5B2JA

Human nucleosome containing cpg methylated dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2jA00
2HUEB 3A6ND 4WU9B 1M1AD 4E44A 1N1JA 3X1TC 2BYMA 3B6GA 3AZFD 3X1TB 5DNND 2YFWA 3NQJA 3LJAC 5B31G 2AROD 1KX4C 4J8UC 3X1SD 3AZLD 3KUYD 3AV2C 1P3GD 3LJAB 3UTAA 3AV1C 3KSYA 1ZLAA 1KX4B 4J8UB 2NQBD 3AV2B 3VH6A 3AV1B 5JRGA 3REJB 2NZDC 4J8XA 5AVCD 5B24A 4AWLC 1P3BA 4H9SA 2NZDB 1F66D 4Z66C 4WU9A 1U35C 4AWLB 5B40C 3W99C 4WNNB 4Z66B 3X1TA 1U35B 5B40B 3W99B 3AN2C 5GT0C 3LJAA 1P3IC 1KX4A 4KHAA 3AN2B 3AV2A 5GT0B 3AV1A 1P3IB 3MGQA 3MGPC 5B33D 3MGPB 3LZ0D 5GT3C 2NZDA 3W96D 5GT3B 5F99C 4WNNA 5AV6C 4Z66A 4CSRA 1U35A 3B6GD 4WU8A 5B2ID 5B40A 5DNMC 1P3LC 3W99A 5F99B 5AV6B 1A7WA 4H9NB 5DNMB 1P3LB 4NE6A 5E5AA 3AN2A 3UTAD 5AV8C 1Q9CA 5GT0A 1ZLAD 3UT9B 5AV8B 5JRGD 3MGPA 3AZEA 4J8XD 5B24D 1B67A 1P3BD 4NE3A 5GT3A 4WU9D 3VH5T 5F99A 5AV6A 3X1TD 3O62C 5DNMA 1HTAA 1TAFB 1P3AC 5BNXB 4YS3C 3O62B 3LJAD 1KU5A 1KX4D 4J8UD 4ZBJC 4QLCC 1P3AB 3AV2D 4YS3B 3AV1D 5AV8A 4ZBJB 4QLCB 3RELC 1P3KC 3W98C 2NZDD 3RELB 3W98B 4Z66D 4H9PB 4KGCC 1U35D 4WU8D 5B40D 3W99D 4KGCB 1TAFA 5BNXA 3O62A 3MVDC 5E5AD 1P3AA 3AN2D 4DRBA 4YS3A 5GT0D 3MVDB 3X1VC 4QLCA 5BO0B 2CV5A 3MGPD 3X1VB 3AZED 3RELA 1P3KA 2BYMB 4XZQA 3B6GB 3W98A 4NE5A 5GT3D 4UUZB 5CPJC 4H9PA 4J8WC 3NQJB 4G92C 3AZIA 5F99D 5AV6D 5CPJB 4KGCA 5C3IC 1H3OA 4G92B 3B0BA 5DNMD 4J8VC 4ZUXC 1JFIB 3V9RB 3MVDA 1P3MC 4J8VB 4ZUXB 3UTBA 5BO0A 5AV8D 1AOIC 2LY8A 1P3MB 3X1VA 2JSSA 2YFVB 1M19C 4UUZA 1ID3A 1M19B 5BT1D 5CPJA 4J8WA 3WTPE 3MGQC 4KHAB 4JJNC 3B6FC 3O62D 1JFIA 3MGQB 3V9RA 3WKJA 3WTPC 4J8VA 4JJNB 4ZUXA 1P3AD 4YS3D 3B6FB 2F8NA 1M18C 1P3MA 3WTPB 4QLCD 3AZNC 1M18B 1AOIA 4WU8C 2YFVA 2FJ7C 3RELD 1P3KD 4CSRB 5B0YC 4XZQD 3AZNB 3W98D 4WU8B 5B1MC 1BH9A 1WWIA 2FJ7B 1M19A 5E5AC 5B0YB 4H9RB 5B1MB 2PYOC 4KGCD 5E5AB 5FUGB 3VH6T 2PYOB 4NFTA 5GXQC 3AZEC 4JJNA 1BH8B 3B6FA 5GXQB 3MVDD 5G49B 3WTPA 3AZEB 5AV5C 5B2JC 1M18A 4DRAA 3X1VD 5AV5B 5B2JB 3AZNA 2FJ7A 5B0YA 4H9RA 4R8PA 1ID3D 5B1MA 5CPJD 3W97C 5FUGA 4J8WD 2PYOA 1P34C 5KDMB 5AV9A 1BH8A 3AYWC 1P34B 4EO5C 5GXQA 3C1BC 3WKJD 4J8VD 