5B2JA

Human nucleosome containing cpg methylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2jA00
3LJAB 1TAFA 2AROD 3X1TA 5B32A 5B1LD 3AZEA 2HIOA 4X23C 5JRGC 3REKD 4KHAA 4J8WA 3MNND 3UT9A 4QLCC 5F99D 3KUYD 2NQBC 5AV9C 4H9QB 3WKJA 3A6NA 1B6WA 4M6BA 5B40C 3MGPC 1F66B 4KUDB 2NZDA 5C3IC 1M18D 3LZ0C 1AOIC 3MGQC 1P3ID 1ZLAD 3AN2A 1KX3A 4UUZA 3UTAB 3AZKA 5CPKB 3WTPD 1P3FB 1R4VA 4XZQD 4H9NB 1U35D 3LELA 3B6FA 3RELB 3B6GD 1BH9B 5DNMC 5GXQB 5CPJA 5GSUD 1N1JB 1S32C 2PYOB 3W96C 1P3PA 2F8NB 4J8UB 5BT1D 1P3GD 2YFVB 3AFAD 5AY8D 1BFMA 2AROB 4R8PD 4Z5TA 3TU4A 4KGCB 4WU8D 5B1LB 4H9RA 3MVDA 3REKB 3AZFD 4HGAC 1KX4A 1HTAA 5AVCA 3MNNB 3REHA 3REJD 3AZLC 5F99B 3B0DB 4XUJD 3W97A 5GT3A 2FJ7A 3LZ1D 3KUYC 3AZGD 1M19C 1KU5A 3X1SD 2CV5D 1P3LC 5AV6B 3VH5A 4J8VC 4J8XC 5B0ZA 1P3IB 1ZLAB 5AV5D 1M18C 3WTPB 3AZHD 1P3BA 1ZLAC 5B2IB 4XZQB 3AZID 3KWQA 4E44A 1U35B 1P3OA 3WTPC 3V9RA 5BNVB 1U35C 5DNNA 3X1TD 2BYKA 5GSUB 1KX5C 4H9PA 3AZED 2HIOD 3MGRA 4CAYA 3B6GC 4J8WD 3AZMC 1P3GB 3AFAB 4WNNB 4R8PB 5B33C 4ZUXA 5BS7C 4WU8B 5BT1C 3C1BA 3B0CT 3AFAC 1ID3A 5AY8C 3WKJD 3A6ND 2BYMA 3AZFB 4LD9A 1H3OB 4Z66A 5BO0A 3KXBA 3REJC 3AYWA 5B24C 3LZ1B 1TZYA 1KX3D 4XUJC 3AV2C 4G91B 3AZKD 2CV5B 5CPIC 3AZGC 3AZNB 3X1SC 3LELD 5E5AA 3REIC 1P3KA 4YS3A 3C1CA 5BNXA 2YFWA 4WZSB 5AV5B 3VH6W 1HQ3B 4ZBJC 2F8NH 5B2JA 3AZJC 4Z2MH 3AZHB 3W98C 1P3PD 3AZIB 5FUGA 5AV5C 3WA9B 1EQZA 5B0YC 5G49A 1TAFB 4Z5TD 3X1TB 3X1UA 3X1VA 5B1MC 2HIOB 3AZEB 3AV1A 3MVDD 4J8UD 2HUEB 1P3MA 4J8WB 3UTBA 1KX4D 1P34A 4DRAA 5AVCD 2IO5B 3REHD 4YM6A 2JSSA 4KGCD 5B31A 3LJAC 3B0BA 5GT3D 3WKJB 3A6NB 2FJ7D 1P3AA 4NE3A 3WAAD 5AVBA 2NZDB 3W99A 5B0ZD 3AN2B 1KX3B 4UUZB 3WTPE 1B67A 3AZKB 5AV6D 5CP6A 1P3BD 3KWQD 3LELB 3B6FB 1F66C 4KUDC 1BH8A 4EO5B 2RVQC 3R45A 5JRGA 4X23A 5GT0D 5B2ID 3MGRD 3UTAC 1P3PB 5CPKC 4QLCA 1P3FC 2LY8A 4Z5TB 4ZUXD 3TU4B 2NQBA 5AV9A 4H9RB 3O62D 3RELC 3MVDB 5GXQC 2PYOC 5JA4A 1KX4B 5AVCB 5B40A 3REHB 4J8UC 3MGPA 3LZ0A 4Z66D 1AOIA 2AROC 3KXBD 3MGQA 4KGCC 5GT3B 3AYWD 5B1LC 2FJ7B 3REKC 1M1AD 3WAAB 3MNNC 3WAAC 5E5AD 5F99C 1P3KD 5B0ZB 4YS3D 5DNMA 3B0DC 1S32A 3NQUA 3MGSA 4H9SC 3W96A 5B2JD 3AZND 1P3BB 3KWQB 1EQZD 5KDMB 5AV6C 1WWSA 5AV8A 1HQ3D 3V9RB 5DNNB 2BYKB 1P3IC 2F8NG 3X1UD 3X1VD 4H9PB 4Z2MG 2CWEA 5GT0B 1JFIA 3WA9D 3MGRB 4CAYB 1P3MD 1P34D 3AZLA 1WWIA 5GT0C 5B2IC 4XZQC 4YM6D 5B32D 5B31D 4ZUXB 4AWLB 3C1BB 3O62B 1ID3B 5GSUC 3KUYA 2BYMB 1M19A 3UT9D 3O62C 1P3AD 1P3LA 5AVBD 4LD9B 4J8VA 4J8XA 1P3GC 4Z66B 5BO0B 3KXBB 4R8PC 3W99D 3VH5W 3AYWB 4WU8C 1M18A 1TZYB 3AZFC 1M1AB 1ZLAA 2NZDD 5CP6D 3WTPA 5E5AB 1P3KB 1M1AC 4YS3B 3AN2D 3C1CB 4CSRA 5BNXB 1KX5A 5JRGD 3LZ1C 5B2JB 3B6GA 4G91C 5FUGB 3AZMA 2CV5C 2F8NK 1EQZB 3B6FD 5G49B 4QLCD 5B33A 3AZNC 5CPJD 5BS7A 2NQBD 5AY8A 5AV9D 3X1UB 3X1VB 3AV1B 1HQ3C 1P3MB 1P34B 3AZHC 5B40D 3AZIC 3WA9C 4YM6B 3TU4D 3MGPD 5B32B 5B31B 3REJA 3LZ0D 1AOID 5B24A 3MGQD 4KHAB 3X1TC 5B32C 4NE6A 4XUJA 3AZEC 2HIOC 3UT9B 3AV2A 2HUEC 1P3AB 4J8WC 5AVBB 4JJNA 3AZGA 5CPIA 2IO5C 3X1SA 3UT9C 3REIA 3W97D 3W99B 5DNMD 4NFTA 1S32D 3WKJC 3AZJA 4WU9A 3A6NC 3W98A 3VH6T 3MGSD 3W96D 4H9OA 5AV5A 5CP6B 5B0YA 3KSYA 2NZDC 1BH8B 5AV8D 5B1MA 3R45B 5JRGB 4X23B 1A7WA 3AN2C 1P3OD 1KX3C 3NQJA 3AZKC 3AZLD 4QLCB 5B32G 5B31G 5DNND 3LELC 5CPJB 3LJAA 3B6FC 2NQBB 5AV9B 4EO5C 5CPJC 5JA4B 1M19D 1P3PC 5B40B 1P3LD 3MGPB 5C3IB 3C1BD 4J8VD 4J8XD 3LZ0B 1ID3D 1AOIB 3MGQB 4Z5TC 3TU4C 4H9QA 4NE5A 3MVDC 4LD9D 1KX4C 5AVCC 3REHC 3W97B 1F66A 4KUDA 5DNMB 1F1EA 1TZYD 1KX5D 1S32B 3W97C 5GT3C 3NQUB 2FJ7C 3MGSB 3UTAA 3W96B 5CPKA 1P3FA 3AZMD 4H9NA 3MGSC 3C1CD 5B33D 5AV8B 3RELA 5B0ZC 1BH9A 3AZIA 5GXQA 1N1JA 2PYOA 5AV8C 1P3OB 1JFIB 4HGAB 2F8NA 4J8UA 3AZLB 1P3BC 1P3OC 3KWQC 2YFVA 2AROA 3AV1D 4KGCA 5B24D 5B1LA 5DNNC 3UTBD 3KUYB 3REKA 3AV2D 1M19B 1ULYA 3MGRC 3MNNA 1P3LB 4JJND 5CPID 4J8VB 4J8XB 3REID 3WAAA 5F99A 3B0CW 4ZUXC 4AWLC 3C1BC 1M18B 1ID3C 4H9SA 3AZJD 4WU9D 3W98D 4G92B 2F8ND 4DRBA 5B0YD 4LD9C 5AV6A 2L5AA 4G92C 4Z66C 3KXBC 4CSRB 5KDMA 1P3IA 1KX5B 3AYWC 5B1MD 3B6GB 1TZYC 5CHLB 3AZMB 5GT0A 5B2IA 4XZQA 1U35A 2YFWB 5B33B 4X23D 5E5AC 3LJAD 1P3KC 3VH6A 4YS3C 1Q9CA 5BNVA 5AY8B 3C1CC 5GSUA 3O62A 5B2JC 1P3GA 1EQZC 3AFAA 4WNNA 3REJB 4R8PA 5B24B 4WU8A 3UTBB 3VH5T 3X1UC 3X1VC 4XUJB 3AV2B 3AV1C 3AZFA 1P3MC 3UTBC 4JJNB 5CPIB 3AZGB 1P34C 4WV4B 3X1SB 1H3OA 3REIB 4YM6C 1M1AA 1F66D 4KUDD 5B31C 4JJNC 2RVQD 4ZBJB 3LZ1A 3AZJB 4WU9B 3W98B 3UTAD 4H9OB 2CV5A 5CPKD 5B0YB 1P3AC 1P3FD 5AVBC 4WU9C 3AZNA 3W99C 3RELD 5B1MB 5GXQD 1HQ3A 2PYOD 3NQJB 3AZHA 5CP6C 3WA9A 4E45A
