5B2JA

Human nucleosome containing cpg methylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2jA00
2NQBD 1P34B 5CP6C 3B6FB 1P3OC 5CPIA 1ID3B 4Z66C 1EQZB 3WTPA 3O62A 1S32C 5B0ZB 5GT3D 5B0YD 5B1LC 3MGSD 3AN2D 3C1CD 3AYWC 3AZGC 1KX4D 4LD9C 3UT9C 3WTPB 3O62B 2NQBC 2FJ7A 3MGRD 2IO5C 4G91B 3MGPA 5AVBA 3W96A 5B40A 1KX5D 2FJ7B 3MGSC 3AN2C 1M18D 3MNNA 5DNMA 1P3IC 3MGPB 3W97D 5AVBB 3W96B 5B40B 4YM6D 2L5AA 3MNNB 3KWQD 5DNMB 1KX5C 4ZUXC 3AZIA 1M18C 4H9OA 5CHLB 4WU9A 3REJD 3RELA 3AZIB 3WAAD 4H9OB 4YM6C 3MVDC 3KWQC 5AY8A 4WU9B 1BH9A 3RELB 5KDMA 3KXBA 3A6NA 3REJC 5DNNA 4WZSB 5AY8B 5AV8A 1BH9B 3WAAC 5GXQA 4QLCA 5KDMB 3KXBB 3A6NB 2PYOD 5DNNB 2BYKA 5AV8B 5B2JA 3REHD 1P3MA 5GXQB 3KUYA 3VH5W 4QLCB 1HTAA 2BYKB 3LELC 5B2JB 5B33C 5GT3A 3AZNA 2RVQD 5B0YA 1P3MB 2PYOC 1TAFA 3KUYB 3C1CA 1KX4A 3W99D 3MGQC 3AZHD 3AZMA 3AZNB 5GT3B 5B0YB 3MGRA 1TAFB 5AVCC 3C1CB 1P34D 1KX4B 3B6FD 2RVQC 4X23C 1EQZD 1P3GC 3NQUA 3AZMB 1WWIA 5B0ZD 1M1AA 3MGRB 3W99C 3W97A 3AZHC 4J8VA 3WTPD 3O62D 3NQUB 1P34C 3B6FC 1M1AB 1ID3C 1EQZC 3REKA 4J8VB 5B0ZC 4J8UB 5CPIC 3REKB 4DRBA 3WTPC 3O62C 5AVBD 3W96D 5B40D 3TU4B 4G91C 4CAYA 3MNND 3AFAA 2FJ7C 3W98A 5FUGA 3MGPC 4CAYB 5AVBC 3W96C 5B32A 5B40C 3AFAB 3W98B 3AZID 5FUGB 3REHA 3MNNC 5DNMC 4WU9D 3RELD 3AZKA 5B32B 4JJNA 2CV5D 3REHB 3WTPE 3B0CT 4ZBJB 5AY8D 3AZIC 3AZKB 5JRGA 5B1MA 4JJNB 1P3AA 5AV6A 4WU9C 3A6ND 1JFIA 3RELC 5DNND 4M6BA 5BNVA 1P3BA 1TZYD 4E44A 5JRGB 5GXQD 5B1MB 4QLCD 1P3AB 5AY8C 5AV6B 5G49A 1JFIB 5BNVB 5B2JD 1P3BB 1P3MD 3KXBC 3A6NC 5DNNC 3KUYD 3X1SA 5AV8C 5G49B 1U35D 5GXQC 3WA9A 4QLCC 3AZND 3X1SB 5B2JC 3AV2A 1AOIA 1BFMA 2HUEB 5BNXA 1P3MC 1P3LD 3WA9B 3VH6T 3KUYC 3AZMD 4Z5TA 4J8XA 5BT1D 4UUZA 3X1TD 3AZEA 3AZNC 3AV2B 5GT3C 1AOIB 5B0YC 5BNXB 3C1CC 1KX4C 4Z5TB 4J8XB 1WWSA 1M1AD 4UUZB 3AZMC 3AZEB 4J8VD 5B31A 4J8UD 3MGRC 5BT1C 1P3KD 3X1VA 3REKD 1B6WA 3X1UA 4NE6A 5B31B 1M1AC 1B67A 4H9RA 3W97C 3TU4D 3X1VB 4J8VC 4J8UC 3X1UB 2CV5A 1ULYA 4H9RB 3REKC 4HGAC 5B24A 4Z2MG 2CV5B 3AFAD 3W98D 5AV5D 3AZFD 1TZYA 5B24B 5B32D 5JA4A 1TZYB 1HQ3A 2BYMA 3AFAC 3W98C 3AZKD 4JJND 1U35A 5JA4B 1HQ3B 5E5AA 5B32C 2BYMB 4G92B 3AZGD 3REHC 5JRGD 5B1MD 1P3AD 4ZBJC 5BO0B 5AV6D 1U35B 1P3LA 3AZKC 5E5AB 4JJNC 1P3BD 2NZDA 3X1TA 1F66D 1P3LB 4WNNA 5GSUA 5JRGC 5B1MC 1P3AC 5AV6C 2NZDB 3X1TB 4J8UA 3X1SD 1P3BC 4NFTA 4WNNB 3B0CW 5GSUB 1P3KA 3WA9D 3LZ1A 4J8WA 3AV2D 1AOID 3B6GA 3TU4A 1P3KB 3X1SC 4Z5TD 4J8XD 2HUEC 5B32G 3LZ1B 3AV1A 1M19A 3WA9C 4J8WB 4NE5A 3AZED 3B6GB 3AV2C 1AOIC 3AV1B 1M19B 1R4VA 5AV5A 4Z5TC 5B31D 4J8XC 3AZFA 4KGCA 1A7WA 3AZEC 3X1VD 3VH5A 4NE3A 3X1UD 5AV5B 3UTAA 3AZFB 4KGCB 3VH6W 4H9QB 1P3PA 1BH8A 5CPJA 2F8NH 5B31C 3AZJB 5F99A 3UTAB 3X1VC 1ZLAA 1P3PB 1BH8B 3X1UC 5CPJB 5B24D 4KHAA 5F99B 3AZLA 3WKJD 1ZLAB 4R8PA 2CV5C 3C1BA 4XZQA 1F66A 2HIOA 4KHAB 4XUJD 1KX3A 5B24C 3AZLB 4R8PB 1HQ3D 5AV9A 3C1BB 4XZQB 1F66B 2HIOB 1TZYC 1F1EA 1KX3B 5C3IB 5E5AD 5AV9B 2YFVA 4CSRA 1P3FA 2LY8A 1HQ3C 5CPKA 4G92C 1P3OD 2F8NA 2NZDD 2YFVB 4CSRB 1U35C 1P3FB 5E5AC 5CPKB 4E45A 2F8NB 5GSUD 3LJAA 4LD9D 3UT9D 1P3LC 2NZDC 3VH6A 3LJAB 3X1TC 4WU8A 5GSUC 5CPIB 3LZ1D 3B0DB 4J8WD 1P3ID 3B0BA 3B6GD 4WU8B 3REIA 3AV1D 1M19D 1P3KC 4ZUXD 3LZ1C 4J8WC 3REIB 3B6GC 4KUDA 3TU4C 5BS7A 4Z2MH 2CWEA 3WKJA 4KGCD 3AV1C 1M19C 3MVDD 4XUJA 4KUDB 5B2IA 3AZJD 3UTAD 3WKJB 3LZ0A 4YS3A 1P3PD 5AV5C 5CPJD 4XUJB 3AZFC 4KGCC 5B2IB 1H3OA 5BO0A 5F99D 3UTBA 3LZ0B 4YS3B 4H9SA 4AWLB 1ZLAD 3AZJC 2JSSA 2AROA 4EO5B 5GT0A 3UTAC 3NQJA 3V9RA 5CP6A 1H3OB 1P3OA 1P3PC 3UTBB 5CPJC 4Z66A 3AZLD 4R8PD 1S32A 5F99C 5GT0B 2AROB 4XZQD 3LELD 3C1BD 5B33D 2HIOD 3NQJB 1KU5A 4WV4B 3V9RB 3R45A 5CP6B 1P3OB 5B1LA 1ZLAC 3AYWA 4LD9A 4H9NA 4Z66B 3AZGA 1KX3D 3UT9A 2NQBA 3MGQD 5AV9D 1S32B 3AZLC 3R45B 4R8PC 5B1LB 5AVCD 4XZQC 4H9NB 3C1BC 3AYWB 3AZGB 3UT9B 1F66C 2HIOC 4X23D 4LD9B 2NQBB 1P3GD 3MGSA 3AN2A 1KX3C 5C3IC 1P3FD 2IO5B 1P3IA 5AV9C 5CPKD 2F8ND 3MGSB 3AN2B 1KX5A 4ZUXA 4H9PA 1ID3D 1P3IB 2F8NK 1M18A 3LJAD 1P3FC 5CPKC 5CPID 1KX5B 4ZUXB 4H9PB 1M18B 3KSYA 4YM6A 4H9QA 3MVDA 3KWQA 3W97B 3AZJA 4WU8D 3LJAC 4YM6B 2FJ7D 3REJA 3MVDB 3KWQB 2AROC 3B0DC 4HGAB 3VH5T 3WAAA 3REID 4DRAA 3MGPD 3REJB 4WU8C 5DNMD 3WAAB 4KUDD 3REIC 3LELA 5B33A 2YFWA 2PYOA 5B2ID 2F8NG 3LZ0D 4YS3D 3MGQA 4KUDC 3LELB 5BS7C 2YFWB 5B33B 3WKJC 2PYOB 5AVCA 1N1JA 4X23A 3UTBD 3MGQB 1P3GA 4XUJC 5B2IC 5GT0D 2AROD 3LZ0C 4YS3C 3W99A 5AVCB 5CP6D 3KXBD 5B31G 4AWLC 3AZHA 1N1JB 4X23B 4Z66D 4EO5C 5AV8D 1P3GB 1P34A 1Q9CA 3B6FA 1S32D 3UTBC 1ID3A 1EQZA 3W99B 4H9SC 3AZHB 5B1LD 3AYWD 5GT0C 5B0ZA