5G49A 4ZUXD 3AYWB 2F8ND 1P3MD 5AV5A 5BT1C 3VH6W 3MGSC 5B2JA 3VH5A 1AOID 3MGSB 3MNNC 1M19D 2F8NG 4H9QB 3MNNB 3AZJC 3WA9C 5KDMA 3AZJB 3W97A 3WA9B 3X1UC 3MGQD 1P34A 2CV5C 1BFMA 4JJND 5BS7C 4XZQC 3AYWA 3B6FD 3X1UB 1S32C 3C1BA 2CV5B 5B32C 3WTPD 5CPKC 1P3KB 4XZQB 1M18D 3AZGC 3AZIC 1S32B 1ULYA 3MGSA 5CPKB 3REKC 3AZND 3C1CC 3AZIB 3AFAA 2FJ7D 1R4VA 4H9QA 3MNNA 5B0YD 3TU4C 3C1CB 1H3OB 4R8PD 5B1MD 3MGRA 3KWQC 3UTBC 3TU4B 3AZJA 1TZYC 3LZ1C 2PYOD 3WA9A 3KWQB 3UTBB 1TZYB 3LZ1B 5GXQD 3X1UA 1HQ3C 5BS7A 4WZSB 1S32A 1HQ3B 3REIC 1ID3C 5B32A 5AV5D 5B2JD 5CPKA 3AZGA 1ID3B 4M6BA 3R45B 3REIB 4H9OA 3AZHC 3REKA 3C1CA 4J8WB 3WKJC 5C3IB 3TU4A 3WKJB 3KWQA 2BYKB 3W97D 1TZYA 3LZ1A 2F8NB 1P34D 1P3PC 4YM6C 3AYWD 4KUDC 1AOIB 1P3PB 4YM6B 3C1BD 1HQ3A 4KUDB 4XUJC 5CHLB 5GSUC 1BH9B 3REIA 3R45A 3MGSD 4XUJB 5GSUB 3AFAD 3MNND 3AZHA 5CPIC 4G91C 1KX5C 3LZ0A 3AZJD 5CPIB 2BYKA 3AZKC 5JA4A 3WA9D 4G91B 1KX5B 5AY8C 3AZKB 3X1UD 1P3PA 4YM6A 2CV5D 5B0ZC 5AY8B 5B2IA 3LELC 1P3OC 4R8PC 4KUDA 1S32D 5B0ZB 5B32D 3LELB 1P3OB 1KX3C 5CPKD 2IO5C 4R8PB 4XUJA 3AZGD 3AZID 1P3BB 5GSUA 5AV9C 3REJC 2HIOC 1KX3B 2IO5B 3REKD 1EQZC 3C1CD 5CP6C 3AZMA 5AV9B 2HIOB 1EQZB 3TU4D 5CPIA 5B32G 5CP6B 1KX5A 3KWQD 3UTBD 1TZYD 3LZ1D 3AZKA 5AY8A 5AVBC 4Z2MH 1HQ3D 5B0ZA 3LELA 5B1LC 3WAAC 5AVBB 1P3OA 3REID 5B1LB 3WAAB 1KX3A 4J8UA 4Z5TC 3REJA 2F8NH 2HIOA 3AZHD 1EQZA 3W97B 4Z5TB 5CP6A 1P3FC 4WV4B 2RVQC 4EO5B 4Z2MG 3C1BB 3KXBC 3REHC 1P3FB 5BNVB 4X23C 3REHB 1P3PD 4YM6D 1F1EA 3KXBB 3AFAC 4LD9C 4X23B 5AVBA 4KUDD 4LD9B 3AFAB 3MGRC 5B1LA 3WAAA 3UT9C 4XUJD 5GSUD 5B31C 3MGRB 1P3IA 3A6NC 1M1AC 4Z5TA 5B31B 3AZMD 1WWSA 5CPID 1B6WA 3B0DC 3A6NB 1M1AB 3AZFC 5DNNC 1P3FA 1KX5D 3B0DB 2AROC 5BNVA 3AZKD 3AZFB 3B0CT 3X1SC 3AZLC 3KUYC 5DNNB 3REHA 3KXBA 5B32B 1P3GC 5AY8D 2AROB 4X23A 2NQBC 3X1SB 3AZLB 3KUYB 3AZGB 4LD9A 1P3GB 5B0ZD 4H9NA 3LELD 4H9OB 1P3LA 1P3OD 3REKB 2NQBB 5AVCC 4HGAC 1KX3D 3UT9A 1F66C 5AVCB 5B31A 4HGAB 5AV9D 3REJD 2HIOD 2CWEA 1EQZD 1F66B 3A6NA 5CP6D 1M1AA 3AZFA 5DNNA 4CAYB 2AROA 3X1SA 3AZLA 3KUYA 1P3GA 4E45A 5AVBD 2NQBA 5B33C 5B1LD 2F8NK 3WAAD 3LZ0C 3AZHB 3B0CW 3VH5W 5B33B 5AVCA 3W96C 1P3ID 3LZ0B 1F66A 4Z5TD 5JA4B 3B6GC 3W96B 3NQUB 5B2IC 1N1JB 2L5AA 1P3FD 5B2IB 4CAYA 2RVQD 3REHD 3KXBD 2YFWB 3UTAC 1ZLAC 4X23D 4LD9D 3AZMC 3UTAB 5JRGC 1ZLAB 1P3LD 4J8XC 5B33A 3AZMB 5JRGB 5B24C 3MGRD 1P3BC 4H9SC 2HUEC 3UT9D 4J8XB 4WU9C 5B31D 5B24B 3W96A 3NQUA
