D;  1AOI B;  1EQZ D;  5BS7 A;  1KX3 B;  3AFA B;  5C3I B;  2PYO A;  4J8X C;  3X1V A;  5B0Z C;  5B32 D;  3WAA D;  5B31 G;  1P3A B;  3TU4 A;  5B2I A;  3MGQ B;  3EPL A;  4ZUX D;  5B32 G;  5AV6 A;  2ZY4 A;  4KUD C;  2CV5 A;  5BNX B;  3B0B A;  3WTP A;  3AZJ C;  1JFI B;  3UT9 B;  3WKJ C;  2JCH A;  3VH5 A;  3AZF C;  3LZ0 C;  2F8N K;  2F8N B;  1ID3 B;  1AOI A;  2DF4 C;  3W96 A;  3AZN D;  3LZ1 B;  5CP6 D;  4WU9 A;  5E5A A;  2FJ7 B;  3AZI D;  1P3L A;  3AZK B;  2JSS A;  2Y2P A;  5KDM B;  4Z5T A;  3B0D C;  2IO5 C;  1P3M A;  3AZH A;  3FDD A;  1KX4 D;  5G49 B;  1TZY B;  2Y2O A;  4HGA B;  1U35 D;  3W99 B;  2VQR A;  3AZM D;  2NZD A;  4R8P B;  4CAY A;  2FJ7 D;  3REK B;  1S32 C;  3AZK D;  3NQU A;  3MNN B;  3MGS D;  3KWQ D;  4H9Q B;  3REL B;  4J8X A;  3X1T B;  5GXQ D;  5JA4 B;  5B0Z A;  1KX5 C;  3X1S D;  5B1M C;  3EPK A;  2ZY5 A;  5B1L B;  3LEL B;  5B2J B;  5B40 D;  5AV5 C;  2BYM A;  2Y2J A;  1M19 C;  2Y2H A;  3MVD B;  4H9P A;  5AVB D;  5B24 D;  4J8V C;  3AZJ A;  4QLC C;  3AV1 D;  1P3P D;  5AVC C;  5CPJ B;  3C1B D;  3C1C D;  3AZF A;  3MGR C;  4XUJ C;  3LZ0 A;  3LEL D;  1ZLA C;  3VH6 A;  3B6F B;  5GSU C;  2F8N H;  3REL A;  3W98 D;  1P3O D;  1F66 C;  5DNN C;  5JA4 A;  5B2J A;  3MGP C;  1PZR A;  3X1U C;  4X23 D;  3AZE C;  4G92 B;  4G91 C;  1P3B D;  5B0Y B;  1P3F B;  3B6F D;  4NE3 A;  3AZL D;  2NQB C;  3UTA D;  3KFU G;  1S32 A;  1P34 B;  3W97 B;  5CPI C;  1BH9 B;  3AV2 D;  1M1A D;  1P3K C;  5GT0 C;  1KX5 A;  1HQ3 D;  5AY8 C;  2J8P A;  4CSR A;  4LD9 B;  2HIO B;  1M18 C;  3KXB B;  3B6G C;  2W8S A;  5AV5 A;  3VH5 W;  3A6N B;  1M19 A;  3AYW B;  1P3G C;  5JRG B;  5F99 B;  4J8W D;  4J8V A;  4WU8 C;  3WA9 D;  2CV5 C;  1R4V A;  3F6T A;  4YM6 D;  5AVC A;  4H9N A;  3O62 D;  5CPK C;  4YS3 D;  1ZLA A;  3WTP E;  3REI D;  5AV8 B;  2YFV B;  1KX3 C;  5DNN A;  3AFA C;  5C3I C;  3R45 A;  1P3I D;  1BH8 B;  5AV9 D;  5B31 B;  4JJN B;  1P3A C;  1EQZ B;  3X1U A;  2BG1 A;  4XZQ D;  3MGQ C;  1F1E A;  3AZE A;  3WAA B;  1W2E A;  5B32 B;  3AN2 D;  3UT9 C;  2NQB A;  4ZUX B;  5GT3 D;  5CPI A;  5BT1 C;  4Z2M G;  3A1I A;  1P3K A;  1ID3 C;  5AV8 A;  5GT0 A;  4KGC D;  5AY8 A;  4NE5 A;  2RVQ D;  1M18 A;  1BH8 A;  3B6G A;  3LZ1 C;  1N1J A;  1P3G A;  2FJ7 C;  3AZK C;  1TAF A;  1EQZ A;  2YFW A;  3LJA D;  4UUZ B;  4H9O B;  1Q9C A;  4WU8 A;  5B33 D;  3AZG D;  