chains in the Genus database with same CATH superfamily
2NQBD 1P34B 2XD1A 5CP6C 3B6FB 1P3OC 5CPIA 1ID3B 4Z66C 1EQZB 3WTPA 3O62A 1S32C 5B0ZB 5GT3D 2ZY4A 5B0YD 5B1LC 3MGSD 3AN2D 3C1CD 3AYWC 3AZGC 1KX4D 4LD9C 3UT9C 3WTPB 3O62B 2NQBC 2FJ7A 3MGRD 2IO5C 4G91B 3MGPA 5AVBA 3W96A 5B40A 1KX5D 2FJ7B 3MGSC 3AN2C 1M18D 3MNNA 2FFFB 5DNMA 1P3IC 3MGPB 3W97D 5AVBB 3W96B 5B40B 4YM6D 2L5AA 2ZM5A 3MNNB 3KWQD 5DNMB 1KX5C 4ZUXC 3AZIA 1M18C 4H9OA 5CHLB 4WU9A 3REJD 3RELA 3AZIB 3WAAD 4H9OB 4YM6C 2Y2KA 3MVDC 3KWQC 5AY8A 4WU9B 1BH9A 3RELB 2VQRA 5KDMA 3KXBA 3A6NA 3REJC 5DNNA 4WZSB 5AY8B 5AV8A 1BH9B 3WAAC 5GXQA 4QLCA 5KDMB 3KXBB 3A6NB 2PYOD 5DNNB 2BYKA 5AV8B 5B2JA 3REHD 1P3MA 5GXQB 3KUYA 3VH5W 4QLCB 1HTAA 2BYKB 3LELC 5B2JB 5B33C 5GT3A 3AZNA 2RVQD 5B0YA 1P3MB 2Y2OA 2PYOC 1TAFA 3KUYB 3C1CA 1KX4A 3W99D 3MGQC 3AZHD 3AZMA 3AZNB 2J8PA 5GT3B 5B0YB 3MGRA 1TAFB 5AVCC 3C1CB 1P34D 1KX4B 3B6FD 2RVQC 4X23C 1EQZD 1P3GC 3NQUA 3AZMB 1WWIA 5B0ZD 1M1AA 3MGRB 3W99C 3W97A 3FDDA 3AZHC 4J8VA 3WTPD 3O62D 3NQUB 1P34C 3B6FC 1PZRA 1M1AB 1ID3C 1EQZC 3REKA 3KFUG 4J8VB 5B0ZC 4J8UB 5CPIC 3REKB 4DRBA 3WTPC 3O62C 5AVBD 3W96D 5B40D 3EG5B 3TU4B 4G91C 4CAYA 3MNND 4DQYB 3AFAA 2FJ7C 3W98A 5FUGA 3MGPC 4CAYB 5AVBC 3W96C 5B32A 5B40C 3AFAB 3W98B 3AZID 5FUGB 3REHA 3MNNC 5DNMC 4WU9D 3RELD 3AZKA 5B32B 4JJNA 2CV5D 3REHB 3WTPE 3B0CT 2DQNC 4ZBJB 5AY8D 3AZIC 3AZKB 5JRGA 5B1MA 4JJNB 1P3AA 5AV6A 4WU9C 3A6ND 1JFIA 3RELC 5DNND 4M6BA 5BNVA 1P3BA 1TZYD 3A1KA 4E44A 5JRGB 5GXQD 5B1MB 4QLCD 1P3AB 5AY8C 5AV6B 5G49A 1JFIB 2F2AC 1T3UA 5BNVB 5B2JD 1P3BB 1P3MD 3KXBC 3A6NC 5DNNC 3KUYD 3X1SA 5AV8C 5G49B 1U35D 5GXQC 3WA9A 4QLCC 3AZND 3X1SB 5B2JC 3AV2A 1AOIA 1BFMA 2HUEB 5BNXA 1P3MC 1P3LD 3WA9B 3VH6T 3KUYC 3AZMD 4Z5TA 4J8XA 5BT1D 4UUZA 3X1TD 3AZEA 3AZNC 3AV2B 5GT3C 1AOIB 5B0YC 5BNXB 3C1CC 1KX4C 4Z5TB 4J8XB 1WWSA 1M1AD 4UUZB 3AZMC 3AZEB 4J8VD 5B31A 4J8UD 3MGRC 5BT1C 1P3KD 3X1VA 3REKD 1B6WA 3X1UA 4NE6A 5B31B 1M1AC 1B67A 4H9RA 3W97C 3TU4D 3X1VB 4J8VC 4J8UC 2G5IC 2JE5A 3X1UB 2CV5A 1ULYA 4H9RB 3REKC 4HGAC 5B24A 4Z2MG 2CV5B 3AFAD 3EPJA 3W98D 5AV5D 3AZFD 1TZYA 5B24B 5B32D 5JA4A 1TZYB 1HQ3A 2BYMA 3AFAC 3W98C 3AZKD 4JJND 1U35A 5JA4B 1HQ3B 5E5AA 5B32C 2BYMB 4G92B 3AZGD 3AL0C 3REHC 5JRGD 5B1MD 1P3AD 5AV6D 4ZBJC 5BO0B 1U35B 1P3LA 3AZKC 5E5AB 4JJNC 1P3BD 2NZDA 3X1TA 1F66D 1P3LB 4WNNA 5GSUA 2JCHA 5JRGC 2Y2GA 5B1MC 1P3AC 5AV6C 2NZDB 3X1TB 4J8UA 3X1SD 1P3BC 4NFTA 4WNNB 3B0CW 5GSUB 1P3KA 3WA9D 3LZ1A 4J8WA 3AV2D 1AOID 3B6GA 3TU4A 1P3KB 3X1SC 4Z5TD 4J8XD 2HUEC 5B32G 3LZ1B 3AV1A 1M19A 3WA9C 4J8WB 4NE5A 3AZED 3B6GB 3AV2C 1AOIC 3AV1B 1M19B 1R4VA 5AV5A 4Z5TC 5B31D 4J8XC 3AZFA 4KGCA 1A7WA 3AZEC 3X1VD 3VH5A 4NE3A 3X1UD 5AV5B 3UTAA 3AZFB 4KGCB 3VH6W 4H9QB 1P3PA 1BH8A 5CPJA 2F8NH 5B31C 2RIQA 3AZJB 5F99A 3UTAB 3X1VC 1ZLAA 1P3PB 1BH8B 3X1UC 5CPJB 5B24D 4KHAA 5F99B 1Z2CB 3AZLA 3WKJD 1ZLAB 4R8PA 2CV5C 3C1BA 4XZQA 1F66A 2HIOA 4KHAB 4XUJD 1KX3A 5B24C 3AZLB 4R8PB 1HQ3D 5AV9A 3C1BB 4XZQB 1F66B 2HIOB 3H0LC 1TZYC 1F1EA 1KX3B 5C3IB 5E5AD 5AV9B 2Y2JA 2YFVA 4CSRA 2UWXA 2Y2NA 2LY8A 3H0RC 1P3FA 2Y2MA 1HQ3C 5CPKA 4G92C 1P3OD 2F8NA 2NZDD 2YFVB 4CSRB 1U35C 1P3FB 3P5JB 3H0MC 5E5AC 5CPKB 2XD5A 4E45A 2F8NB 5GSUD 3LJAA 4LD9D 3UT9D 3A1IA 1P3LC 2NZDC 3VH6A 3LJAB 3X1TC 2ZY2A 4WU8A 5GSUC 5CPIB 3LZ1D 3B0DB 4J8WD 1P3ID 3B0BA 3B6GD 4WU8B 3REIA 2Y2PA 3AV1D 3IP4C 1M19D 1P3KC 4ZUXD 3LZ1C 4J8WC 3REIB 3B6GC 4KUDA 3TU4C 5BS7A 4Z2MH 2CWEA 3WKJA 2DF4C 4KGCD 3AV1C 1M19C 3MVDD 4XUJA 4KUDB 5B2IA 3AZJD 3UTAD 3WKJB 2G5HC 3LZ0A 4YS3A 1P3PD 5AV5C 5CPJD 4XUJB 3AZFC 2W8SA 5B2IB 4KGCC 1H3OA 5BO0A 2Y2IA 5F99D 3UTBA 3LZ0B 4YS3B 4H9SA 2Y2HA 4AWLB 1ZLAD 3AZJC 2JSSA 2AROA 4EO5B 5GT0A 3UTAC 3NQJA 3V9RA 5CP6A 1H3OB 1P3OA 1P3PC 3UTBB 2ZY3A 4Z66A 5CPJC 3AZLD 4R8PD 1S32A 5F99C 5GT0B 2AROB 4XZQD 3LELD 3C1BD 5B33D 2HIOD 3NQJB 1KU5A 4WV4B 3V9RB 3R45A 5CP6B 1P3OB 5B1LA 1ZLAC 3AYWA 4LD9A 4H9NA 4Z66B 3AZGA 1KX3D 3UT9A 2NQBA 3MGQD 5AV9D 1S32B 3EPLA 3AZLC 3R45B 4R8PC 5B1LB 5AVCD 4XZQC 4H9NB 3C1BC 3AYWB 3AZGB 3UT9B 1F66C 2HIOC 4X23D 4LD9B 2NQBB 1P3GD 3MGSA 3AN2A 1KX3C 5C3IC 1P3FD 2IO5B 1P3IA 5AV9C 5CPKD 2F8ND 1W2EA 3MGSB 3AN2B 1KX5A 4ZUXA 4H9PA 1ID3D 1P3IB 2F8NK 1M18A 3LJAD 1P3FC 5CPKC 5CPID 1KX5B 4ZUXB 4H9PB 1M18B 3KSYA 4YM6A 4H9QA 3MVDA 3KWQA 3W97B 3AZJA 4WU8D 3LJAC 4YM6B 2FJ7D 3REJA 3MVDB 3KWQB 4UPKA 3B0DC 2AROC 4HGAB 3VH5T 3WAAA 3REID 2Y2LA 4DRAA 3MGPD 3REJB 4WU8C 3EPHA 5DNMD 3WAAB 4KUDD 3EPKA 3REIC 3LELA 5B33A 2YFWA 2PYOA 5B2ID 4WJ3C 2F8NG 3LZ0D 4YS3D 3MGQA 4KUDC 2Y2QA 3LELB 5BS7C 2YFWB 5B33B 3WKJC 2PYOB 2ZY5A 5AVCA 1N1JA 4X23A 3UTBD 3MGQB 1P3GA 4XUJC 5B2IC 5GT0D 2AROD 3LZ0C 4YS3C 3W99A 5AVCB 5CP6D 3KXBD 5B31G 2BG1A 4AWLC 3AZHA 1N1JB 4X23B 4Z66D 4EO5C 5AV8D 1P3GB 3F6TA 1P34A 1Q9CA 3B6FA 1S32D 3UTBC 1ID3A 1EQZA 3W99B 4H9SC 3AZHB 5B1LD 3AYWD 5GT0C 5B0ZA