chains in the Genus database with same CATH superfamily
2HUEB 3A6ND 4WU9B 1M1AD 4E44A 2Y2IA 1N1JA 3X1TC 2BYMA 3B6GA 3KFUG 3AZFD 3X1TB 5DNND 2YFWA 3NQJA 3LJAC 5B31G 2AROD 1KX4C 4J8UC 3X1SD 3AZLD 3KUYD 3AV2C 1P3GD 3LJAB 3UTAA 3AV1C 3KSYA 1ZLAA 1KX4B 4J8UB 2NQBD 3AV2B 3VH6A 3AV1B 5JRGA 3REJB 2NZDC 4J8XA 5AVCD 5B24A 4AWLC 2DQNC 4H9SA 1P3BA 2NZDB 1F66D 2Y2LA 4Z66C 4WU9A 1U35C 4AWLB 2BG1A 5B40C 3W99C 4WNNB 4Z66B 3X1TA 1U35B 5B40B 3W99B 3AN2C 5GT0C 3LJAA 1P3IC 1KX4A 4KHAA 3AN2B 3AV2A 2FFFB 5GT0B 3AV1A 1P3IB 3MGQA 3MGPC 5B33D 3MGPB 3LZ0D 5GT3C 2NZDA 3W96D 5GT3B 5F99C 4WNNA 5AV6C 4Z66A 4CSRA 1U35A 3B6GD 4WU8A 5B2ID 5B40A 5DNMC 1P3LC 3W99A 5F99B 5AV6B 1A7WA 4H9NB 5DNMB 1P3LB 4NE6A 5E5AA 3AN2A 3UTAD 5AV8C 1Q9CA 5GT0A 1ZLAD 3H0RC 3UT9B 1W2EA 2ZY3A 2ZY2A 5AV8B 5JRGD 3MGPA 3AZEA 4J8XD 5B24D 4WJ3C 1B67A 1P3BD 4NE3A 2Y2GA 5GT3A 4WU9D 3VH5T 5F99A 5AV6A 3X1TD 3O62C 5DNMA 1HTAA 1TAFB 1P3AC 5BNXB 4YS3C 3O62B 3LJAD 1KU5A 1KX4D 4J8UD 4ZBJC 4QLCC 1P3AB 3AV2D 1Z2CB 4YS3B 3AV1D 5AV8A 4ZBJB 4QLCB 3RELC 1P3KC 3W98C 2NZDD 3RELB 3W98B 3H0MC 4Z66D 4H9PB 3EPLA 4KGCC 1U35D 4WU8D 5B40D 3W99D 3AL0C 4KGCB 1TAFA 5BNXA 3O62A 3MVDC 3A1IA 5E5AD 1P3AA 3AN2D 4DRBA 4YS3A 5GT0D 3MVDB 3X1VC 4QLCA 5BO0B 2CV5A 3MGPD 3X1VB 3AZED 3RELA 1P3KA 2BYMB 4XZQA 3B6GB 3W98A 4NE5A 5GT3D 2Y2HA 2Y2NA 4UUZB 5CPJC 4H9PA 2J8PA 4J8WC 3NQJB 4G92C 3AZIA 5F99D 5AV6D 5CPJB 4KGCA 5C3IC 1H3OA 4G92B 3B0BA 5DNMD 2JE5A 4J8VC 4ZUXC 1JFIB 3V9RB 3MVDA 1P3MC 4J8VB 4ZUXB 3UTBA 5BO0A 5AV8D 1AOIC 2LY8A 1P3MB 3X1VA 2VQRA 2JSSA 2YFVB 1M19C 4UUZA 1ID3A 1M19B 5BT1D 5CPJA 4J8WA 3WTPE 3MGQC 4KHAB 4JJNC 3B6FC 3O62D 1JFIA 3MGQB 3V9RA 3WKJA 3WTPC 4J8VA 4JJNB 4ZUXA 1P3AD 4YS3D 3B6FB 2F8NA 1M18C 1P3MA 3WTPB 4QLCD 3AZNC 1M18B 1AOIA 4WU8C 2YFVA 2FJ7C 3RELD 1P3KD 4CSRB 5B0YC 