chains in the Genus database with same CATH superfamily
3LJAB 1TAFA 2Y2MA 2AROD 3X1TA 5B32A 2DF4C 5B1LD 3AZEA 2HIOA 4X23C 5JRGC 3REKD 4KHAA 4J8WA 4UPKA 3MNND 3UT9A 4QLCC 5F99D 2Y2IA 3KUYD 2NQBC 3H0MC 4H9QB 5AV9C 3WKJA 3A6NA 1B6WA 4M6BA 5B40C 3MGPC 1F66B 4KUDB 2NZDA 5C3IC 1M18D 3LZ0C 1AOIC 3MGQC 1P3ID 1ZLAD 3AN2A 1KX3A 4UUZA 3UTAB 3AZKA 5CPKB 3WTPD 1P3FB 1R4VA 4XZQD 4H9NB 1U35D 3LELA 3B6FA 3RELB 3B6GD 1BH9B 5DNMC 5GXQB 5CPJA 5GSUD 1N1JB 1S32C 2PYOB 3W96C 1P3PA 2F8NB 4J8UB 5BT1D 1P3GD 2YFVB 3AFAD 5AY8D 1BFMA 3AL0C 2AROB 4R8PD 4Z5TA 3TU4A 4KGCB 4WU8D 5B1LB 4H9RA 3MVDA 3REKB 3AZFD 4HGAC 1KX4A 1HTAA 5AVCA 3MNNB 3REHA 3REJD 3AZLC 5F99B 3B0DB 4XUJD 2ZY4A 3W97A 5GT3A 2FJ7A 3LZ1D 3KUYC 2BG1A 3AZGD 1M19C 1KU5A 3X1SD 2ZY5A 2CV5D 2Y2LA 1P3LC 5AV6B 3VH5A 4J8VC 2ZY3A 4J8XC 3P5JB 5B0ZA 1P3IB 3EPHA 4DQYB 1ZLAB 5AV5D 1M18C 3WTPB 3AZHD 1P3BA 2Y2QA 1ZLAC 5B2IB 4XZQB 3AZID 3KWQA 4E44A 1U35B 1P3OA 3WTPC 2Y2PA 3V9RA 5BNVB 1U35C 5DNNA 3X1TD 2BYKA 5GSUB 1KX5C 4H9PA 3AZED 2HIOD 3MGRA 4CAYA 3B6GC 4J8WD 3AZMC 1P3GB 3AFAB 4WNNB 4R8PB 5B33C 4ZUXA 5BS7C 4WU8B 5BT1C 3C1BA 3B0CT 3AFAC 1ID3A 5AY8C 3WKJD 3A6ND 2BYMA 3AZFB 2G5IC 4LD9A 1H3OB 2ZM5A 3IP4C 4Z66A 5BO0A 3KXBA 3REJC 3AYWA 5B24C 1W2EA 3LZ1B 1TZYA 1KX3D 4XUJC 3AV2C 4G91B 3AZKD 2CV5B 5CPIC 3AZGC 3AZNB 3X1SC 3LELD 5E5AA 3REIC 1P3KA 4YS3A 3C1CA 5BNXA 2YFWA 3EG5B 4WZSB 5AV5B 3VH6W 1HQ3B 4ZBJC 2F8NH 5B2JA 3AZJC 4Z2MH 3AZHB 3W98C 1P3PD 3AZIB 5FUGA 5AV5C 3WA9B 1EQZA 5B0YC 5G49A 1TAFB 4Z5TD 3X1TB 3X1UA 3X1VA 5B1MC 2HIOB 3AZEB 3AV1A 3MVDD 4J8UD 2HUEB 1P3MA 4J8WB 3UTBA 1KX4D 1P34A 4DRAA 5AVCD 2IO5B 3REHD 4YM6A 2JSSA 4KGCD 5B31A 3LJAC 3B0BA 5GT3D 3WKJB 3A6NB 2FJ7D 1P3AA 4NE3A 3WAAD 5AVBA 2NZDB 3W99A 5B0ZD 3A1KA 3H0RC 3AN2B 1KX3B 4UUZB 3WTPE 1B67A 3AZKB 5AV6D 5CP6A 1P3BD 3KWQD 3LELB 3B6FB 1F66C 4KUDC 1BH8A 2DQNC 2RIQA 4EO5B 2RVQC 3R45A 5JRGA 4X23A 5GT0D 5B2ID 3MGRD 3UTAC 1P3PB 5CPKC 4QLCA 1P3FC 2LY8A 4Z5TB 4ZUXD 3TU4B 2NQBA 5AV9A 4H9RB 3O62D 3RELC 3MVDB 5GXQC 2PYOC 5JA4A 1KX4B 5AVCB 5B40A 3REHB 4J8UC 3MGPA 3LZ0A 4Z66D 1AOIA 2AROC 3KXBD 3MGQA 4KGCC 5GT3B 3AYWD 5B1LC 2FJ7B 3REKC 1M1AD 3WAAB 3MNNC 3WAAC 5E5AD 5F99C 1P3KD 5B0ZB 4YS3D 5DNMA 3B0DC 1S32A 3NQUA 3MGSA 4H9SC 3W96A 5B2JD 3AZND 1P3BB 3KWQB 1Z2CB 5KDMB 1EQZD 5AV6C 1WWSA 5AV8A 1HQ3D 3V9RB 5DNNB 2BYKB 1P3IC 2F8NG 3X1UD 3X1VD 4H9PB 4Z2MG 2CWEA 5GT0B 1JFIA 3WA9D 3MGRB 4CAYB 1P3MD 3EPJA 1P34D 3AZLA 1WWIA 5GT0C 5B2IC 4XZQC 4YM6D 5B32D 5B31D 4ZUXB 2J8PA 4AWLB 3C1BB 3O62B 1ID3B 5GSUC 3KUYA 2BYMB 1M19A 3UT9D 3O62C 1P3AD 1P3LA 5AVBD 4LD9B 4J8VA 4J8XA 1P3GC 4Z66B 5BO0B 3KXBB 4R8PC 3W99D 3VH5W 3AYWB 4WU8C 1M18A 1TZYB 3AZFC 1M1AB 1ZLAA 2NZDD 5CP6D 3EPLA 2ZY2A 3WTPA 5E5AB 1P3KB 1M1AC 2Y2HA 4YS3B 3AN2D 3C1CB 4CSRA 5BNXB 1KX5A 5JRGD 3LZ1C 5B2JB 3B6GA 2F2AC 4G91C 5FUGB 3AZMA 2CV5C 2F8NK 1EQZB 3B6FD 5G49B 4QLCD 5B33A 3AZNC 5CPJD 5BS7A 2NQBD 5AY8A 5AV9D 3X1UB 3X1VB 2Y2KA 3AV1B 1HQ3C 2Y2GA 1P3MB 1P34B 3AZHC 5B40D 3AZIC 3WA9C 4YM6B 3TU4D 3MGPD 5B32B 5B31B 3REJA 3LZ0D 1AOID 5B24A 3MGQD 4KHAB 3X1TC 5B32C 4NE6A 4XUJA 3AZEC 2HIOC 3UT9B 3AV2A 2HUEC 1P3AB 1PZRA 4J8WC 5AVBB 4JJNA 3AZGA 5CPIA 2IO5C 3X1SA 3UT9C 3REIA 3W97D 3W99B 5DNMD 4NFTA 3A1IA 1S32D 3WKJC 3AZJA 4WU9A 3A6NC 3W98A 3VH6T 3MGSD 3W96D 4H9OA 5AV5A 5CP6B 5B0YA 3KSYA 2NZDC 1BH8B 1T3UA 5AV8D 5B1MA 3R45B 5JRGB 4X23B 1A7WA 2Y2OA 3AN2C 1P3OD 3NQJA 1KX3C 3AZKC 3AZLD 4QLCB 5B32G 5B31G 5DNND 3LELC 2Y2JA 3LJAA 5CPJB 3B6FC 2NQBB 5AV9B 4EO5C 5CPJC 5JA4B 1M19D 1P3PC 5B40B 1P3LD 3MGPB 5C3IB 3C1BD 2Y2NA 4J8VD 4J8XD 3LZ0B 1ID3D 1AOIB 3MGQB 4WJ3C 4Z5TC 3TU4C 4H9QA 4NE5A 3MVDC 2XD5A 4LD9D 1KX4C 3FDDA 5AVCC 3REHC 3W97B 1F66A 4KUDA 5DNMB 1F1EA 1TZYD 1KX5D 1S32B 3W97C 5GT3C 3NQUB 2FJ7C 3MGSB 3UTAA 3W96B 5CPKA 1P3FA 3AZMD 4H9NA 3MGSC 3C1CD 5B33D 5AV8B 3EPKA 3RELA 5B0ZC 1BH9A 3AZIA 5GXQA 1N1JA 2PYOA 5AV8C 1P3OB 1JFIB 4HGAB 2F8NA 4J8UA 3AZLB 1P3BC 1P3OC 3KWQC 2VQRA 2YFVA 2AROA 3AV1D 4KGCA 5B24D 5B1LA 5DNNC 2FFFB 3UTBD 3KUYB 3REKA 3AV2D 1M19B 1ULYA 3MGRC 3MNNA 1P3LB 4JJND 5CPID 4J8VB 4J8XB 3REID 3WAAA 5F99A 3B0CW 4ZUXC 4AWLC 3C1BC 2XD1A 1M18B 1ID3C 4H9SA 3AZJD 4WU9D 3W98D 4G92B 2F8ND 4DRBA 5B0YD 4LD9C 5AV6A 2L5AA 4G92C 2JE5A 4Z66C 3KXBC 4CSRB 5KDMA 1P3IA 1KX5B 3AYWC 5B1MD 3B6GB 1TZYC 5CHLB 3AZMB 5GT0A 5B2IA 4XZQA 1U35A 2YFWB 5B33B 4X23D 5E5AC 3LJAD 1P3KC 3VH6A 4YS3C 1Q9CA 3H0LC 5BNVA 5AY8B 3C1CC 5GSUA 2UWXA 2JCHA 3KFUG 3O62A 5B2JC 2G5HC 2W8SA 1P3GA 1EQZC 3AFAA 4WNNA 3REJB 4R8PA 5B24B 4WU8A 3UTBB 3VH5T 3X1UC 3X1VC 4XUJB 3AV2B 3AV1C 3AZFA 1P3MC 3UTBC 4JJNB 5CPIB 3AZGB 1P34C 4WV4B 3X1SB 1H3OA 3REIB 4YM6C 1M1AA 1F66D 4KUDD 5B31C 4JJNC 2RVQD 4ZBJB 3LZ1A 3AZJB 4WU9B 3W98B 3UTAD 4H9OB 2CV5A 5CPKD 5B0YB 1P3AC 1P3FD 5AVBC 4WU9C 3AZNA 3F6TA 3W99C 3RELD 5B1MB 5GXQD 1HQ3A 2PYOD 3NQJB 3AZHA 5CP6C 3WA9A 4E45A