3AZN B;  2PYO D;  3H0M C;  2ARO B;  5CP6 B;  3X1V D;  2UWX A;  3KUY D;  3AZI B;  1TZY C;  4HGA C;  3TU4 D;  5CPK A;  5B2I D;  3W99 C;  1B6W A;  4R8P C;  3REK C;  1KX4 B;  4EO5 B;  5B24 C;  5AV6 D;  4M6B A;  3MNN C;  3REL C;  1KX3 A;  3AFA A;  3WTP D;  3X1T C;  1U35 B;  1BFM A;  2ARO D;  5DNM D;  3AZM B;  4WJ3 C;  4J8U D;  1P3A A;  5B1L C;  3LEL C;  3MGS B;  5B2J C;  3KWQ B;  3MGQ A;  3REH B;  5GXQ B;  3W98 C;  3MVD C;  3A1K A;  3X1S B;  3EPH A;  5BO0 B;  5BNX A;  1JFI A;  3W96 D;  5CP6 A;  3UT9 A;  5B40 B;  5CPJ C;  3AZI A;  5E5A D;  1P3L D;  5AVB B;  5B24 B;  4Z5T D;  2F8N A;  1H3O B;  1ID3 A;  3AV1 B;  1P3P B;  4Z66 D;  3REH D;  1P3M D;  3B6F C;  3C1B B;  3AZH D;  3UTB D;  3C1C B;  4WNN B;  4E45 A;  3LZ1 A;  3AZM A;  2FJ7 A;  3AZK A;  2FFF B;  3MGS A;  2NZD D;  3W98 B;  5KDM A;  1P3O B;  2F2A C;  4G92 C;  5B0Z D;  5B0Y C;  5G49 A;  1P3F C;  3EG5 B;  1TZY A;  5B40 A;  1WWS A;  3W99 A;  2CWE A;  4X23 B;  4R8P A;  3REK A;  1P34 C;  3W97 C;  1P3B B;  5B24 A;  3NQJ A;  3MNN A;  4H9Q A;  4KUD D;  2Y2N A;  3AZL B;  3X1T A;  3WKJ D;  4WNN A;  5BNV B;  3UTA B;  4LD9 C;  2HIO C;  5B1L A;  3LEL A;  3KXB C;  3AZF D;  2RIQ A;  3AV2 B;  3LZ0 D;  1M1A B;  3A6N C;  3AYW C;  3W98 A;  3MVD A;  5JRG C;  1P3O A;  1HQ3 B;  3REJ B;  5F99 C;  2G5H C;  3B0C W;  5CPJ A;  1Z2C B;  4WZS B;  4J8W B;  4X23 A;  3WA9 B;  4YM6 B;  2BYK B;  5AV8 C;  3B6F A;  4ZBJ B;  3REJ D;  3O62 B;  3H0R C;  4YS3 B;  4AWL C;  3REI B;  2Y2L A;  5B31 C;  4JJN C;  3AV2 A;  1S32 D;  1M1A A;  1EQZ C;  4UPK A;  3WAA C;  5B32 C;  1P3I B;  5AV9 B;  3V9R B;  5B0Y A;  1KX5 D;  1P3F A;  2Y2K A;  5B1M D;  3IP4 C;  4XZQ B;  5AV5 D;  4ZUX C;  1M19 D;  3W97 A;  1P34 A;  4J8W A;  1BH9 A;  3AL0 C;  3AN2 B;  4J8V D;  4QLC D;  5AVC D;  3KUY C;  3NQJ B;  4AWL B;  3B0C T;  2HIO A;  5GT3 B;  4LD9 A;  3KXB A;  1ULY A;  3MGR D;  4XUJ D;  1ZLA D;  3A6N A;  3AYW A;  5JRG A;  1T3U A;  4KGC B;  5F99 A;  5GSU D;  4KHA B;  1F66 D;  5DNN D;  3AZN C;  5AV9 A;  1P3I A;  2ARO C;  5CP6 C;  4H9R B;  4DQY B;  3AZI C;  3LJA B;  2Y2M A;  3VH5 T;  3MGP D;  5B33 B;  3X1U D;  3AZG B;  1WWI A;  2PYO B;  2HUE B;  3AZE D;  3X1V B;  1KX4 C;  4EO5 C;  2JE5 A;  3KUY B;  2YFV A;  3TU4 B;  1U35 C;  5B2I B;  4H9S C;  2L5A A;  5FUG B;  2NQB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...