4XZQD 3AZNB 3W98D 4WU8B 5B1MC 1BH9A 1WWIA 2FJ7B 1M19A 5E5AC 5B0YB 4H9RB 5B1MB 2PYOC 4KGCD 5E5AB 3EPKA 5FUGB 3VH6T 2PYOB 4NFTA 5GXQC 3AZEC 4JJNA 1BH8B 3B6FA 5GXQB 3MVDD 2XD1A 5G49B 3WTPA 3AZEB 5AV5C 5B2JC 1M18A 4DRAA 3X1VD 5AV5B 5B2JB 3AZNA 2FJ7A 5B0YA 4H9RA 4R8PA 1ID3D 5B1MA 5CPJD 3W97C 5FUGA 4J8WD 2PYOA 1P34C 5KDMB 5AV9A 1BH8A 3AYWC 1P34B 4EO5C 5GXQA 3C1BC 3WKJD 4J8VD 5G49A 4ZUXD 2Y2OA 3AYWB 2F8ND 1P3MD 5AV5A 5BT1C 3VH6W 3MGSC 2W8SA 5B2JA 3VH5A 1AOID 2XD5A 2UWXA 3MGSB 3MNNC 1M19D 2F8NG 4H9QB 3MNNB 3AZJC 3WA9C 5KDMA 3AZJB 3W97A 3WA9B 3X1UC 3MGQD 1P34A 2CV5C 1BFMA 3H0LC 4JJND 5BS7C 1T3UA 4XZQC 3AYWA 3X1UB 3B6FD 1S32C 3C1BA 2CV5B 5B32C 3WTPD 5CPKC 1P3KB 4XZQB 1M18D 3AZGC 3AZIC 1S32B 2Y2PA 1ULYA 3MGSA 5CPKB 3REKC 3AZND 3C1CC 3AZIB 3AFAA 3EPJA 2FJ7D 1R4VA 4H9QA 3MNNA 5B0YD 3TU4C 3C1CB 1H3OB 4R8PD 5B1MD 3MGRA 3IP4C 3KWQC 3UTBC 2ZM5A 3TU4B 3AZJA 1TZYC 3LZ1C 2PYOD 3WA9A 3KWQB 3UTBB 1TZYB 3LZ1B 3EPHA 5GXQD 3X1UA 1HQ3C 5BS7A 4WZSB 1S32A 1HQ3B 3REIC 1ID3C 5B32A 5AV5D 5B2JD 5CPKA 3AZGA 1ID3B 4M6BA 3R45B 3REIB 4H9OA 3AZHC 3REKA 3C1CA 4J8WB 3WKJC 5C3IB 3TU4A 3WKJB 3KWQA 2BYKB 3W97D 1TZYA 3LZ1A 2F8NB 1P34D 1P3PC 4YM6C 2Y2KA 2G5IC 3AYWD 4KUDC 1AOIB 1P3PB 4YM6B 3C1BD 1HQ3A 4KUDB 4XUJC 3A1KA 5CHLB 5GSUC 1BH9B 3REIA 3R45A 3MGSD 4XUJB 5GSUB 3AFAD 3MNND 3AZHA 5CPIC 4G91C 1KX5C 2Y2QA 3LZ0A 3AZJD 2BYKA 5CPIB 3AZKC 5JA4A 3WA9D 4G91B 1KX5B 5AY8C 3AZKB 3X1UD 1P3PA 4YM6A 2Y2MA 2CV5D 5B0ZC 5AY8B 5B2IA 3LELC 1P3OC 4R8PC 4KUDA 1S32D 5B0ZB 5B32D 3LELB 1P3OB 1KX3C 5CPKD 2IO5C 4R8PB 4XUJA 3AZGD 3AZID 1P3BB 5GSUA 5AV9C 3REJC 2HIOC 1KX3B 2IO5B 3REKD 1EQZC 3C1CD 5CP6C 3AZMA 5AV9B 2HIOB 1EQZB 3TU4D 5CPIA 5B32G 5CP6B 1KX5A 3KWQD 3EG5B 3UTBD 3FDDA 1TZYD 3LZ1D 3AZKA 5AY8A 5AVBC 2Y2JA 4Z2MH 1HQ3D 5B0ZA 3LELA 5B1LC 3WAAC 5AVBB 1P3OA 3REID 4UPKA 5B1LB 3WAAB 1KX3A 4J8UA 4Z5TC 3REJA 2F8NH 2HIOA 2G5HC 3AZHD 1EQZA 3W97B 4Z5TB 5CP6A 1P3FC 4WV4B 4DQYB 2RVQC 4EO5B 4Z2MG 3C1BB 3KXBC 3REHC 1P3FB 5BNVB 2ZY4A 4X23C 3REHB 1P3PD 4YM6D 1F1EA 3KXBB 3AFAC 4LD9C 4X23B 5AVBA 4KUDD 4LD9B 3AFAB 2DF4C 3MGRC 5B1LA 3WAAA 