chains in the Genus database with same CATH topology
3LJAB 1TAFA 2Y2MA 2AROD 3X1TA 5B32A 2DF4C 5B1LD 3AZEA 2HIOA 4X23C 5JRGC 3REKD 4KHAA 4J8WA 4UPKA 3MNND 3UT9A 4QLCC 5F99D 2Y2IA 3KUYD 2NQBC 3H0MC 4H9QB 5AV9C 3WKJA 3A6NA 1B6WA 4M6BA 5B40C 3MGPC 1F66B 4KUDB 2NZDA 5C3IC 1M18D 3LZ0C 1AOIC 3MGQC 1P3ID 1ZLAD 3AN2A 1KX3A 4UUZA 3UTAB 3AZKA 5CPKB 3WTPD 1P3FB 1R4VA 4XZQD 4H9NB 1U35D 3LELA 3B6FA 3RELB 3B6GD 1BH9B 5DNMC 5GXQB 5CPJA 5GSUD 1N1JB 1S32C 2PYOB 3W96C 1P3PA 2F8NB 4J8UB 5BT1D 1P3GD 2YFVB 3AFAD 5AY8D 1BFMA 3AL0C 2AROB 4R8PD 4Z5TA 3TU4A 4KGCB 4WU8D 5B1LB 4H9RA 3MVDA 3REKB 3AZFD 4HGAC 1KX4A 1HTAA 5AVCA 3MNNB 3REHA 3REJD 3AZLC 5F99B 3B0DB 4XUJD 2ZY4A 3W97A 5GT3A 2FJ7A 3LZ1D 3KUYC 2BG1A 3AZGD 1M19C 1KU5A 3X1SD 2ZY5A 2CV5D 2Y2LA 1P3LC 5AV6B 3VH5A 4J8VC 2ZY3A 4J8XC 3P5JB 5B0ZA 1P3IB 3EPHA 4DQYB 1ZLAB 5AV5D 1M18C 3WTPB 3AZHD 1P3BA 2Y2QA 1ZLAC 5B2IB 4XZQB 3AZID 3KWQA 4E44A 1U35B 1P3OA 3WTPC 2Y2PA 3V9RA 5BNVB 1U35C 5DNNA 3X1TD 2BYKA 5GSUB 1KX5C 4H9PA 3AZED 2HIOD 3MGRA 4CAYA 3B6GC 4J8WD 3AZMC 1P3GB 3AFAB 4WNNB 4R8PB 5B33C 4ZUXA 5BS7C 4WU8B 5BT1C 3C1BA 3B0CT 3AFAC 1ID3A 5AY8C 3WKJD 3A6ND 2BYMA 3AZFB 2G5IC 4LD9A 1H3OB 2ZM5A 3IP4C 4Z66A 5BO0A 3KXBA 3REJC 3AYWA 5B24C 1W2EA 3LZ1B 1TZYA 1KX3D 4XUJC 3AV2C 4G91B 3AZKD 2CV5B 5CPIC 3AZGC 3AZNB 3X1SC 3LELD 5E5AA 3REIC 1P3KA 4YS3A 3C1CA 5BNXA 2YFWA 3EG5B 4WZSB 5AV5B 3VH6W 1HQ3B 4ZBJC 2F8NH 5B2JA 3AZJC 4Z2MH 3AZHB 3W98C 1P3PD 3AZIB 5FUGA 5AV5C 3WA9B 1EQZA 5B0YC 5G49A 1TAFB 4Z5TD 3X1TB 3X1UA 3X1VA 5B1MC 2HIOB 3AZEB 3AV1A 3MVDD 4J8UD 2HUEB 1P3MA 4J8WB 3UTBA 1KX4D 1P34A 4DRAA 5AVCD 2IO5B 3REHD 4YM6A 2JSSA 4KGCD 5B31A 3LJAC 3B0BA 5GT3D 3WKJB 3A6NB 2FJ7D 1P3AA 4NE3A 3WAAD 5AVBA 2NZDB 3W99A 5B0ZD 3A1KA 3H0RC 3AN2B 1KX3B 4UUZB 3WTPE 1B67A 3AZKB 5AV6D 5CP6A 1P3BD 3KWQD 3LELB 3B6FB 1F66C 4KUDC 1BH8A 2DQNC 2RIQA 4EO5B 2RVQC 3R45A 5JRGA 4X23A 5GT0D 5B2ID 3MGRD 3UTAC 1P3PB 5CPKC 4QLCA 1P3FC 2LY8A 4Z5TB 4ZUXD 3TU4B 2NQBA 5AV9A 4H9RB 3O62D 3RELC 3MVDB 5GXQC 2PYOC 5JA4A 1KX4B 5AVCB 5B40A 3REHB 4J8UC 3MGPA 3LZ0A 4Z66D 1AOIA 2AROC 3KXBD 3MGQA 4KGCC 5GT3B 3AYWD 5B1LC 2FJ7B 3REKC 1M1AD 3WAAB 3MNNC 3WAAC 5E5AD 5F99C 1P3KD 5B0ZB 4YS3D 5DNMA 3B0DC 1S32A 3NQUA 3MGSA 4H9SC 3W96A 5B2JD 3AZND 1P3BB 3KWQB 1Z2CB 5KDMB 1EQZD 5AV6C 1WWSA 5AV8A 1HQ3D 3V9RB 5DNNB 2BYKB 1P3IC 2F8NG 3X1UD 3X1VD 4H9PB 4Z2MG 2CWEA 5GT0B 1JFIA 3WA9D 3MGRB 4CAYB 1P3MD 3EPJA 1P34D 3AZLA 1WWIA 5GT0C 5B2IC 4XZQC 4YM6D 5B32D 5B31D 4ZUXB 2J8PA 4AWLB 3C1BB 3O62B 1ID3B 5GSUC 3KUYA 2BYMB 1M19A 3UT9D 3O62C 1P3AD 1P3LA 5AVBD 4LD9B 4J8VA 4J8XA 1P3GC 4Z66B 5BO0B 3KXBB 4R8PC 3W99D 3VH5W 3AYWB 4WU8C 1M18A 1TZYB 3AZFC 1M1AB 1ZLAA 2NZDD 5CP6D 3EPLA 2ZY2A 3WTPA 5E5AB 1P3KB 1M1AC 2Y2HA 4YS3B 3AN2D 3C1CB 4CSRA 5BNXB 1KX5A 5JRGD 3LZ1C 5B2JB 3B6GA 2F2AC 4G91C 5FUGB 3AZMA 2CV5C 2F8NK 1EQZB 3B6FD 5G49B 4QLCD 5B33A 3AZNC 5CPJD 5BS7A 2NQBD 5AY8A 5AV9D 3X1UB 3X1VB 2Y2KA 3AV1B 1HQ3C 2Y2GA 1P3MB 1P34B 3AZHC 5B40D 3AZIC 3WA9C 4YM6B 3TU4D 3MGPD 5B32B 5B31B 3REJA 3LZ0D 1AOID 5B24A 3MGQD 4KHAB 3X1TC 5B32C 4NE6A 4XUJA 3AZEC 2HIOC 3UT9B 3AV2A 2HUEC 1P3AB 1PZRA 4J8WC 5AVBB 4JJNA 3AZGA 5CPIA 2IO5C 3X1SA 3UT9C 3REIA 3W97D 3W99B 5DNMD 4NFTA 3A1IA 1S32D 3WKJC 3AZJA 4WU9A 3A6NC 3W98A 3VH6T 3MGSD 3W96D 4H9OA 5AV5A 5CP6B 5B0YA 3KSYA 2NZDC 1BH8B 1T3UA 5AV8D 5B1MA 3R45B 5JRGB 4X23B 1A7WA 2Y2OA 3AN2C 1P3OD 3NQJA 1KX3C 3AZKC 3AZLD 4QLCB 5B32G 5B31G 5DNND 3LELC 2Y2JA 3LJAA 5CPJB 3B6FC 2NQBB 5AV9B 4EO5C 5CPJC 5JA4B 1M19D 1P3PC 5B40B 1P3LD 3MGPB 5C3IB 3C1BD 2Y2NA 4J8VD 4J8XD 3LZ0B 1ID3D 1AOIB 3MGQB 4WJ3C 4Z5TC 3TU4C 4H9QA 4NE5A 3MVDC 2XD5A 4LD9D 1KX4C 3FDDA 5AVCC 3REHC 3W97B 1F66A 4KUDA 5DNMB 1F1EA 1TZYD 1KX5D 1S32B 3W97C 5GT3C 3NQUB 2FJ7C 3MGSB 3UTAA 3W96B 5CPKA 1P3FA 3AZMD 4H9NA 3MGSC 3C1CD 5B33D 5AV8B 3EPKA 3RELA 5B0ZC 1BH9A 3AZIA 5GXQA 1N1JA 2PYOA 5AV8C 1P3OB 1JFIB 4HGAB 2F8NA 4J8UA 