chains in the Genus database with same CATH topology
2NQBD 1P34B 2XD1A 5CP6C 3B6FB 1P3OC 5CPIA 1ID3B 4Z66C 1EQZB 3WTPA 3O62A 1S32C 5B0ZB 5GT3D 2ZY4A 5B0YD 5B1LC 3MGSD 3AN2D 3C1CD 3AYWC 3AZGC 1KX4D 4LD9C 3UT9C 3WTPB 3O62B 2NQBC 2FJ7A 3MGRD 2IO5C 4G91B 3MGPA 5AVBA 3W96A 5B40A 1KX5D 2FJ7B 3MGSC 3AN2C 1M18D 3MNNA 2FFFB 5DNMA 1P3IC 3MGPB 3W97D 5AVBB 3W96B 5B40B 4YM6D 2L5AA 2ZM5A 3MNNB 3KWQD 5DNMB 1KX5C 4ZUXC 3AZIA 1M18C 4H9OA 5CHLB 4WU9A 3REJD 3RELA 3AZIB 3WAAD 4H9OB 4YM6C 2Y2KA 3MVDC 3KWQC 5AY8A 4WU9B 1BH9A 3RELB 2VQRA 5KDMA 3KXBA 3A6NA 3REJC 5DNNA 4WZSB 5AY8B 5AV8A 1BH9B 3WAAC 5GXQA 4QLCA 5KDMB 3KXBB 3A6NB 2PYOD 5DNNB 2BYKA 5AV8B 5B2JA 3REHD 1P3MA 5GXQB 3KUYA 3VH5W 4QLCB 1HTAA 2BYKB 3LELC 5B2JB 5B33C 5GT3A 3AZNA 2RVQD 5B0YA 1P3MB 2Y2OA 2PYOC 1TAFA 3KUYB 3C1CA 1KX4A 3W99D 3MGQC 3AZHD 3AZMA 3AZNB 2J8PA 5GT3B 5B0YB 3MGRA 1TAFB 5AVCC 3C1CB 1P34D 1KX4B 3B6FD 2RVQC 4X23C 1EQZD 1P3GC 3NQUA 3AZMB 1WWIA 5B0ZD 1M1AA 3MGRB 3W99C 3W97A 3FDDA 3AZHC 4J8VA 3WTPD 3O62D 3NQUB 1P34C 3B6FC 1PZRA 1M1AB 1ID3C 1EQZC 3REKA 3KFUG 4J8VB 5B0ZC 4J8UB 5CPIC 3REKB 4DRBA 3WTPC 3O62C 5AVBD 3W96D 5B40D 3EG5B 3TU4B 4G91C 4CAYA 3MNND 4DQYB 3AFAA 2FJ7C 3W98A 5FUGA 3MGPC 4CAYB 5AVBC 3W96C 5B32A 5B40C 3AFAB 3W98B 3AZID 5FUGB 3REHA 3MNNC 5DNMC 4WU9D 3RELD 3AZKA 5B32B 4JJNA 2CV5D 3REHB 3WTPE 3B0CT 2DQNC 4ZBJB 5AY8D 3AZIC 3AZKB 5JRGA 5B1MA 4JJNB 1P3AA 5AV6A 4WU9C 3A6ND 1JFIA 3RELC 5DNND 4M6BA 5BNVA 1P3BA 1TZYD 3A1KA 4E44A 5JRGB 5GXQD 5B1MB 4QLCD 1P3AB 5AY8C 5AV6B 5G49A 1JFIB 2F2AC 1T3UA 5BNVB 5B2JD 1P3BB 1P3MD 3KXBC 3A6NC 5DNNC 3KUYD 3X1SA 5AV8C 5G49B 1U35D 5GXQC 3WA9A 4QLCC 3AZND 3X1SB 5B2JC 3AV2A 1AOIA 1BFMA 2HUEB 5BNXA 1P3MC 1P3LD 3WA9B 3VH6T 3KUYC 3AZMD 4Z5TA 4J8XA 5BT1D 4UUZA 3X1TD 3AZEA 3AZNC 3AV2B 5GT3C 1AOIB 5B0YC 5BNXB 3C1CC 1KX4C 4Z5TB 4J8XB 1WWSA 1M1AD 4UUZB 3AZMC 3AZEB 4J8VD 5B31A 4J8UD 3MGRC 5BT1C 1P3KD 3X1VA 3REKD 1B6WA 3X1UA 4NE6A 5B31B 1M1AC 1B67A 4H9RA 3W97C 3TU4D 3X1VB 4J8VC 4J8UC 2G5IC 2JE5A 3X1UB 2CV5A 1ULYA 4H9RB 3REKC 4HGAC 5B24A 4Z2MG 2CV5B 3AFAD 3EPJA 3W98D 5AV5D 3AZFD 1TZYA 5B24B 5B32D 5JA4A 1TZYB 1HQ3A 2BYMA 3AFAC 3W98C 3AZKD 4JJND 1U35A 5JA4B 1HQ3B 5E5AA 5B32C 2BYMB 4G92B 3AZGD 3AL0C 3REHC 5JRGD 5B1MD 1P3AD 5AV6D 4ZBJC 5BO0B 1U35B 1P3LA 3AZKC 5E5AB 4JJNC 1P3BD 2NZDA 3X1TA 1F66D 1P3LB 4WNNA 5GSUA 2JCHA 5JRGC 2Y2GA 5B1MC 1P3AC 5AV6C 2NZDB 3X1TB 4J8UA 3X1SD 1P3BC 4NFTA 4WNNB 3B0CW 5GSUB 1P3KA 3WA9D 3LZ1A 4J8WA 3AV2D 1AOID 3B6GA 3TU4A 1P3KB 3X1SC 4Z5TD 4J8XD 2HUEC 5B32G 3LZ1B 3AV1A 1M19A 3WA9C 4J8WB 4NE5A 3AZED 3B6GB 3AV2C 1AOIC 3AV1B 1M19B 1R4VA 5AV5A 4Z5TC 5B31D 4J8XC 3AZFA 4KGCA 1A7WA 3AZEC 3X1VD 3VH5A 4NE3A 3X1UD 5AV5B 3UTAA 3AZFB 4KGCB 3VH6W 4H9QB 1P3PA 1BH8A 5CPJA 2F8NH 5B31C 2RIQA 3AZJB 5F99A 3UTAB 3X1VC 1ZLAA 1P3PB 1BH8B 3X1UC 5CPJB 5B24D 4KHAA 5F99B 1Z2CB 3AZLA 3WKJD 1ZLAB 4R8PA 2CV5C 3C1BA 4XZQA 1F66A 2HIOA 4KHAB 4XUJD 1KX3A 5B24C 3AZLB 4R8PB 1HQ3D 5AV9A 3C1BB 4XZQB 1F66B 2HIOB 3H0LC 1TZYC 1F1EA 1KX3B 5C3IB 5E5AD 5AV9B 2Y2JA 2YFVA 4CSRA 2UWXA 2Y2NA 2LY8A 3H0RC 1P3FA 2Y2MA 1HQ3C 5CPKA 4G92C 1P3OD 2F8NA 2NZDD 2YFVB 4CSRB 1U35C 1P3FB 3P5JB 3H0MC 5E5AC 5CPKB 2XD5A 4E45A 2F8NB 5GSUD 3LJAA 4LD9D 3UT9D 3A1IA 1P3LC 2NZDC 3VH6A 3LJAB 3X1TC 2ZY2A 4WU8A 5GSUC 5CPIB 3LZ1D 3B0DB 4J8WD 1P3ID 3B0BA 3B6GD 4WU8B 3REIA 2Y2PA 3AV1D 3IP4C 1M19D 1P3KC 4ZUXD 3LZ1C 4J8WC 3REIB 3B6GC 4KUDA 3TU4C 5BS7A 4Z2MH 2CWEA 3WKJA 2DF4C 4KGCD 3AV1C 1M19C 3MVDD 4XUJA 4KUDB 5B2IA 3AZJD 3UTAD 3WKJB 2G5HC 3LZ0A 4YS3A 1P3PD 5AV5C 5CPJD 4XUJB 3AZFC 2W8SA 5B2IB 4KGCC 1H3OA 5BO0A 2Y2IA 5F99D 3UTBA 3LZ0B 4YS3B 4H9SA 2Y2HA 4AWLB 1ZLAD 3AZJC 2JSSA 2AROA 4EO5B 5GT0A 3UTAC 3NQJA 3V9RA 5CP6A 1H3OB 1P3OA 1P3PC 3UTBB 2ZY3A 4Z66A 5CPJC 3AZLD 4R8PD 1S32A 5F99C 5GT0B 2AROB 4XZQD 3LELD 3C1BD 5B33D 2HIOD 3NQJB 1KU5A 4WV4B 3V9RB 3R45A 5CP6B 1P3OB 5B1LA 1ZLAC 3AYWA 4LD9A 4H9NA 