3UT9C 4XUJD 5GSUD 5B31C 3MGRB 1P3IA 3A6NC 1M1AC 4Z5TA 5B31B 3AZMD 1WWSA 3P5JB 5CPID 1B6WA 3B0DC 3A6NB 1M1AB 3AZFC 5DNNC 1P3FA 1KX5D 3B0DB 2AROC 5BNVA 3AZKD 3AZFB 3B0CT 3X1SC 3AZLC 3KUYC 5DNNB 3REHA 3KXBA 5B32B 1P3GC 5AY8D 2AROB 4X23A 2NQBC 3X1SB 3AZLB 3KUYB 3AZGB 4LD9A 1P3GB 5B0ZD 4H9NA 3LELD 4H9OB 1P3LA 1P3OD 3REKB 2NQBB 2F2AC 5AVCC 4HGAC 1KX3D 3UT9A 2ZY5A 1F66C 5AVCB 5B31A 4HGAB 5AV9D 3REJD 2HIOD 2RIQA 2CWEA 1EQZD 1F66B 3A6NA 5CP6D 1M1AA 3F6TA 3AZFA 5DNNA 4CAYB 2AROA 3X1SA 3AZLA 3KUYA 1P3GA 4E45A 5AVBD 2NQBA 5B33C 5B1LD 2F8NK 3WAAD 3LZ0C 3AZHB 3B0CW 3VH5W 5B33B 5AVCA 3W96C 1P3ID 3LZ0B 1F66A 1PZRA 4Z5TD 5JA4B 3B6GC 3W96B 3NQUB 5B2IC 1N1JB 2L5AA 1P3FD 5B2IB 4CAYA 2RVQD 3REHD 3KXBD 2YFWB 3UTAC 2JCHA 1ZLAC 4X23D 4LD9D 3AZMC 3UTAB 5JRGC 1ZLAB 1P3LD 4J8XC 5B33A 3AZMB 5JRGB 5B24C 3MGRD 1P3BC 4H9SC 2HUEC 3UT9D 4J8XB 4WU9C 5B31D 5B24B 3W96A 3NQUA
chains in the Genus database with same CATH topology
2HUEB 3A6ND 4WU9B 1M1AD 4E44A 2Y2IA 1N1JA 3X1TC 2BYMA 3B6GA 3KFUG 3AZFD 3X1TB 5DNND 2YFWA 3NQJA 3LJAC 5B31G 2AROD 1KX4C 4J8UC 3X1SD 3AZLD 3KUYD 3AV2C 1P3GD 3LJAB 3UTAA 3AV1C 3KSYA 1ZLAA 1KX4B 4J8UB 2NQBD 3AV2B 3VH6A 3AV1B 5JRGA 3REJB 2NZDC 4J8XA 5AVCD 5B24A 4AWLC 2DQNC 4H9SA 1P3BA 2NZDB 1F66D 2Y2LA 4Z66C 4WU9A 1U35C 4AWLB 2BG1A 5B40C 3W99C 4WNNB 4Z66B 3X1TA 1U35B 5B40B 3W99B 3AN2C 5GT0C 3LJAA 1P3IC 1KX4A 4KHAA 3AN2B 3AV2A 2FFFB 5GT0B 3AV1A 1P3IB 3MGQA 3MGPC 5B33D 3MGPB 3LZ0D 5GT3C 2NZDA 3W96D 5GT3B 5F99C 4WNNA 5AV6C 4Z66A 4CSRA 1U35A 3B6GD 4WU8A 5B2ID 5B40A 5DNMC 1P3LC 3W99A 5F99B 5AV6B 1A7WA 4H9NB 5DNMB 1P3LB 4NE6A 5E5AA 3AN2A 3UTAD 5AV8C 1Q9CA 5GT0A 1ZLAD 3H0RC 3UT9B 1W2EA 2ZY3A 2ZY2A 5AV8B 5JRGD 3MGPA 3AZEA 4J8XD 5B24D 4WJ3C 1B67A 1P3BD 4NE3A 2Y2GA 5GT3A 4WU9D 3VH5T 5F99A 5AV6A 3X1TD 3O62C 5DNMA 1HTAA 1TAFB 1P3AC 5BNXB 4YS3C 3O62B 3LJAD 1KU5A 1KX4D 4J8UD 4ZBJC 4QLCC 1P3AB 3AV2D 1Z2CB 4YS3B 3AV1D 5AV8A 4ZBJB 4QLCB 3RELC 1P3KC 3W98C 2NZDD 3RELB 3W98B 3H0MC 4Z66D 4H9PB 3EPLA 4KGCC 1U35D 4WU8D 5B40D 3W99D 3AL0C 4KGCB 1TAFA 5BNXA 3O62A 3MVDC 3A1IA 5E5AD 1P3AA 3AN2D 4DRBA 4YS3A 