3AZLB 1P3BC 1P3OC 3KWQC 2VQRA 2YFVA 2AROA 3AV1D 4KGCA 5B24D 5B1LA 5DNNC 2FFFB 3UTBD 3KUYB 3REKA 3AV2D 1M19B 1ULYA 3MGRC 3MNNA 1P3LB 4JJND 5CPID 4J8VB 4J8XB 3REID 3WAAA 5F99A 3B0CW 4ZUXC 4AWLC 3C1BC 2XD1A 1M18B 1ID3C 4H9SA 3AZJD 4WU9D 3W98D 4G92B 2F8ND 4DRBA 5B0YD 4LD9C 5AV6A 2L5AA 4G92C 2JE5A 4Z66C 3KXBC 4CSRB 5KDMA 1P3IA 1KX5B 3AYWC 5B1MD 3B6GB 1TZYC 5CHLB 3AZMB 5GT0A 5B2IA 4XZQA 1U35A 2YFWB 5B33B 4X23D 5E5AC 3LJAD 1P3KC 3VH6A 4YS3C 1Q9CA 3H0LC 5BNVA 5AY8B 3C1CC 5GSUA 2UWXA 2JCHA 3KFUG 3O62A 5B2JC 2G5HC 2W8SA 1P3GA 1EQZC 3AFAA 4WNNA 3REJB 4R8PA 5B24B 4WU8A 3UTBB 3VH5T 3X1UC 3X1VC 4XUJB 3AV2B 3AV1C 3AZFA 1P3MC 3UTBC 4JJNB 5CPIB 3AZGB 1P34C 4WV4B 3X1SB 1H3OA 3REIB 4YM6C 1M1AA 1F66D 4KUDD 5B31C 4JJNC 2RVQD 4ZBJB 3LZ1A 3AZJB 4WU9B 3W98B 3UTAD 4H9OB 2CV5A 5CPKD 5B0YB 1P3AC 1P3FD 5AVBC 4WU9C 3AZNA 3F6TA 3W99C 3RELD 5B1MB 5GXQD 1HQ3A 2PYOD 3NQJB 3AZHA 5CP6C 3WA9A 4E45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA B;  1TAF A;  2ARO D;  3X1T A;  5B32 A;  5B1L D;  3AZE A;  2HIO A;  4X23 C;  5JRG C;  3REK D;  4KHA A;  4J8W A;  3MNN D;  3UT9 A;  4QLC C;  5F99 D;  3KUY D;  2NQB C;  5AV9 C;  4H9Q B;  3WKJ A;  3A6N A;  1B6W A;  4M6B A;  5B40 C;  3MGP C;  1F66 B;  4KUD B;  2NZD A;  5C3I C;  1M18 D;  3LZ0 C;  1AOI C;  3MGQ C;  1P3I D;  1ZLA D;  3AN2 A;  1KX3 A;  4UUZ A;  3UTA B;  3AZK A;  5CPK B;  3WTP D;  1P3F B;  1R4V A;  4XZQ D;  4H9N B;  1U35 D;  3LEL A;  3B6F A;  3REL B;  3B6G D;  1BH9 B;  5DNM C;  5GXQ B;  5CPJ A;  5GSU D;  1N1J B;  1S32 C;  2PYO B;  3W96 C;  1P3P A;  2F8N B;  4J8U B;  5BT1 D;  1P3G D;  2YFV B;  3AFA D;  5AY8 D;  1BFM A;  2ARO B;  4R8P D;  4Z5T A;  3TU4 A;  4KGC B;  4WU8 D;  5B1L B;  4H9R A;  3MVD A;  3REK B;  3AZF D;  4HGA C;  1KX4 A;  1HTA A;  5AVC A;  3MNN B;  3REH A;  3REJ D;  3AZL C;  5F99 B;  3B0D B;  4XUJ D;  3W97 A;  5GT3 A;  2FJ7 A;  3LZ1 D;  3KUY C;  3AZG D;  1M19 C;  1KU5 A;  3X1S D;  2CV5 D;  1P3L C;  5AV6 B;  3VH5 A;  4J8V C;  4J8X C;  5B0Z A;  1P3I B;  1ZLA B;  5AV5 D;  1M18 C;  3WTP B;  3AZH D;  1P3B A;  1ZLA C;  5B2I B;  4XZQ B;  3AZI D;  3KWQ A;  4E44 A;  1U35 B;  1P3O A;  3WTP C;  3V9R A;  5BNV B;  1U35 C;  5DNN A;  3X1T D;  2BYK A;  5GSU B;  1KX5 C;  4H9P A;  3AZE D;  2HIO D;  3MGR A;  4CAY A;  3B6G C;  4J8W D;  3AZM C;  1P3G B;  3AFA B;  4WNN B;  4R8P B;  5B33 C;  4ZUX A;  5BS7 C;  4WU8 B;  5BT1 C;  3C1B A;  3B0C T;  3AFA C;  1ID3 A;  5AY8 C;  3WKJ D;  3A6N D;  2BYM A;  3AZF B;  4LD9 A;  1H3O B;  4Z66 A;  5BO0 A;  3KXB A;  3REJ C;  3AYW A;  5B24 C;  3LZ1 B;  1TZY A;  1KX3 D;  4XUJ C;  3AV2 C;  4G91 B;  3AZK D;  2CV5 B;  5CPI C;  3AZG C;  3AZN B;  3X1S C;  3LEL D;  5E5A A;  3REI C;  1P3K A;  4YS3 A;  3C1C A;  5BNX A;  2YFW A;  4WZS B;  5AV5 B;  3VH6 W;  1HQ3 B;  4ZBJ C;  2F8N H;  5B2J A;  3AZJ C;  4Z2M H;  3AZH B;  3W98 C;  1P3P D;  3AZI B;  5FUG A;  5AV5 C;  3WA9 B;  1EQZ A;  5B0Y C;  5G49 A;  1TAF B;  4Z5T D;  3X1T B;  3X1U A;  3X1V A;  5B1M C;  2HIO B;  3AZE B;  3AV1 A;  3MVD D;  4J8U D;  2HUE B;  1P3M A;  4J8W B;  3UTB A;  1KX4 D;  1P34 A;  4DRA A;  5AVC D;  2IO5 B;  3REH D;  4YM6 A;  2JSS A;  4KGC D;  5B31 A;  3LJA C;  3B0B A;  5GT3 D;  3WKJ B;  3A6N B;  2FJ7 D;  1P3A A;  4NE3 A;  3WAA D;  5AVB A;  2NZD B;  3W99 A;  5B0Z D;  3AN2 B;  1KX3 B;  4UUZ B;  3WTP E;  1B67 A;  3AZK B;  5AV6 D;  5CP6 A;  1P3B D;  3KWQ D;  3LEL B;  3B6F B;  1F66 C;  4KUD C;  1BH8 A;  4EO5 B;  2RVQ C;  3R45 A;  5JRG A;  4X23 A;  5GT0 D;  5B2I D;  3MGR D;  3UTA C;  1P3P B;  5CPK C;  4QLC A;  1P3F C;  2LY8 A;  4Z5T B;  4ZUX D;  3TU4 B;  2NQB A;  5AV9 A;  4H9R B;  3O62 D;  3REL C;  3MVD B;  5GXQ C;  2PYO C;  5JA4 A;  1KX4 B;  5AVC B;  5B40 A;  3REH B;  4J8U C;  3MGP A;  3LZ0 A;  4Z66 D;  1AOI A;  2ARO C;  3KXB D;  3MGQ A;  4KGC C;  5GT3 B;  3AYW D;  5B1L C;  2FJ7 B;  3REK C;  1M1A D;  3WAA B;  3MNN C;  3WAA C;  5E5A D;  5F99 C;  1P3K D;  5B0Z B;  4YS3 D;  5DNM A;  3B0D C;  1S32 A;  3NQU A;  3MGS A;  4H9S C;  3W96 A;  5B2J D;  3AZN D;  1P3B B;  3KWQ B;  1EQZ D;  5KDM B;  5AV6 C;  1WWS A;  5AV8 A;  1HQ3 D;  3V9R B;  5DNN B;  2BYK B;  1P3I C;  2F8N G;  3X1U D;  3X1V D;  4H9P B;  4Z2M G;  2CWE A;  5GT0 B;  1JFI A;  3WA9 D;  3MGR B;  4CAY B;  1P3M D;  1P34 D;  3AZL A;  1WWI A;  5GT0 C;  5B2I C;  4XZQ C;  4YM6 D;  5B32 D;  5B31 D;  4ZUX B;  4AWL B;  3C1B B;  3O62 B;  1ID3 B;  5GSU C;  