4Z66B 3AZGA 1KX3D 3UT9A 2NQBA 3MGQD 5AV9D 1S32B 3EPLA 3AZLC 3R45B 4R8PC 5B1LB 5AVCD 4XZQC 4H9NB 3C1BC 3AYWB 3AZGB 3UT9B 1F66C 2HIOC 4X23D 4LD9B 2NQBB 1P3GD 3MGSA 3AN2A 1KX3C 5C3IC 1P3FD 2IO5B 1P3IA 5AV9C 5CPKD 2F8ND 1W2EA 3MGSB 3AN2B 1KX5A 4ZUXA 4H9PA 1ID3D 1P3IB 2F8NK 1M18A 3LJAD 1P3FC 5CPKC 5CPID 1KX5B 4ZUXB 4H9PB 1M18B 3KSYA 4YM6A 4H9QA 3MVDA 3KWQA 3W97B 3AZJA 4WU8D 3LJAC 4YM6B 2FJ7D 3REJA 3MVDB 3KWQB 4UPKA 3B0DC 2AROC 4HGAB 3VH5T 3WAAA 3REID 2Y2LA 4DRAA 3MGPD 3REJB 4WU8C 3EPHA 5DNMD 3WAAB 4KUDD 3EPKA 3REIC 3LELA 5B33A 2YFWA 2PYOA 5B2ID 4WJ3C 2F8NG 3LZ0D 4YS3D 3MGQA 4KUDC 2Y2QA 3LELB 5BS7C 2YFWB 5B33B 3WKJC 2PYOB 2ZY5A 5AVCA 1N1JA 4X23A 3UTBD 3MGQB 1P3GA 4XUJC 5B2IC 5GT0D 2AROD 3LZ0C 4YS3C 3W99A 5AVCB 5CP6D 3KXBD 5B31G 2BG1A 4AWLC 3AZHA 1N1JB 4X23B 4Z66D 4EO5C 5AV8D 1P3GB 3F6TA 1P34A 1Q9CA 3B6FA 1S32D 3UTBC 1ID3A 1EQZA 3W99B 4H9SC 3AZHB 5B1LD 3AYWD 5GT0C 5B0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB D;  1P34 B;  5CP6 C;  3B6F B;  1P3O C;  5CPI A;  1ID3 B;  4Z66 C;  1EQZ B;  3WTP A;  3O62 A;  1S32 C;  5B0Z B;  5GT3 D;  5B0Y D;  5B1L C;  3MGS D;  3AN2 D;  3C1C D;  3AYW C;  3AZG C;  1KX4 D;  4LD9 C;  3UT9 C;  3WTP B;  3O62 B;  2NQB C;  2FJ7 A;  3MGR D;  2IO5 C;  4G91 B;  3MGP A;  5AVB A;  3W96 A;  5B40 A;  1KX5 D;  2FJ7 B;  3MGS C;  3AN2 C;  1M18 D;  3MNN A;  5DNM A;  1P3I C;  3MGP B;  3W97 D;  5AVB B;  3W96 B;  5B40 B;  4YM6 D;  2L5A A;  3MNN B;  3KWQ D;  5DNM B;  1KX5 C;  4ZUX C;  3AZI A;  1M18 C;  4H9O A;  5CHL B;  4WU9 A;  3REJ D;  3REL A;  3AZI B;  3WAA D;  4H9O B;  4YM6 C;  3MVD C;  3KWQ C;  5AY8 A;  4WU9 B;  1BH9 A;  3REL B;  5KDM A;  3KXB A;  3A6N A;  3REJ C;  5DNN A;  4WZS B;  5AY8 B;  5AV8 A;  1BH9 B;  3WAA C;  5GXQ A;  4QLC A;  5KDM B;  3KXB B;  3A6N B;  2PYO D;  5DNN B;  2BYK A;  5AV8 B;  5B2J A;  3REH D;  1P3M A;  5GXQ B;  3KUY A;  3VH5 W;  4QLC B;  1HTA A;  2BYK B;  3LEL C;  5B2J B;  5B33 C;  5GT3 A;  3AZN A;  2RVQ D;  5B0Y A;  1P3M B;  2PYO C;  1TAF A;  3KUY B;  3C1C A;  1KX4 A;  3W99 D;  3MGQ C;  3AZH D;  3AZM A;  3AZN B;  5GT3 B;  5B0Y B;  3MGR A;  1TAF B;  5AVC C;  3C1C B;  1P34 D;  1KX4 B;  3B6F D;  2RVQ C;  4X23 C;  1EQZ D;  1P3G C;  3NQU A;  3AZM B;  1WWI A;  5B0Z D;  1M1A A;  3MGR B;  3W99 C;  3W97 A;  3AZH C;  4J8V A;  3WTP D;  3O62 D;  3NQU B;  1P34 C;  3B6F C;  1M1A B;  1ID3 C;  1EQZ C;  3REK A;  4J8V B;  5B0Z C;  4J8U B;  5CPI C;  3REK B;  4DRB A;  3WTP C;  3O62 C;  5AVB D;  3W96 D;  5B40 D;  3TU4 B;  4G91 C;  4CAY A;  3MNN D;  3AFA A;  2FJ7 C;  3W98 A;  5FUG A;  3MGP C;  4CAY B;  5AVB C;  3W96 C;  5B32 A;  5B40 C;  3AFA B;  3W98 B;  3AZI D;  5FUG B;  3REH A;  3MNN C;  5DNM C;  4WU9 D;  3REL D;  3AZK A;  5B32 B;  4JJN A;  2CV5 D;  3REH B;  3WTP E;  3B0C T;  4ZBJ B;  5AY8 D;  3AZI C;  3AZK B;  5JRG A;  5B1M A;  4JJN B;  1P3A A;  5AV6 A;  4WU9 C;  3A6N D;  1JFI A;  3REL C;  5DNN D;  4M6B A;  5BNV A;  1P3B A;  1TZY D;  4E44 A;  5JRG B;  5GXQ D;  5B1M B;  4QLC D;  1P3A B;  5AY8 C;  5AV6 B;  5G49 A;  1JFI B;  5BNV B;  5B2J D;  1P3B B;  1P3M D;  3KXB C;  3A6N C;  5DNN C;  3KUY D;  3X1S A;  5AV8 C;  5G49 B;  1U35 D;  5GXQ C;  3WA9 A;  4QLC C;  3AZN D;  3X1S B;  5B2J C;  3AV2 A;  1AOI A;  1BFM A;  2HUE B;  5BNX A;  1P3M C;  1P3L D;  3WA9 B;  3VH6 T;  3KUY C;  3AZM D;  4Z5T A;  4J8X A;  5BT1 D;  4UUZ A;  3X1T D;  3AZE A;  3AZN C;  3AV2 B;  5GT3 C;  1AOI B;  5B0Y C;  5BNX B;  3C1C C;  1KX4 C;  4Z5T B;  4J8X B;  1WWS A;  1M1A D;  4UUZ B;  3AZM C;  3AZE B;  4J8V D;  5B31 A;  4J8U D;  3MGR C;  5BT1 C;  1P3K D;  3X1V A;  3REK D;  1B6W A;  3X1U A;  4NE6 A;  5B31 B;  1M1A C;  1B67 A;  4H9R A;  3W97 C;  3TU4 D;  3X1V B;  4J8V C;  4J8U C;  3X1U B;  2CV5 A;  1ULY A;  4H9R B;  3REK C;  4HGA C;  5B24 A;  4Z2M G;  2CV5 B;  3AFA D;  3W98 D;  5AV5 D;  3AZF D;  1TZY A;  5B24 B;  5B32 D;  5JA4 A;  1TZY B;  1HQ3 A;  2BYM A;  3AFA C;  3W98 C;  3AZK D;  4JJN D;  1U35 A;  5JA4 B;  1HQ3 B;  5E5A A;  5B32 C;  2BYM B;  4G92 B;  3AZG D;  3REH C;  5JRG D;  5B1M D;  1P3A D;  4ZBJ C;  5BO0 B;  5AV6 D;  1U35 B;  1P3L A;  3AZK C;  5E5A B;  4JJN C;  1P3B D;  2NZD A;  3X1T A;  1F66 D;  1P3L B;  4WNN A;  5GSU A;  5JRG C;  5B1M C;  1P3A C;  5AV6 C;  2NZD B;  3X1T B;  4J8U A;  3X1S D;  1P3B C;  4NFT A;  4WNN B;  3B0C W;  5GSU B;  1P3K A;  3WA9 D;  3LZ1 A;  4J8W A;  3AV2 D;  1AOI D;  3B6G A;  