5GT0D 3MVDB 3X1VC 4QLCA 5BO0B 2CV5A 3MGPD 3X1VB 3AZED 3RELA 1P3KA 2BYMB 4XZQA 3B6GB 3W98A 4NE5A 5GT3D 2Y2HA 2Y2NA 4UUZB 5CPJC 4H9PA 2J8PA 4J8WC 3NQJB 4G92C 3AZIA 5F99D 5AV6D 5CPJB 4KGCA 5C3IC 1H3OA 4G92B 3B0BA 5DNMD 2JE5A 4J8VC 4ZUXC 1JFIB 3V9RB 3MVDA 1P3MC 4J8VB 4ZUXB 3UTBA 5BO0A 5AV8D 1AOIC 2LY8A 1P3MB 3X1VA 2VQRA 2JSSA 2YFVB 1M19C 4UUZA 1ID3A 1M19B 5BT1D 5CPJA 4J8WA 3WTPE 3MGQC 4KHAB 4JJNC 3B6FC 3O62D 1JFIA 3MGQB 3V9RA 3WKJA 3WTPC 4J8VA 4JJNB 4ZUXA 1P3AD 4YS3D 3B6FB 2F8NA 1M18C 1P3MA 3WTPB 4QLCD 3AZNC 1M18B 1AOIA 4WU8C 2YFVA 2FJ7C 3RELD 1P3KD 4CSRB 5B0YC 4XZQD 3AZNB 3W98D 4WU8B 5B1MC 1BH9A 1WWIA 2FJ7B 1M19A 5E5AC 5B0YB 4H9RB 5B1MB 2PYOC 4KGCD 5E5AB 3EPKA 5FUGB 3VH6T 2PYOB 4NFTA 5GXQC 3AZEC 4JJNA 1BH8B 3B6FA 5GXQB 3MVDD 2XD1A 5G49B 3WTPA 3AZEB 5AV5C 5B2JC 1M18A 4DRAA 3X1VD 5AV5B 5B2JB 3AZNA 2FJ7A 5B0YA 4H9RA 4R8PA 1ID3D 5B1MA 5CPJD 3W97C 5FUGA 4J8WD 2PYOA 1P34C 5KDMB 5AV9A 1BH8A 3AYWC 1P34B 4EO5C 5GXQA 3C1BC 3WKJD 4J8VD 5G49A 4ZUXD 2Y2OA 3AYWB 2F8ND 1P3MD 5AV5A 5BT1C 3VH6W 3MGSC 2W8SA 5B2JA 3VH5A 1AOID 2XD5A 2UWXA 3MGSB 3MNNC 1M19D 2F8NG 4H9QB 3MNNB 3AZJC 3WA9C 5KDMA 3AZJB 3W97A 3WA9B 3X1UC 3MGQD 1P34A 2CV5C 1BFMA 3H0LC 4JJND 5BS7C 1T3UA 4XZQC 3AYWA 3X1UB 3B6FD 1S32C 3C1BA 2CV5B 5B32C 3WTPD 5CPKC 1P3KB 4XZQB 1M18D 3AZGC 3AZIC 1S32B 2Y2PA 1ULYA 3MGSA 5CPKB 3REKC 3AZND 3C1CC 3AZIB 3AFAA 3EPJA 2FJ7D 1R4VA 4H9QA 3MNNA 5B0YD 3TU4C 3C1CB 1H3OB 4R8PD 5B1MD 3MGRA 3IP4C 3KWQC 3UTBC 2ZM5A 3TU4B 3AZJA 1TZYC 3LZ1C 2PYOD 3WA9A 3KWQB 3UTBB 1TZYB 3LZ1B 3EPHA 5GXQD 3X1UA 1HQ3C 5BS7A 4WZSB 1S32A 1HQ3B 3REIC 1ID3C 5B32A 5AV5D 5B2JD 5CPKA 3AZGA 1ID3B 4M6BA 3R45B 3REIB 4H9OA 3AZHC 3REKA 3C1CA 4J8WB 3WKJC 5C3IB 3TU4A 3WKJB 3KWQA 2BYKB 3W97D 1TZYA 3LZ1A 2F8NB 1P34D 1P3PC 4YM6C 2Y2KA 2G5IC 3AYWD 4KUDC 1AOIB 1P3PB 4YM6B 3C1BD 1HQ3A 4KUDB 4XUJC 3A1KA 5CHLB 5GSUC 1BH9B 3REIA 3R45A 3MGSD 4XUJB 5GSUB 3AFAD 3MNND 3AZHA 5CPIC 4G91C 1KX5C 2Y2QA 3LZ0A 3AZJD 2BYKA 5CPIB 3AZKC 5JA4A 3WA9D 4G91B 1KX5B 5AY8C 3AZKB 3X1UD 1P3PA 4YM6A 2Y2MA 2CV5D 5B0ZC 5AY8B 5B2IA 3LELC 1P3OC 4R8PC 4KUDA 1S32D 5B0ZB 