3KUY A;  2BYM B;  1M19 A;  3UT9 D;  3O62 C;  1P3A D;  1P3L A;  5AVB D;  4LD9 B;  4J8V A;  4J8X A;  1P3G C;  4Z66 B;  5BO0 B;  3KXB B;  4R8P C;  3W99 D;  3VH5 W;  3AYW B;  4WU8 C;  1M18 A;  1TZY B;  3AZF C;  1M1A B;  1ZLA A;  2NZD D;  5CP6 D;  3WTP A;  5E5A B;  1P3K B;  1M1A C;  4YS3 B;  3AN2 D;  3C1C B;  4CSR A;  5BNX B;  1KX5 A;  5JRG D;  3LZ1 C;  5B2J B;  3B6G A;  4G91 C;  5FUG B;  3AZM A;  2CV5 C;  2F8N K;  1EQZ B;  3B6F D;  5G49 B;  4QLC D;  5B33 A;  3AZN C;  5CPJ D;  5BS7 A;  2NQB D;  5AY8 A;  5AV9 D;  3X1U B;  3X1V B;  3AV1 B;  1HQ3 C;  1P3M B;  1P34 B;  3AZH C;  5B40 D;  3AZI C;  3WA9 C;  4YM6 B;  3TU4 D;  3MGP D;  5B32 B;  5B31 B;  3REJ A;  3LZ0 D;  1AOI D;  5B24 A;  3MGQ D;  4KHA B;  3X1T C;  5B32 C;  4NE6 A;  4XUJ A;  3AZE C;  2HIO C;  3UT9 B;  3AV2 A;  2HUE C;  1P3A B;  4J8W C;  5AVB B;  4JJN A;  3AZG A;  5CPI A;  2IO5 C;  3X1S A;  3UT9 C;  3REI A;  3W97 D;  3W99 B;  5DNM D;  4NFT A;  1S32 D;  3WKJ C;  3AZJ A;  4WU9 A;  3A6N C;  3W98 A;  3VH6 T;  3MGS D;  3W96 D;  4H9O A;  5AV5 A;  5CP6 B;  5B0Y A;  3KSY A;  2NZD C;  1BH8 B;  5AV8 D;  5B1M A;  3R45 B;  5JRG B;  4X23 B;  1A7W A;  3AN2 C;  1P3O D;  1KX3 C;  3NQJ A;  3AZK C;  3AZL D;  4QLC B;  5B32 G;  5B31 G;  5DNN D;  3LEL C;  5CPJ B;  3LJA A;  3B6F C;  2NQB B;  5AV9 B;  4EO5 C;  5CPJ C;  5JA4 B;  1M19 D;  1P3P C;  5B40 B;  1P3L D;  3MGP B;  5C3I B;  3C1B D;  4J8V D;  4J8X D;  3LZ0 B;  1ID3 D;  1AOI B;  3MGQ B;  4Z5T C;  3TU4 C;  4H9Q A;  4NE5 A;  3MVD C;  4LD9 D;  1KX4 C;  5AVC C;  3REH C;  3W97 B;  1F66 A;  4KUD A;  5DNM B;  1F1E A;  1TZY D;  1KX5 D;  1S32 B;  3W97 C;  5GT3 C;  3NQU B;  2FJ7 C;  3MGS B;  3UTA A;  3W96 B;  5CPK A;  1P3F A;  3AZM D;  4H9N A;  3MGS C;  3C1C D;  5B33 D;  5AV8 B;  3REL A;  5B0Z C;  1BH9 A;  3AZI A;  5GXQ A;  1N1J A;  2PYO A;  5AV8 C;  1P3O B;  1JFI B;  4HGA B;  2F8N A;  4J8U A;  3AZL B;  1P3B C;  1P3O C;  3KWQ C;  2YFV A;  2ARO A;  3AV1 D;  4KGC A;  5B24 D;  5B1L A;  5DNN C;  3UTB D;  3KUY B;  3REK A;  3AV2 D;  1M19 B;  1ULY A;  3MGR C;  3MNN A;  1P3L B;  4JJN D;  5CPI D;  4J8V B;  4J8X B;  3REI D;  3WAA A;  5F99 A;  3B0C W;  4ZUX C;  4AWL C;  3C1B C;  1M18 B;  1ID3 C;  4H9S A;  3AZJ D;  4WU9 D;  3W98 D;  4G92 B;  2F8N D;  4DRB A;  5B0Y D;  4LD9 C;  5AV6 A;  2L5A A;  4G92 C;  4Z66 C;  3KXB C;  4CSR B;  5KDM A;  1P3I A;  1KX5 B;  3AYW C;  5B1M D;  3B6G B;  1TZY C;  5CHL B;  3AZM B;  5GT0 A;  5B2I A;  4XZQ A;  1U35 A;  2YFW B;  5B33 B;  4X23 D;  5E5A C;  3LJA D;  1P3K C;  3VH6 A;  4YS3 C;  1Q9C A;  5BNV A;  5AY8 B;  3C1C C;  5GSU A;  3O62 A;  5B2J C;  1P3G A;  1EQZ C;  3AFA A;  4WNN A;  3REJ B;  4R8P A;  5B24 B;  4WU8 A;  3UTB B;  3VH5 T;  3X1U C;  3X1V C;  4XUJ B;  3AV2 B;  3AV1 C;  3AZF A;  1P3M C;  3UTB C;  4JJN B;  5CPI B;  3AZG B;  1P34 C;  4WV4 B;  3X1S B;  1H3O A;  3REI B;  4YM6 C;  1M1A A;  1F66 D;  4KUD D;  5B31 C;  4JJN C;  2RVQ D;  4ZBJ B;  3LZ1 A;  3AZJ B;  4WU9 B;  3W98 B;  3UTA D;  4H9O B;  2CV5 A;  5CPK D;  5B0Y B;  1P3A C;  1P3F D;  5AVB C;  4WU9 C;  3AZN A;  3W99 C;  3REL D;  5B1M B;  5GXQ D;  1HQ3 A;  2PYO D;  3NQJ B;  3AZH A;  5CP6 C;  3WA9 A;  4E45 A; 
#chains in the Genus database with same CATH topology
 3LJA B;  1TAF A;  2Y2M A;  2ARO D;  3X1T A;  5B32 A;  2DF4 C;  5B1L D;  3AZE A;  2HIO A;  4X23 C;  5JRG C;  3REK D;  4KHA A;  4J8W A;  4UPK A;  3MNN D;  3UT9 A;  4QLC C;  5F99 D;  2Y2I A;  3KUY D;  2NQB C;  3H0M C;  4H9Q B;  5AV9 C;  3WKJ A;  3A6N A;  1B6W A;  4M6B A;  5B40 C;  3MGP C;  1F66 B;  4KUD B;  2NZD A;  5C3I C;  1M18 D;  3LZ0 C;  1AOI C;  3MGQ C;  1P3I D;  1ZLA D;  3AN2 A;  1KX3 A;  4UUZ A;  3UTA B;  3AZK A;  5CPK B;  3WTP D;  1P3F B;  1R4V A;  4XZQ D;  4H9N B;  1U35 D;  3LEL A;  3B6F A;  3REL B;  3B6G D;  1BH9 B;  5DNM C;  5GXQ B;  5CPJ A;  5GSU D;  1N1J B;  1S32 C;  2PYO B;  3W96 C;  1P3P A;  2F8N B;  4J8U B;  5BT1 D;  1P3G D;  2YFV B;  3AFA D;  5AY8 D;  1BFM A;  3AL0 C;  2ARO B;  4R8P D;  4Z5T A;  3TU4 A;  4KGC B;  4WU8 D;  5B1L B;  4H9R A;  3MVD A;  3REK B;  3AZF D;  4HGA C;  1KX4 A;  1HTA A;  5AVC A;  3MNN B;  3REH A;  3REJ D;  3AZL C;  5F99 B;  3B0D B;  4XUJ D;  2ZY4 A;  3W97 A;  5GT3 A;  2FJ7 A;  3LZ1 D;  3KUY C;  2BG1 A;  3AZG D;  1M19 C;  1KU5 A;  3X1S D;  2ZY5 A;  2CV5 D;  2Y2L A;  1P3L C;  5AV6 B;  3VH5 A;  4J8V C;  2ZY3 A;  4J8X C;  3P5J B;  5B0Z A;  1P3I B;  3EPH