3TU4 A;  1P3K B;  3X1S C;  4Z5T D;  4J8X D;  2HUE C;  5B32 G;  3LZ1 B;  3AV1 A;  1M19 A;  3WA9 C;  4J8W B;  4NE5 A;  3AZE D;  3B6G B;  3AV2 C;  1AOI C;  3AV1 B;  1M19 B;  1R4V A;  5AV5 A;  4Z5T C;  5B31 D;  4J8X C;  3AZF A;  4KGC A;  1A7W A;  3AZE C;  3X1V D;  3VH5 A;  4NE3 A;  3X1U D;  5AV5 B;  3UTA A;  3AZF B;  4KGC B;  3VH6 W;  4H9Q B;  1P3P A;  1BH8 A;  5CPJ A;  2F8N H;  5B31 C;  3AZJ B;  5F99 A;  3UTA B;  3X1V C;  1ZLA A;  1P3P B;  1BH8 B;  3X1U C;  5CPJ B;  5B24 D;  4KHA A;  5F99 B;  3AZL A;  3WKJ D;  1ZLA B;  4R8P A;  2CV5 C;  3C1B A;  4XZQ A;  1F66 A;  2HIO A;  4KHA B;  4XUJ D;  1KX3 A;  5B24 C;  3AZL B;  4R8P B;  1HQ3 D;  5AV9 A;  3C1B B;  4XZQ B;  1F66 B;  2HIO B;  1TZY C;  1F1E A;  1KX3 B;  5C3I B;  5E5A D;  5AV9 B;  2YFV A;  4CSR A;  1P3F A;  2LY8 A;  1HQ3 C;  5CPK A;  4G92 C;  1P3O D;  2F8N A;  2NZD D;  2YFV B;  4CSR B;  1U35 C;  1P3F B;  5E5A C;  5CPK B;  4E45 A;  2F8N B;  5GSU D;  3LJA A;  4LD9 D;  3UT9 D;  1P3L C;  2NZD C;  3VH6 A;  3LJA B;  3X1T C;  4WU8 A;  5GSU C;  5CPI B;  3LZ1 D;  3B0D B;  4J8W D;  1P3I D;  3B0B A;  3B6G D;  4WU8 B;  3REI A;  3AV1 D;  1M19 D;  1P3K C;  4ZUX D;  3LZ1 C;  4J8W C;  3REI B;  3B6G C;  4KUD A;  3TU4 C;  5BS7 A;  4Z2M H;  2CWE A;  3WKJ A;  4KGC D;  3AV1 C;  1M19 C;  3MVD D;  4XUJ A;  4KUD B;  5B2I A;  3AZJ D;  3UTA D;  3WKJ B;  3LZ0 A;  4YS3 A;  1P3P D;  5AV5 C;  5CPJ D;  4XUJ B;  3AZF C;  4KGC C;  5B2I B;  1H3O A;  5BO0 A;  5F99 D;  3UTB A;  3LZ0 B;  4YS3 B;  4H9S A;  4AWL B;  1ZLA D;  3AZJ C;  2JSS A;  2ARO A;  4EO5 B;  5GT0 A;  3UTA C;  3NQJ A;  3V9R A;  5CP6 A;  1H3O B;  1P3O A;  1P3P C;  3UTB B;  5CPJ C;  4Z66 A;  3AZL D;  4R8P D;  1S32 A;  5F99 C;  5GT0 B;  2ARO B;  4XZQ D;  3LEL D;  3C1B D;  5B33 D;  2HIO D;  3NQJ B;  1KU5 A;  4WV4 B;  3V9R B;  3R45 A;  5CP6 B;  1P3O B;  5B1L A;  1ZLA C;  3AYW A;  4LD9 A;  4H9N A;  4Z66 B;  3AZG A;  1KX3 D;  3UT9 A;  2NQB A;  3MGQ D;  5AV9 D;  1S32 B;  3AZL C;  3R45 B;  4R8P C;  5B1L B;  5AVC D;  4XZQ C;  4H9N B;  3C1B C;  3AYW B;  3AZG B;  3UT9 B;  1F66 C;  2HIO C;  4X23 D;  4LD9 B;  2NQB B;  1P3G D;  3MGS A;  3AN2 A;  1KX3 C;  5C3I C;  1P3F D;  2IO5 B;  1P3I A;  5AV9 C;  5CPK D;  2F8N D;  3MGS B;  3AN2 B;  1KX5 A;  4ZUX A;  4H9P A;  1ID3 D;  1P3I B;  2F8N K;  1M18 A;  3LJA D;  1P3F C;  5CPK C;  5CPI D;  1KX5 B;  4ZUX B;  4H9P B;  1M18 B;  3KSY A;  4YM6 A;  4H9Q A;  3MVD A;  3KWQ A;  3W97 B;  3AZJ A;  4WU8 D;  3LJA C;  4YM6 B;  2FJ7 D;  3REJ A;  3MVD B;  3KWQ B;  2ARO C;  3B0D C;  4HGA B;  3VH5 T;  3WAA A;  3REI D;  4DRA A;  3MGP D;  3REJ B;  4WU8 C;  5DNM D;  3WAA B;  4KUD D;  3REI C;  3LEL A;  5B33 A;  2YFW A;  2PYO A;  5B2I D;  2F8N G;  3LZ0 D;  4YS3 D;  3MGQ A;  4KUD C;  3LEL B;  5BS7 C;  2YFW B;  5B33 B;  3WKJ C;  2PYO B;  5AVC A;  1N1J A;  4X23 A;  3UTB D;  3MGQ B;  1P3G A;  4XUJ C;  5B2I C;  5GT0 D;  2ARO D;  3LZ0 C;  4YS3 C;  3W99 A;  5AVC B;  5CP6 D;  3KXB D;  5B31 G;  4AWL C;  3AZH A;  1N1J B;  4X23 B;  4Z66 D;  4EO5 C;  5AV8 D;  1P3G B;  1P34 A;  1Q9C A;  3B6F A;  1S32 D;  3UTB C;  1ID3 A;  1EQZ A;  3W99 B;  4H9S C;  3AZH B;  5B1L D;  3AYW D;  5GT0 C;  5B0Z A; 
#chains in the Genus database with same CATH topology
 2NQB D;  1P34 B;  2XD1 A;  5CP6 C;  3B6F B;  1P3O C;  5CPI A;  1ID3 B;  4Z66 C;  1EQZ B;  3WTP A;  3O62 A;  1S32 C;  5B0Z B;  5GT3 D;  2ZY4 A;  5B0Y D;  5B1L C;  3MGS D;  3AN2 D;  3C1C D;  3AYW C;  3AZG C;  1KX4 D;  4LD9 C;  3UT9 C;  3WTP B;  3O62 B;  2NQB C;  2FJ7 A;  3MGR D;  2IO5 C;  4G91 B;  3MGP A;  5AVB A;  3W96 A;  5B40 A;  1KX5 D;  2FJ7 B;  3MGS C;  3AN2 C;  1M18 D;  3MNN A;  2FFF B;  5DNM A;  1P3I C;  3MGP B;  3W97 D;  5AVB B;  3W96 B;  5B40 B;  4YM6 D;  2L5A A;  2ZM5 A;  3MNN B;  3KWQ D;  5DNM B;  1KX5 C;  4ZUX C;  3AZI A;  1M18 C;  4H9O A;  5CHL B;  4WU9 A;  3REJ D;  3REL A;  3AZI B;  3WAA D;  4H9O B;  4YM6 C;  2Y2K A;  3MVD C;  3KWQ C;  5AY8 A;  4WU9 B;  1BH9 A;  3REL B;  2VQR A;  5KDM A;  3KXB A;  3A6N A;  3REJ C;  5DNN A;  4WZS B;  5AY8 B;  5AV8 A;  1BH9 B;  3WAA C;  5GXQ A;  4QLC A;  5KDM B;  3KXB B;  3A6N B;  2PYO D;  5DNN B;  2BYK A;  5AV8 B;  5B2J A;  3REH D;  1P3M A;  5GXQ B;  3KUY A;  3VH5 W;  4QLC B;  1HTA A;  2BYK B;  3LEL C;  5B2J B;  5B33 C;  5GT3 A;  3AZN A;  2RVQ D;  5B0Y A;  1P3M B;  2Y2O A;  2PYO C;  1TAF A;  3KUY B;  3C1C A;  1KX4 A;  3W99 D;  3MGQ C;  3AZH