5B32D 3LELB 1P3OB 1KX3C 5CPKD 2IO5C 4R8PB 4XUJA 3AZGD 3AZID 1P3BB 5GSUA 5AV9C 3REJC 2HIOC 1KX3B 2IO5B 3REKD 1EQZC 3C1CD 5CP6C 3AZMA 5AV9B 2HIOB 1EQZB 3TU4D 5CPIA 5B32G 5CP6B 1KX5A 3KWQD 3EG5B 3UTBD 3FDDA 1TZYD 3LZ1D 3AZKA 5AY8A 5AVBC 2Y2JA 4Z2MH 1HQ3D 5B0ZA 3LELA 5B1LC 3WAAC 5AVBB 1P3OA 3REID 4UPKA 5B1LB 3WAAB 1KX3A 4J8UA 4Z5TC 3REJA 2F8NH 2HIOA 2G5HC 3AZHD 1EQZA 3W97B 4Z5TB 5CP6A 1P3FC 4WV4B 4DQYB 2RVQC 4EO5B 4Z2MG 3C1BB 3KXBC 3REHC 1P3FB 5BNVB 2ZY4A 4X23C 3REHB 1P3PD 4YM6D 1F1EA 3KXBB 3AFAC 4LD9C 4X23B 5AVBA 4KUDD 4LD9B 3AFAB 2DF4C 3MGRC 5B1LA 3WAAA 3UT9C 4XUJD 5GSUD 5B31C 3MGRB 1P3IA 3A6NC 1M1AC 4Z5TA 5B31B 3AZMD 1WWSA 3P5JB 5CPID 1B6WA 3B0DC 3A6NB 1M1AB 3AZFC 5DNNC 1P3FA 1KX5D 3B0DB 2AROC 5BNVA 3AZKD 3AZFB 3B0CT 3X1SC 3AZLC 3KUYC 5DNNB 3REHA 3KXBA 5B32B 1P3GC 5AY8D 2AROB 4X23A 2NQBC 3X1SB 3AZLB 3KUYB 3AZGB 4LD9A 1P3GB 5B0ZD 4H9NA 3LELD 4H9OB 1P3LA 1P3OD 3REKB 2NQBB 2F2AC 5AVCC 4HGAC 1KX3D 3UT9A 2ZY5A 1F66C 5AVCB 5B31A 4HGAB 5AV9D 3REJD 2HIOD 2RIQA 2CWEA 1EQZD 1F66B 3A6NA 5CP6D 1M1AA 3F6TA 3AZFA 5DNNA 4CAYB 2AROA 3X1SA 3AZLA 3KUYA 1P3GA 4E45A 5AVBD 2NQBA 5B33C 5B1LD 2F8NK 3WAAD 3LZ0C 3AZHB 3B0CW 3VH5W 5B33B 5AVCA 3W96C 1P3ID 3LZ0B 1F66A 1PZRA 4Z5TD 5JA4B 3B6GC 3W96B 3NQUB 5B2IC 1N1JB 2L5AA 1P3FD 5B2IB 4CAYA 2RVQD 3REHD 3KXBD 2YFWB 3UTAC 2JCHA 1ZLAC 4X23D 4LD9D 3AZMC 3UTAB 5JRGC 1ZLAB 1P3LD 4J8XC 5B33A 3AZMB 5JRGB 5B24C 3MGRD 1P3BC 4H9SC 2HUEC 3UT9D 4J8XB 4WU9C 5B31D 5B24B 3W96A 3NQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE B;  3A6N D;  4WU9 B;  1M1A D;  4E44 A;  1N1J A;  3X1T C;  2BYM A;  3B6G A;  3AZF D;  3X1T B;  5DNN D;  2YFW A;  3NQJ A;  3LJA C;  5B31 G;  2ARO D;  1KX4 C;  4J8U C;  3X1S D;  3AZL D;  3KUY D;  3AV2 C;  1P3G D;  3LJA B;  3UTA A;  3AV1 C;  3KSY A;  1ZLA A;  1KX4 B;  4J8U B;  2NQB D;  3AV2 B;  3VH6 A;  3AV1 B;  5JRG A;  3REJ B;  2NZD C;  4J8X A;  5AVC D;  5B24 A;  4AWL C;  1P3B A;  4H9S A;  2NZD B;  1F66 D;  4Z66 C;  4WU9 A;  1U35 C;  4AWL B;  5B40 C;  3W99 C;  4WNN B;  4Z66 B;  3X1T A;  1U35 B;  5B40 B;  3W99 B;  3AN2 C;  5GT0 C;  