A;  4DQY B;  1ZLA B;  5AV5 D;  1M18 C;  3WTP B;  3AZH D;  1P3B A;  2Y2Q A;  1ZLA C;  5B2I B;  4XZQ B;  3AZI D;  3KWQ A;  4E44 A;  1U35 B;  1P3O A;  3WTP C;  2Y2P A;  3V9R A;  5BNV B;  1U35 C;  5DNN A;  3X1T D;  2BYK A;  5GSU B;  1KX5 C;  4H9P A;  3AZE D;  2HIO D;  3MGR A;  4CAY A;  3B6G C;  4J8W D;  3AZM C;  1P3G B;  3AFA B;  4WNN B;  4R8P B;  5B33 C;  4ZUX A;  5BS7 C;  4WU8 B;  5BT1 C;  3C1B A;  3B0C T;  3AFA C;  1ID3 A;  5AY8 C;  3WKJ D;  3A6N D;  2BYM A;  3AZF B;  2G5I C;  4LD9 A;  1H3O B;  2ZM5 A;  3IP4 C;  4Z66 A;  5BO0 A;  3KXB A;  3REJ C;  3AYW A;  5B24 C;  1W2E A;  3LZ1 B;  1TZY A;  1KX3 D;  4XUJ C;  3AV2 C;  4G91 B;  3AZK D;  2CV5 B;  5CPI C;  3AZG C;  3AZN B;  3X1S C;  3LEL D;  5E5A A;  3REI C;  1P3K A;  4YS3 A;  3C1C A;  5BNX A;  2YFW A;  3EG5 B;  4WZS B;  5AV5 B;  3VH6 W;  1HQ3 B;  4ZBJ C;  2F8N H;  5B2J A;  3AZJ C;  4Z2M H;  3AZH B;  3W98 C;  1P3P D;  3AZI B;  5FUG A;  5AV5 C;  3WA9 B;  1EQZ A;  5B0Y C;  5G49 A;  1TAF B;  4Z5T D;  3X1T B;  3X1U A;  3X1V A;  5B1M C;  2HIO B;  3AZE B;  3AV1 A;  3MVD D;  4J8U D;  2HUE B;  1P3M A;  4J8W B;  3UTB A;  1KX4 D;  1P34 A;  4DRA A;  5AVC D;  2IO5 B;  3REH D;  4YM6 A;  2JSS A;  4KGC D;  5B31 A;  3LJA C;  3B0B A;  5GT3 D;  3WKJ B;  3A6N B;  2FJ7 D;  1P3A A;  4NE3 A;  3WAA D;  5AVB A;  2NZD B;  3W99 A;  5B0Z D;  3A1K A;  3H0R C;  3AN2 B;  1KX3 B;  4UUZ B;  3WTP E;  1B67 A;  3AZK B;  5AV6 D;  5CP6 A;  1P3B D;  3KWQ D;  3LEL B;  3B6F B;  1F66 C;  4KUD C;  1BH8 A;  2DQN C;  2RIQ A;  4EO5 B;  2RVQ C;  3R45 A;  5JRG A;  4X23 A;  5GT0 D;  5B2I D;  3MGR D;  3UTA C;  1P3P B;  5CPK C;  4QLC A;  1P3F C;  2LY8 A;  4Z5T B;  4ZUX D;  3TU4 B;  2NQB A;  5AV9 A;  4H9R B;  3O62 D;  3REL C;  3MVD B;  5GXQ C;  2PYO C;  5JA4 A;  1KX4 B;  5AVC B;  5B40 A;  3REH B;  4J8U C;  3MGP A;  3LZ0 A;  4Z66 D;  1AOI A;  2ARO C;  3KXB D;  3MGQ A;  4KGC C;  5GT3 B;  3AYW D;  5B1L C;  2FJ7 B;  3REK C;  1M1A D;  3WAA B;  3MNN C;  3WAA C;  5E5A D;  5F99 C;  1P3K D;  5B0Z B;  4YS3 D;  5DNM A;  3B0D C;  1S32 A;  3NQU A;  3MGS A;  4H9S C;  3W96 A;  5B2J D;  3AZN D;  1P3B B;  3KWQ B;  1Z2C B;  5KDM B;  1EQZ D;  5AV6 C;  1WWS A;  5AV8 A;  1HQ3 D;  3V9R B;  5DNN B;  2BYK B;  1P3I C;  2F8N G;  3X1U D;  3X1V D;  4H9P B;  4Z2M G;  2CWE A;  5GT0 B;  1JFI A;  3WA9 D;  3MGR B;  4CAY B;  1P3M D;  3EPJ A;  1P34 D;  3AZL A;  1WWI A;  5GT0 C;  5B2I C;  4XZQ C;  4YM6 D;  5B32 D;  5B31 D;  4ZUX B;  2J8P A;  4AWL B;  3C1B B;  3O62 B;  1ID3 B;  5GSU C;  3KUY A;  2BYM B;  1M19 A;  3UT9 D;  3O62 C;  1P3A D;  1P3L A;  5AVB D;  4LD9 B;  4J8V A;  4J8X A;  1P3G C;  4Z66 B;  5BO0 B;  3KXB B;  4R8P C;  3W99 D;  3VH5 W;  3AYW B;  4WU8 C;  1M18 A;  1TZY B;  3AZF C;  1M1A B;  1ZLA A;  2NZD D;  5CP6 D;  3EPL A;  2ZY2 A;  3WTP A;  5E5A B;  1P3K B;  1M1A C;  2Y2H A;  4YS3 B;  3AN2 D;  3C1C B;  4CSR A;  5BNX B;  1KX5 A;  5JRG D;  3LZ1 C;  5B2J B;  3B6G A;  2F2A C;  4G91 C;  5FUG B;  3AZM A;  2CV5 C;  2F8N K;  1EQZ B;  3B6F D;  5G49 B;  4QLC D;  5B33 A;  3AZN C;  5CPJ D;  5BS7 A;  2NQB D;  5AY8 A;  5AV9 D;  3X1U B;  3X1V B;  2Y2K A;  3AV1 B;  1HQ3 C;  2Y2G A;  1P3M B;  1P34 B;  3AZH C;  5B40 D;  3AZI C;  3WA9 C;  4YM6 B;  3TU4 D;  3MGP D;  5B32 B;  5B31 B;  3REJ A;  3LZ0 D;  1AOI D;  5B24 A;  3MGQ D;  4KHA B;  3X1T C;  5B32 C;  4NE6 A;  4XUJ A;  3AZE C;  2HIO C;  3UT9 B;  3AV2 A;  2HUE C;  1P3A B;  1PZR A;  4J8W C;  5AVB B;  4JJN A;  3AZG A;  5CPI A;  2IO5 C;  3X1S A;  3UT9 C;  3REI A;  3W97 D;  3W99 B;  5DNM D;  4NFT A;  3A1I A;  1S32 D;  3WKJ C;  3AZJ A;  4WU9 A;  3A6N C;  3W98 A;  3VH6 T;  3MGS D;  3W96 D;  4H9O A;  5AV5 A;  5CP6 B;  5B0Y A;  3KSY A;  2NZD C;  1BH8 B;  1T3U A;  5AV8 D;  5B1M A;  3R45 B;  5JRG B;  4X23 B;  1A7W A;  2Y2O A;  3AN2 C;  1P3O D;  3NQJ A;  1KX3 C;  3AZK C;  3AZL D;  4QLC B;  5B32 G;  5B31 G;  5DNN D;  3LEL C;  2Y2J A;  3LJA A;  5CPJ B;  3B6F C;  2NQB B;  5AV9 B;  4EO5 C;  5CPJ C;  5JA4 B;  1M19 D;  1P3P C;  5B40 B;  1P3L D;  3MGP B;  5C3I B;  3C1B D;  2Y2N A;  4J8V D;  4J8X D;  3LZ0 B;  1ID3 D;  1AOI B;  3MGQ B;  4WJ3 C;  4Z5T C;  3TU4 C;  4H9Q A;  4NE5 A;  3MVD C;  2XD5 A;  4LD9 D;  1KX4 C;  3FDD A;  5AVC C;  3REH C;  3W97 B;  1F66 A;  4KUD A;  5DNM B;  1F1E A;  1TZY D;  1KX5 D;  1S32 B;  3W97 C;  5GT3 C;  3NQU B;  2FJ7 C;  3MGS B;  3UTA A;  3W96 B;  5CPK A;  1P3F A;  3AZM D;  4H9N