D;  3AZM A;  3AZN B;  2J8P A;  5GT3 B;  5B0Y B;  3MGR A;  1TAF B;  5AVC C;  3C1C B;  1P34 D;  1KX4 B;  3B6F D;  2RVQ C;  4X23 C;  1EQZ D;  1P3G C;  3NQU A;  3AZM B;  1WWI A;  5B0Z D;  1M1A A;  3MGR B;  3W99 C;  3W97 A;  3FDD A;  3AZH C;  4J8V A;  3WTP D;  3O62 D;  3NQU B;  1P34 C;  3B6F C;  1PZR A;  1M1A B;  1ID3 C;  1EQZ C;  3REK A;  3KFU G;  4J8V B;  5B0Z C;  4J8U B;  5CPI C;  3REK B;  4DRB A;  3WTP C;  3O62 C;  5AVB D;  3W96 D;  5B40 D;  3EG5 B;  3TU4 B;  4G91 C;  4CAY A;  3MNN D;  4DQY B;  3AFA A;  2FJ7 C;  3W98 A;  5FUG A;  3MGP C;  4CAY B;  5AVB C;  3W96 C;  5B32 A;  5B40 C;  3AFA B;  3W98 B;  3AZI D;  5FUG B;  3REH A;  3MNN C;  5DNM C;  4WU9 D;  3REL D;  3AZK A;  5B32 B;  4JJN A;  2CV5 D;  3REH B;  3WTP E;  3B0C T;  2DQN C;  4ZBJ B;  5AY8 D;  3AZI C;  3AZK B;  5JRG A;  5B1M A;  4JJN B;  1P3A A;  5AV6 A;  4WU9 C;  3A6N D;  1JFI A;  3REL C;  5DNN D;  4M6B A;  5BNV A;  1P3B A;  1TZY D;  3A1K A;  4E44 A;  5JRG B;  5GXQ D;  5B1M B;  4QLC D;  1P3A B;  5AY8 C;  5AV6 B;  5G49 A;  1JFI B;  2F2A C;  1T3U A;  5BNV B;  5B2J D;  1P3B B;  1P3M D;  3KXB C;  3A6N C;  5DNN C;  3KUY D;  3X1S A;  5AV8 C;  5G49 B;  1U35 D;  5GXQ C;  3WA9 A;  4QLC C;  3AZN D;  3X1S B;  5B2J C;  3AV2 A;  1AOI A;  1BFM A;  2HUE B;  5BNX A;  1P3M C;  1P3L D;  3WA9 B;  3VH6 T;  3KUY C;  3AZM D;  4Z5T A;  4J8X A;  5BT1 D;  4UUZ A;  3X1T D;  3AZE A;  3AZN C;  3AV2 B;  5GT3 C;  1AOI B;  5B0Y C;  5BNX B;  3C1C C;  1KX4 C;  4Z5T B;  4J8X B;  1WWS A;  1M1A D;  4UUZ B;  3AZM C;  3AZE B;  4J8V D;  5B31 A;  4J8U D;  3MGR C;  5BT1 C;  1P3K D;  3X1V A;  3REK D;  1B6W A;  3X1U A;  4NE6 A;  5B31 B;  1M1A C;  1B67 A;  4H9R A;  3W97 C;  3TU4 D;  3X1V B;  4J8V C;  4J8U C;  2G5I C;  2JE5 A;  3X1U B;  2CV5 A;  1ULY A;  4H9R B;  3REK C;  4HGA C;  5B24 A;  4Z2M G;  2CV5 B;  3AFA D;  3EPJ A;  3W98 D;  5AV5 D;  3AZF D;  1TZY A;  5B24 B;  5B32 D;  5JA4 A;  1TZY B;  1HQ3 A;  2BYM A;  3AFA C;  3W98 C;  3AZK D;  4JJN D;  1U35 A;  5JA4 B;  1HQ3 B;  5E5A A;  5B32 C;  2BYM B;  4G92 B;  3AZG D;  3AL0 C;  3REH C;  5JRG D;  5B1M D;  1P3A D;  5AV6 D;  4ZBJ C;  5BO0 B;  1U35 B;  1P3L A;  3AZK C;  5E5A B;  4JJN C;  1P3B D;  2NZD A;  3X1T A;  1F66 D;  1P3L B;  4WNN A;  5GSU A;  2JCH A;  5JRG C;  2Y2G A;  5B1M C;  1P3A C;  5AV6 C;  2NZD B;  3X1T B;  4J8U A;  3X1S D;  1P3B C;  4NFT A;  4WNN B;  3B0C W;  5GSU B;  1P3K A;  3WA9 D;  3LZ1 A;  4J8W A;  3AV2 D;  1AOI D;  3B6G A;  3TU4 A;  1P3K B;  3X1S C;  4Z5T D;  4J8X D;  2HUE C;  5B32 G;  3LZ1 B;  3AV1 A;  1M19 A;  3WA9 C;  4J8W B;  4NE5 A;  3AZE D;  3B6G B;  3AV2 C;  1AOI C;  3AV1 B;  1M19 B;  1R4V A;  5AV5 A;  4Z5T C;  5B31 D;  4J8X C;  3AZF A;  4KGC A;  1A7W A;  3AZE C;  3X1V D;  3VH5 A;  4NE3 A;  3X1U D;  5AV5 B;  3UTA A;  3AZF B;  4KGC B;  3VH6 W;  4H9Q B;  1P3P A;  1BH8 A;  5CPJ A;  2F8N H;  5B31 C;  2RIQ A;  3AZJ B;  5F99 A;  3UTA B;  3X1V C;  1ZLA A;  1P3P B;  1BH8 B;  3X1U C;  5CPJ B;  5B24 D;  4KHA A;  5F99 B;  1Z2C B;  3AZL A;  3WKJ D;  1ZLA B;  4R8P A;  2CV5 C;  3C1B A;  4XZQ A;  1F66 A;  2HIO A;  4KHA B;  4XUJ D;  1KX3 A;  5B24 C;  3AZL B;  4R8P B;  1HQ3 D;  5AV9 A;  3C1B B;  4XZQ B;  1F66 B;  2HIO B;  3H0L C;  1TZY C;  1F1E A;  1KX3 B;  5C3I B;  5E5A D;  5AV9 B;  2Y2J A;  2YFV A;  4CSR A;  2UWX A;  2Y2N A;  2LY8 A;  3H0R C;  1P3F A;  2Y2M A;  1HQ3 C;  5CPK A;  4G92 C;  1P3O D;  2F8N A;  2NZD D;  2YFV B;  4CSR B;  1U35 C;  1P3F B;  3P5J B;  3H0M C;  5E5A C;  5CPK B;  2XD5 A;  4E45 A;  2F8N B;  5GSU D;  3LJA A;  4LD9 D;  3UT9 D;  3A1I A;  1P3L C;  2NZD C;  3VH6 A;  3LJA B;  3X1T C;  2ZY2 A;  4WU8 A;  5GSU C;  5CPI B;  3LZ1 D;  3B0D B;  4J8W D;  1P3I D;  3B0B A;  3B6G D;  4WU8 B;  3REI A;  2Y2P A;  3AV1 D;  3IP4 C;  1M19 D;  1P3K C;  4ZUX D;  3LZ1 C;  4J8W C;  3REI B;  3B6G C;  4KUD A;  3TU4 C;  5BS7 A;  4Z2M H;  2CWE A;  3WKJ A;  2DF4 C;  4KGC D;  3AV1 C;  1M19 C;  3MVD D;  4XUJ A;  4KUD B;  5B2I A;  3AZJ D;  3UTA D;  3WKJ B;  2G5H C;  3LZ0 A;  4YS3 A;  1P3P D;  5AV5 C;  5CPJ D;  4XUJ B;  3AZF C;  2W8S A;  5B2I B;  4KGC C;  1H3O A;  5BO0 A;  2Y2I A;  5F99 D;  3UTB A;  3LZ0 B;  4YS3 B;  4H9S A;  2Y2H A;  4AWL B;  1ZLA D;  3AZJ C;  2JSS A;  2ARO A;  4EO5 B;  5GT0 A;  3UTA C;  3NQJ A;  3V9R A;  5CP6 A;  1H3O B;  1P3O A;  1P3P C;  3UTB B;  2ZY3 A;  4Z66 A;  5CPJ C;  3AZL D;  4R8P D;  1S32 A;  5F99 C;  5GT0 