A;  3MGS C;  3C1C D;  5B33 D;  5AV8 B;  3EPK A;  3REL A;  5B0Z C;  1BH9 A;  3AZI A;  5GXQ A;  1N1J A;  2PYO A;  5AV8 C;  1P3O B;  1JFI B;  4HGA B;  2F8N A;  4J8U A;  3AZL B;  1P3B C;  1P3O C;  3KWQ C;  2VQR A;  2YFV A;  2ARO A;  3AV1 D;  4KGC A;  5B24 D;  5B1L A;  5DNN C;  2FFF B;  3UTB D;  3KUY B;  3REK A;  3AV2 D;  1M19 B;  1ULY A;  3MGR C;  3MNN A;  1P3L B;  4JJN D;  5CPI D;  4J8V B;  4J8X B;  3REI D;  3WAA A;  5F99 A;  3B0C W;  4ZUX C;  4AWL C;  3C1B C;  2XD1 A;  1M18 B;  1ID3 C;  4H9S A;  3AZJ D;  4WU9 D;  3W98 D;  4G92 B;  2F8N D;  4DRB A;  5B0Y D;  4LD9 C;  5AV6 A;  2L5A A;  4G92 C;  2JE5 A;  4Z66 C;  3KXB C;  4CSR B;  5KDM A;  1P3I A;  1KX5 B;  3AYW C;  5B1M D;  3B6G B;  1TZY C;  5CHL B;  3AZM B;  5GT0 A;  5B2I A;  4XZQ A;  1U35 A;  2YFW B;  5B33 B;  4X23 D;  5E5A C;  3LJA D;  1P3K C;  3VH6 A;  4YS3 C;  1Q9C A;  3H0L C;  5BNV A;  5AY8 B;  3C1C C;  5GSU A;  2UWX A;  2JCH A;  3KFU G;  3O62 A;  5B2J C;  2G5H C;  2W8S A;  1P3G A;  1EQZ C;  3AFA A;  4WNN A;  3REJ B;  4R8P A;  5B24 B;  4WU8 A;  3UTB B;  3VH5 T;  3X1U C;  3X1V C;  4XUJ B;  3AV2 B;  3AV1 C;  3AZF A;  1P3M C;  3UTB C;  4JJN B;  5CPI B;  3AZG B;  1P34 C;  4WV4 B;  3X1S B;  1H3O A;  3REI B;  4YM6 C;  1M1A A;  1F66 D;  4KUD D;  5B31 C;  4JJN C;  2RVQ D;  4ZBJ B;  3LZ1 A;  3AZJ B;  4WU9 B;  3W98 B;  3UTA D;  4H9O B;  2CV5 A;  5CPK D;  5B0Y B;  1P3A C;  1P3F D;  5AVB C;  4WU9 C;  3AZN A;  3F6T A;  3W99 C;  3REL D;  5B1M B;  5GXQ D;  1HQ3 A;  2PYO D;  3NQJ B;  3AZH A;  5CP6 C;  3WA9 A;  4E45 A; 
#chains in the Genus database with same CATH homology
 3LJA B;  1TAF A;  2Y2M A;  2ARO D;  3X1T A;  5B32 A;  2DF4 C;  5B1L D;  3AZE A;  2HIO A;  4X23 C;  5JRG C;  3REK D;  4KHA A;  4J8W A;  4UPK A;  3MNN D;  3UT9 A;  4QLC C;  5F99 D;  2Y2I A;  3KUY D;  2NQB C;  3H0M C;  4H9Q B;  5AV9 C;  3WKJ A;  3A6N A;  1B6W A;  4M6B A;  5B40 C;  3MGP C;  1F66 B;  4KUD B;  2NZD A;  5C3I C;  1M18 D;  3LZ0 C;  1AOI C;  3MGQ C;  1P3I D;  1ZLA D;  3AN2 A;  1KX3 A;  4UUZ A;  3UTA B;  3AZK A;  5CPK B;  3WTP D;  1P3F B;  1R4V A;  4XZQ D;  4H9N B;  1U35 D;  3LEL A;  3B6F A;  3REL B;  3B6G D;  1BH9 B;  5DNM C;  5GXQ B;  5CPJ A;  5GSU D;  1N1J B;  1S32 C;  2PYO B;  3W96 C;  1P3P A;  2F8N B;  4J8U B;  5BT1 D;  1P3G D;  2YFV B;  3AFA D;  5AY8 D;  1BFM A;  3AL0 C;  2ARO B;  4R8P D;  4Z5T A;  3TU4 A;  4KGC B;  4WU8 D;  5B1L B;  4H9R A;  3MVD A;  3REK B;  3AZF D;  4HGA C;  1KX4 A;  1HTA A;  5AVC A;  3MNN B;  3REH A;  3REJ D;  3AZL C;  5F99 B;  3B0D B;  4XUJ D;  2ZY4 A;  3W97 A;  5GT3 A;  2FJ7 A;  3LZ1 D;  3KUY C;  2BG1 A;  3AZG D;  1M19 C;  1KU5 A;  3X1S D;  2ZY5 A;  2CV5 D;  2Y2L A;  1P3L C;  5AV6 B;  3VH5 A;  4J8V C;  2ZY3 A;  4J8X C;  3P5J B;  5B0Z A;  1P3I B;  3EPH A;  4DQY B;  1ZLA B;  5AV5 D;  1M18 C;  3WTP B;  3AZH D;  1P3B A;  2Y2Q A;  1ZLA C;  5B2I B;  4XZQ B;  3AZI D;  3KWQ A;  4E44 A;  1U35 B;  1P3O A;  3WTP C;  2Y2P A;  3V9R A;  5BNV B;  1U35 C;  5DNN A;  3X1T D;  2BYK A;  5GSU B;  1KX5 C;  4H9P A;  3AZE D;  2HIO D;  3MGR A;  4CAY A;  3B6G C;  4J8W D;  3AZM C;  1P3G B;  3AFA B;  4WNN B;  4R8P B;  5B33 C;  4ZUX A;  5BS7 C;  4WU8 B;  5BT1 C;  3C1B A;  3B0C T;  3AFA C;  1ID3 A;  5AY8 C;  3WKJ D;  3A6N D;  2BYM A;  3AZF B;  2G5I C;  4LD9 A;  1H3O B;  2ZM5 A;  3IP4 C;  4Z66 A;  5BO0 A;  3KXB A;  3REJ C;  3AYW A;  5B24 C;  1W2E A;  3LZ1 B;  1TZY A;  1KX3 D;  4XUJ C;  3AV2 C;  4G91 B;  3AZK D;  2CV5 B;  5CPI C;  3AZG C;  3AZN B;  3X1S C;  3LEL D;  5E5A A;  3REI C;  1P3K A;  4YS3 A;  3C1C A;  5BNX A;  2YFW A;  3EG5 B;  4WZS B;  5AV5 B;  3VH6 W;  1HQ3 B;  4ZBJ C;  2F8N H;  5B2J A;  3AZJ C;  4Z2M H;  3AZH B;  3W98 C;  1P3P D;  3AZI B;  5FUG A;  5AV5 C;  3WA9 B;  1EQZ A;  5B0Y C;  5G49 A;  1TAF B;  4Z5T D;  3X1T B;  3X1U A;  3X1V A;  5B1M C;  2HIO B;  3AZE B;  3AV1 A;  3MVD D;  4J8U D;  2HUE B;  1P3M A;  4J8W B;  3UTB A;  1KX4 D;  1P34 A;  4DRA A;  5AVC D;  2IO5 B;  3REH D;  4YM6 A;  2JSS A;  4KGC D;  5B31 A;  3LJA C;  3B0B A;  5GT3 D;  3WKJ B;  3A6N B;  2FJ7 D;  1P3A A;  4NE3 A;  3WAA D;  5AVB A;  2NZD B;  3W99 A;  5B0Z D;  3A1K A;  3H0R C;  3AN2 B;  1KX3 B;  4UUZ B;  3WTP E;  1B67 A;  3AZK B;  5AV6 D;  5CP6 A;  1P3B D;  3KWQ D;  3LEL B;  3B6F B;  1F66 C;  4KUD C;  1BH8 A;  2DQN C;  2RIQ A;  4EO5 B;  2RVQ C;  3R45 A;  5JRG A;  4X23 A;  5GT0 D;  5B2I D;  3MGR D;  3UTA