B;  2ARO B;  4XZQ D;  3LEL D;  3C1B D;  5B33 D;  2HIO D;  3NQJ B;  1KU5 A;  4WV4 B;  3V9R B;  3R45 A;  5CP6 B;  1P3O B;  5B1L A;  1ZLA C;  3AYW A;  4LD9 A;  4H9N A;  4Z66 B;  3AZG A;  1KX3 D;  3UT9 A;  2NQB A;  3MGQ D;  5AV9 D;  1S32 B;  3EPL A;  3AZL C;  3R45 B;  4R8P C;  5B1L B;  5AVC D;  4XZQ C;  4H9N B;  3C1B C;  3AYW B;  3AZG B;  3UT9 B;  1F66 C;  2HIO C;  4X23 D;  4LD9 B;  2NQB B;  1P3G D;  3MGS A;  3AN2 A;  1KX3 C;  5C3I C;  1P3F D;  2IO5 B;  1P3I A;  5AV9 C;  5CPK D;  2F8N D;  1W2E A;  3MGS B;  3AN2 B;  1KX5 A;  4ZUX A;  4H9P A;  1ID3 D;  1P3I B;  2F8N K;  1M18 A;  3LJA D;  1P3F C;  5CPK C;  5CPI D;  1KX5 B;  4ZUX B;  4H9P B;  1M18 B;  3KSY A;  4YM6 A;  4H9Q A;  3MVD A;  3KWQ A;  3W97 B;  3AZJ A;  4WU8 D;  3LJA C;  4YM6 B;  2FJ7 D;  3REJ A;  3MVD B;  3KWQ B;  4UPK A;  3B0D C;  2ARO C;  4HGA B;  3VH5 T;  3WAA A;  3REI D;  2Y2L A;  4DRA A;  3MGP D;  3REJ B;  4WU8 C;  3EPH A;  5DNM D;  3WAA B;  4KUD D;  3EPK A;  3REI C;  3LEL A;  5B33 A;  2YFW A;  2PYO A;  5B2I D;  4WJ3 C;  2F8N G;  3LZ0 D;  4YS3 D;  3MGQ A;  4KUD C;  2Y2Q A;  3LEL B;  5BS7 C;  2YFW B;  5B33 B;  3WKJ C;  2PYO B;  2ZY5 A;  5AVC A;  1N1J A;  4X23 A;  3UTB D;  3MGQ B;  1P3G A;  4XUJ C;  5B2I C;  5GT0 D;  2ARO D;  3LZ0 C;  4YS3 C;  3W99 A;  5AVC B;  5CP6 D;  3KXB D;  5B31 G;  2BG1 A;  4AWL C;  3AZH A;  1N1J B;  4X23 B;  4Z66 D;  4EO5 C;  5AV8 D;  1P3G B;  3F6T A;  1P34 A;  1Q9C A;  3B6F A;  1S32 D;  3UTB C;  1ID3 A;  1EQZ A;  3W99 B;  4H9S C;  3AZH B;  5B1L D;  3AYW D;  5GT0 C;  5B0Z A; 
#chains in the Genus database with same CATH homology
 2NQB D;  1P34 B;  2XD1 A;  5CP6 C;  3B6F B;  1P3O C;  5CPI A;  1ID3 B;  4Z66 C;  1EQZ B;  3WTP A;  3O62 A;  1S32 C;  5B0Z B;  5GT3 D;  2ZY4 A;  5B0Y D;  5B1L C;  3MGS D;  3AN2 D;  3C1C D;  3AYW C;  3AZG C;  1KX4 D;  4LD9 C;  3UT9 C;  3WTP B;  3O62 B;  2NQB C;  2FJ7 A;  3MGR D;  2IO5 C;  4G91 B;  3MGP A;  5AVB A;  3W96 A;  5B40 A;  1KX5 D;  2FJ7 B;  3MGS C;  3AN2 C;  1M18 D;  3MNN A;  2FFF B;  5DNM A;  1P3I C;  3MGP B;  3W97 D;  5AVB B;  3W96 B;  5B40 B;  4YM6 D;  2L5A A;  2ZM5 A;  3MNN B;  3KWQ D;  5DNM B;  1KX5 C;  4ZUX C;  3AZI A;  1M18 C;  4H9O A;  5CHL B;  4WU9 A;  3REJ D;  3REL A;  3AZI B;  3WAA D;  4H9O B;  4YM6 C;  2Y2K A;  3MVD C;  3KWQ C;  5AY8 A;  4WU9 B;  1BH9 A;  3REL B;  2VQR A;  5KDM A;  3KXB A;  3A6N A;  3REJ C;  5DNN A;  4WZS B;  5AY8 B;  5AV8 A;  1BH9 B;  3WAA C;  5GXQ A;  4QLC A;  5KDM B;  3KXB B;  3A6N B;  2PYO D;  5DNN B;  2BYK A;  5AV8 B;  5B2J A;  3REH D;  1P3M A;  5GXQ B;  3KUY A;  3VH5 W;  4QLC B;  1HTA A;  2BYK B;  3LEL C;  5B2J B;  5B33 C;  5GT3 A;  3AZN A;  2RVQ D;  5B0Y A;  1P3M B;  2Y2O A;  2PYO C;  1TAF A;  3KUY B;  3C1C A;  1KX4 A;  3W99 D;  3MGQ C;  3AZH D;  3AZM A;  3AZN B;  2J8P A;  5GT3 B;  5B0Y B;  3MGR A;  1TAF B;  5AVC C;  3C1C B;  1P34 D;  1KX4 B;  3B6F D;  2RVQ C;  4X23 C;  1EQZ D;  1P3G C;  3NQU A;  3AZM B;  1WWI A;  5B0Z D;  1M1A A;  3MGR B;  3W99 C;  3W97 A;  3FDD A;  3AZH C;  4J8V A;  3WTP D;  3O62 D;  3NQU B;  1P34 C;  3B6F C;  1PZR A;  1M1A B;  1ID3 C;  1EQZ C;  3REK A;  3KFU G;  4J8V B;  5B0Z C;  4J8U B;  5CPI C;  3REK B;  4DRB A;  3WTP C;  3O62 C;  5AVB D;  3W96 D;  5B40 D;  3EG5 B;  3TU4 B;  4G91 C;  4CAY A;  3MNN D;  4DQY B;  3AFA A;  2FJ7 C;  3W98 A;  5FUG A;  3MGP C;  4CAY B;  5AVB C;  3W96 C;  5B32 A;  5B40 C;  3AFA B;  3W98 B;  3AZI D;  5FUG B;  3REH A;  3MNN C;  5DNM C;  4WU9 D;  3REL D;  3AZK A;  5B32 B;  4JJN A;  2CV5 D;  3REH B;  3WTP E;  3B0C T;  2DQN C;  4ZBJ B;  5AY8 D;  3AZI C;  3AZK B;  5JRG A;  5B1M A;  4JJN B;  1P3A A;  5AV6 A;  4WU9 C;  3A6N D;  1JFI A;  3REL C;  5DNN D;  4M6B A;  5BNV A;  1P3B A;  1TZY D;  3A1K A;  4E44 A;  5JRG B;  5GXQ D;  5B1M B;  4QLC D;  1P3A B;  5AY8 C;  5AV6 B;  5G49 A;  1JFI B;  2F2A C;  1T3U A;  5BNV B;  5B2J D;  1P3B B;  1P3M D;  3KXB C;  3A6N C;  5DNN C;  3KUY D;  3X1S A;  5AV8 C;  5G49 B;  1U35 D;  5GXQ C;  3WA9 A;  4QLC C;  3AZN D;  3X1S B;  5B2J C;  3AV2 A;  1AOI A;  1BFM A;  2HUE B;  5BNX A;  1P3M C;  1P3L D;  3WA9 B;  3VH6 T;  3KUY C;  3AZM D;  4Z5T A;  4J8X A;  5BT1 D;  4UUZ A;  3X1T D;  3AZE A;  3AZN C;  3AV2 B;  5GT3 C;  1AOI B;  5B0Y C;  5BNX B;  3C1C C;  1KX4 C;  4Z5T B;  4J8X B;  1WWS A;  1M1A D;  4UUZ B;  3AZM C;  3AZE B;  4J8V D;  5B31 A;  4J8U D;  3MGR C;  5BT1 C;  1P3K D;  3X1V A;  3REK D;  1B6W A;  3X1U A;  4NE6 A;  5B31 B;  1M1A C;  1B67 A;  4H9R A;  3W97 C;  3TU4 D;  3X1V B;  4J8V C;  4J8U C;  2G5I C;  2JE5 A;  3X1U B;  2CV5 A;  1ULY A;  4H9R B;  3REK C;  4HGA C;  5B24 A;  4Z2M G;  2CV5 B;  3AFA D;  3EPJ A;  3W98 D;  5AV5 D;  3AZF D;  1TZY A;  5B24 B;  5B32 D;  5JA4 A;  1TZY B;  1HQ3 A;  2BYM A;  3AFA C;  3W98 C;  3AZK D;  4JJN D;  1U35 A;  5JA4 B;  1HQ3 B;  5E5A A;  5B32 C;  2BYM B;  4G92 B;  3AZG D;  3AL0 C;  3REH C;  5JRG D;  5B1M D;  1P3A D;  5AV6 D;  4ZBJ C;  5BO0 B;  1U35 B;  1P3L A;  3AZK C;  5E5A B;  4JJN C;  1P3B D;  2NZD A;  3X1T A;  1F66 D;  1P3L B;  4WNN A;  5GSU A;  2JCH A;  5JRG C;  2Y2G A;  5B1M C;  1P3A C;  5AV6 C;  2NZD B;  3X1T B;  4J8U A;  3X1S D;  1P3B C;  4NFT A;  4WNN B;  3B0C W;  5GSU B;  1P3K A;  3WA9 D;  3LZ1 A;  4J8W A;  3AV2 D;  1AOI D;  3B6G A;  3TU4 A;  1P3K B;  3X1S C;  4Z5T D;  4J8X D;  2HUE C;  5B32 G;  3LZ1 B;  3AV1 A;  1M19 A;  3WA9 C;  4J8W B;  4NE5 A;  3AZE D;  3B6G B;  3AV2 C;  1AOI C;  3AV1 B;  1M19 B;  1R4V A;  5AV5 A;  4Z5T C;  5B31 D;  4J8X C;  3AZF A;  4KGC A;  1A7W A;  3AZE C;  3X1V D;  3VH5 A;  4NE3 A;  3X1U D;  5AV5 B;  3UTA A;  3AZF B;  4KGC B;  3VH6 W;  4H9Q B;  1P3P A;  1BH8 A;  5CPJ A;  2F8N H;  5B31 C;  2RIQ A;  3AZJ B;  5F99 A;  3UTA B;  3X1V C;  1ZLA A;  1P3P B;  1BH8 B;  3X1U C;  5CPJ B;  5B24 D;  4KHA A;  5F99 B;  1Z2C B;  3AZL A;  3WKJ D;  1ZLA B;  4R8P A;  2CV5 C;  3C1B A;  4XZQ A;  1F66 A;  2HIO A;  4KHA B;  4XUJ D;  1KX3 A;  5B24 C;  3AZL B;  4R8P B;  1HQ3 D;  5AV9 A;  3C1B B;  4XZQ B;  1F66 B;  2HIO B;  3H0L C;  1TZY C;  1F1E A;  1KX3 B;  5C3I B;  5E5A D;  5AV9 B;  2Y2J A;  2YFV A;  4CSR A;  2UWX A;  2Y2N A;  2LY8 A;  3H0R C;  1P3F A;  2Y2M A;  1HQ3 C;  5CPK A;  4G92 C;  1P3O D;  2F8N A;  2NZD D;  2YFV B;  4CSR B;  1U35 C;  1P3F B;  3P5J B;  3H0M C;  5E5A C;  5CPK B;  2XD5 A;  4E45 A;  2F8N B;  5GSU D;  3LJA A;  4LD9 D;  3UT9 D;  3A1I A;  1P3L C;  2NZD C;  3VH6 A;  3LJA B;  3X1T C;  2ZY2 A;  4WU8 A;  5GSU C;  5CPI B;  3LZ1 D;  3B0D B;  4J8W D;  1P3I D;  3B0B A;  3B6G D;  4WU8 B;  3REI A;  2Y2P A;  3AV1 D;  3IP4 C;  1M19 D;  1P3K C;  4ZUX D;  3LZ1 C;  4J8W C;  3REI B;  3B6G C;  4KUD A;  3TU4 C;  5BS7 A;  4Z2M H;  2CWE A;  3WKJ A;  2DF4 C;  4KGC D;  3AV1 C;  1M19 C;  3MVD D;  4XUJ A;  4KUD B;  5B2I A;  3AZJ D;  3UTA D;  3WKJ B;  2G5H C;  3LZ0 A;  4YS3 A;  1P3P D;  5AV5 C;  5CPJ D;  4XUJ B;  3AZF C;  2W8S A;  5B2I B;  4KGC C;  1H3O A;  5BO0 A;  2Y2I A;  5F99 D;  3UTB A;  3LZ0 B;  4YS3 B;  4H9S A;  2Y2H A;  4AWL B;  1ZLA D;  3AZJ C;  2JSS A;  2ARO A;  4EO5 B;  5GT0 A;  3UTA C;  3NQJ A;  3V9R A;  5CP6 A;  1H3O B;  1P3O A;  1P3P C;  3UTB B;  2ZY3 A;  4Z66 A;  5CPJ C;  3AZL D;  4R8P D;  1S32 A;  5F99 C;  5GT0 B;  2ARO B;  4XZQ D;  3LEL D;  3C1B D;  5B33 D;  2HIO D;  3NQJ B;  1KU5 A;  4WV4 B;  3V9R B;  3R45 A;  5CP6 B;  1P3O B;  5B1L A;  1ZLA C;  3AYW A;  4LD9 A;  4H9N A;  4Z66 B;  3AZG A;  1KX3 D;  3UT9 A;  2NQB A;  3MGQ D;  5AV9 D;  1S32 B;  3EPL A;  3AZL C;  3R45 B;  4R8P C;  5B1L B;  5AVC D;  4XZQ C;  4H9N B;  3C1B C;  3AYW B;  3AZG B;  3UT9 B;  1F66 C;  2HIO C;  4X23 D;  4LD9 B;  2NQB B;  1P3G D;  3MGS A;  3AN2 A;  1KX3 C;  5C3I C;  1P3F D;  2IO5 B;  1P3I A;  5AV9 C;  5CPK D;  2F8N D;  1W2E A;  3MGS B;  3AN2 B;  1KX5 A;  4ZUX A;  4H9P A;  1ID3 D;  1P3I B;  2F8N K;  1M18 A;  3LJA D;  1P3F C;  5CPK C;  5CPI D;  1KX5 B;  4ZUX B;  4H9P B;  1M18 B;  3KSY A;  4YM6 A;  4H9Q A;  3MVD A;  3KWQ A;  3W97 B;  3AZJ A;  4WU8 D;  3LJA C;  4YM6 B;  2FJ7 D;  3REJ A;  3MVD B;  3KWQ B;  4UPK A;  3B0D C;  2ARO C;  4HGA B;  3VH5 T;  3WAA A;  3REI D;  2Y2L A;  4DRA A;  3MGP D;  3REJ B;  4WU8 C;  3EPH A;  5DNM D;  3WAA B;  4KUD D;  3EPK A;  3REI C;  3LEL A;  5B33 A;  2YFW A;  2PYO A;  5B2I D;  4WJ3 C;  2F8N G;  3LZ0 D;  4YS3 D;  3MGQ A;  4KUD C;  2Y2Q A;  3LEL B;  5BS7 C;  2YFW B;  5B33 B;  3WKJ C;  2PYO B;  2ZY5 A;  5AVC A;  1N1J A;  4X23 A;  3UTB D;  3MGQ B;  1P3G A;  4XUJ C;  5B2I C;  5GT0 D;  2ARO D;  3LZ0 C;  4YS3 C;  3W99 A;  5AVC B;  5CP6 D;  3KXB D;  5B31 G;  2BG1 A;  4AWL C;  3AZH A;  1N1J B;  4X23 B;  4Z66 D;  4EO5 C;  5AV8 D;  1P3G B;  3F6T A;  1P34 A;  1Q9C A;  3B6F A;  1S32 D;  3UTB C;  1ID3 A;  1EQZ A;  3W99 B;  4H9S C;  3AZH B;  5B1L D;  3AYW D;  5GT0 C;  5B0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...