C;  1P3P B;  5CPK C;  4QLC A;  1P3F C;  2LY8 A;  4Z5T B;  4ZUX D;  3TU4 B;  2NQB A;  5AV9 A;  4H9R B;  3O62 D;  3REL C;  3MVD B;  5GXQ C;  2PYO C;  5JA4 A;  1KX4 B;  5AVC B;  5B40 A;  3REH B;  4J8U C;  3MGP A;  3LZ0 A;  4Z66 D;  1AOI A;  2ARO C;  3KXB D;  3MGQ A;  4KGC C;  5GT3 B;  3AYW D;  5B1L C;  2FJ7 B;  3REK C;  1M1A D;  3WAA B;  3MNN C;  3WAA C;  5E5A D;  5F99 C;  1P3K D;  5B0Z B;  4YS3 D;  5DNM A;  3B0D C;  1S32 A;  3NQU A;  3MGS A;  4H9S C;  3W96 A;  5B2J D;  3AZN D;  1P3B B;  3KWQ B;  1Z2C B;  5KDM B;  1EQZ D;  5AV6 C;  1WWS A;  5AV8 A;  1HQ3 D;  3V9R B;  5DNN B;  2BYK B;  1P3I C;  2F8N G;  3X1U D;  3X1V D;  4H9P B;  4Z2M G;  2CWE A;  5GT0 B;  1JFI A;  3WA9 D;  3MGR B;  4CAY B;  1P3M D;  3EPJ A;  1P34 D;  3AZL A;  1WWI A;  5GT0 C;  5B2I C;  4XZQ C;  4YM6 D;  5B32 D;  5B31 D;  4ZUX B;  2J8P A;  4AWL B;  3C1B B;  3O62 B;  1ID3 B;  5GSU C;  3KUY A;  2BYM B;  1M19 A;  3UT9 D;  3O62 C;  1P3A D;  1P3L A;  5AVB D;  4LD9 B;  4J8V A;  4J8X A;  1P3G C;  4Z66 B;  5BO0 B;  3KXB B;  4R8P C;  3W99 D;  3VH5 W;  3AYW B;  4WU8 C;  1M18 A;  1TZY B;  3AZF C;  1M1A B;  1ZLA A;  2NZD D;  5CP6 D;  3EPL A;  2ZY2 A;  3WTP A;  5E5A B;  1P3K B;  1M1A C;  2Y2H A;  4YS3 B;  3AN2 D;  3C1C B;  4CSR A;  5BNX B;  1KX5 A;  5JRG D;  3LZ1 C;  5B2J B;  3B6G A;  2F2A C;  4G91 C;  5FUG B;  3AZM A;  2CV5 C;  2F8N K;  1EQZ B;  3B6F D;  5G49 B;  4QLC D;  5B33 A;  3AZN C;  5CPJ D;  5BS7 A;  2NQB D;  5AY8 A;  5AV9 D;  3X1U B;  3X1V B;  2Y2K A;  3AV1 B;  1HQ3 C;  2Y2G A;  1P3M B;  1P34 B;  3AZH C;  5B40 D;  3AZI C;  3WA9 C;  4YM6 B;  3TU4 D;  3MGP D;  5B32 B;  5B31 B;  3REJ A;  3LZ0 D;  1AOI D;  5B24 A;  3MGQ D;  4KHA B;  3X1T C;  5B32 C;  4NE6 A;  4XUJ A;  3AZE C;  2HIO C;  3UT9 B;  3AV2 A;  2HUE C;  1P3A B;  1PZR A;  4J8W C;  5AVB B;  4JJN A;  3AZG A;  5CPI A;  2IO5 C;  3X1S A;  3UT9 C;  3REI A;  3W97 D;  3W99 B;  5DNM D;  4NFT A;  3A1I A;  1S32 D;  3WKJ C;  3AZJ A;  4WU9 A;  3A6N C;  3W98 A;  3VH6 T;  3MGS D;  3W96 D;  4H9O A;  5AV5 A;  5CP6 B;  5B0Y A;  3KSY A;  2NZD C;  1BH8 B;  1T3U A;  5AV8 D;  5B1M A;  3R45 B;  5JRG B;  4X23 B;  1A7W A;  2Y2O A;  3AN2 C;  1P3O D;  3NQJ A;  1KX3 C;  3AZK C;  3AZL D;  4QLC B;  5B32 G;  5B31 G;  5DNN D;  3LEL C;  2Y2J A;  3LJA A;  5CPJ B;  3B6F C;  2NQB B;  5AV9 B;  4EO5 C;  5CPJ C;  5JA4 B;  1M19 D;  1P3P C;  5B40 B;  1P3L D;  3MGP B;  5C3I B;  3C1B D;  2Y2N A;  4J8V D;  4J8X D;  3LZ0 B;  1ID3 D;  1AOI B;  3MGQ B;  4WJ3 C;  4Z5T C;  3TU4 C;  4H9Q A;  4NE5 A;  3MVD C;  2XD5 A;  4LD9 D;  1KX4 C;  3FDD A;  5AVC C;  3REH C;  3W97 B;  1F66 A;  4KUD A;  5DNM B;  1F1E A;  1TZY D;  1KX5 D;  1S32 B;  3W97 C;  5GT3 C;  3NQU B;  2FJ7 C;  3MGS B;  3UTA A;  3W96 B;  5CPK A;  1P3F A;  3AZM D;  4H9N A;  3MGS C;  3C1C D;  5B33 D;  5AV8 B;  3EPK A;  3REL A;  5B0Z C;  1BH9 A;  3AZI A;  5GXQ A;  1N1J A;  2PYO A;  5AV8 C;  1P3O B;  1JFI B;  4HGA B;  2F8N A;  4J8U A;  3AZL B;  1P3B C;  1P3O C;  3KWQ C;  2VQR A;  2YFV A;  2ARO A;  3AV1 D;  4KGC A;  5B24 D;  5B1L A;  5DNN C;  2FFF B;  3UTB D;  3KUY B;  3REK A;  3AV2 D;  1M19 B;  1ULY A;  3MGR C;  3MNN A;  1P3L B;  4JJN D;  5CPI D;  4J8V B;  4J8X B;  3REI D;  3WAA A;  5F99 A;  3B0C W;  4ZUX C;  4AWL C;  3C1B C;  2XD1 A;  1M18 B;  1ID3 C;  4H9S A;  3AZJ D;  4WU9 D;  3W98 D;  4G92 B;  2F8N D;  4DRB A;  5B0Y D;  4LD9 C;  5AV6 A;  2L5A A;  4G92 C;  2JE5 A;  4Z66 C;  3KXB C;  4CSR B;  5KDM A;  1P3I A;  1KX5 B;  3AYW C;  5B1M D;  3B6G B;  1TZY C;  5CHL B;  3AZM B;  5GT0 A;  5B2I A;  4XZQ A;  1U35 A;  2YFW B;  5B33 B;  4X23 D;  5E5A C;  3LJA D;  1P3K C;  3VH6 A;  4YS3 C;  1Q9C A;  3H0L C;  5BNV A;  5AY8 B;  3C1C C;  5GSU A;  2UWX A;  2JCH A;  3KFU G;  3O62 A;  5B2J C;  2G5H C;  2W8S A;  1P3G A;  1EQZ C;  3AFA A;  4WNN A;  3REJ B;  4R8P A;  5B24 B;  4WU8 A;  3UTB B;  3VH5 T;  3X1U C;  3X1V C;  4XUJ B;  3AV2 B;  3AV1 C;  3AZF A;  1P3M C;  3UTB C;  4JJN B;  5CPI B;  3AZG B;  1P34 C;  4WV4 B;  3X1S B;  1H3O A;  3REI B;  4YM6 C;  1M1A A;  1F66 D;  4KUD D;  5B31 C;  4JJN C;  2RVQ D;  4ZBJ B;  3LZ1 A;  3AZJ B;  4WU9 B;  3W98 B;  3UTA D;  4H9O B;  2CV5 A;  5CPK D;  5B0Y B;  1P3A C;  1P3F D;  5AVB C;  4WU9 C;  3AZN A;  3F6T A;  3W99 C;  3REL D;  5B1M B;  5GXQ D;  1HQ3 A;  2PYO D;  3NQJ B;  3AZH A;  5CP6 C;  3WA9 A;  4E45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...