3LJA A;  1P3I C;  1KX4 A;  4KHA A;  3AN2 B;  3AV2 A;  5GT0 B;  3AV1 A;  1P3I B;  3MGQ A;  3MGP C;  5B33 D;  3MGP B;  3LZ0 D;  5GT3 C;  2NZD A;  3W96 D;  5GT3 B;  5F99 C;  4WNN A;  5AV6 C;  4Z66 A;  4CSR A;  1U35 A;  3B6G D;  4WU8 A;  5B2I D;  5B40 A;  5DNM C;  1P3L C;  3W99 A;  5F99 B;  5AV6 B;  1A7W A;  4H9N B;  5DNM B;  1P3L B;  4NE6 A;  5E5A A;  3AN2 A;  3UTA D;  5AV8 C;  1Q9C A;  5GT0 A;  1ZLA D;  3UT9 B;  5AV8 B;  5JRG D;  3MGP A;  3AZE A;  4J8X D;  5B24 D;  1B67 A;  1P3B D;  4NE3 A;  5GT3 A;  4WU9 D;  3VH5 T;  5F99 A;  5AV6 A;  3X1T D;  3O62 C;  5DNM A;  1HTA A;  1TAF B;  1P3A C;  5BNX B;  4YS3 C;  3O62 B;  3LJA D;  1KU5 A;  1KX4 D;  4J8U D;  4ZBJ C;  4QLC C;  1P3A B;  3AV2 D;  4YS3 B;  3AV1 D;  5AV8 A;  4ZBJ B;  4QLC B;  3REL C;  1P3K C;  3W98 C;  2NZD D;  3REL B;  3W98 B;  4Z66 D;  4H9P B;  4KGC C;  1U35 D;  4WU8 D;  5B40 D;  3W99 D;  4KGC B;  1TAF A;  5BNX A;  3O62 A;  3MVD C;  5E5A D;  1P3A A;  3AN2 D;  4DRB A;  4YS3 A;  5GT0 D;  3MVD B;  3X1V C;  4QLC A;  5BO0 B;  2CV5 A;  3MGP D;  3X1V B;  3AZE D;  3REL A;  1P3K A;  2BYM B;  4XZQ A;  3B6G B;  3W98 A;  4NE5 A;  5GT3 D;  4UUZ B;  5CPJ C;  4H9P A;  4J8W C;  3NQJ B;  4G92 C;  3AZI A;  5F99 D;  5AV6 D;  5CPJ B;  4KGC A;  5C3I C;  1H3O A;  4G92 B;  3B0B A;  5DNM D;  4J8V C;  4ZUX C;  1JFI B;  3V9R B;  3MVD A;  1P3M C;  4J8V B;  4ZUX B;  3UTB A;  5BO0 A;  5AV8 D;  1AOI C;  2LY8 A;  1P3M B;  3X1V A;  2JSS A;  2YFV B;  1M19 C;  4UUZ A;  1ID3 A;  1M19 B;  5BT1 D;  5CPJ A;  4J8W A;  3WTP E;  3MGQ C;  4KHA B;  4JJN C;  3B6F C;  3O62 D;  1JFI A;  3MGQ B;  3V9R A;  3WKJ A;  3WTP C;  4J8V A;  4JJN B;  4ZUX A;  1P3A D;  4YS3 D;  3B6F B;  2F8N A;  1M18 C;  1P3M A;  3WTP B;  4QLC D;  3AZN C;  1M18 B;  1AOI A;  4WU8 C;  2YFV A;  2FJ7 C;  3REL D;  1P3K D;  4CSR B;  5B0Y C;  4XZQ D;  3AZN B;  3W98 D;  4WU8 B;  5B1M C;  1BH9 A;  1WWI A;  2FJ7 B;  1M19 A;  5E5A C;  5B0Y B;  4H9R B;  5B1M B;  2PYO C;  4KGC D;  5E5A B;  5FUG B;  3VH6 T;  2PYO B;  4NFT A;  5GXQ C;  3AZE C;  4JJN A;  1BH8 B;  3B6F A;  5GXQ B;  3MVD D;  5G49 B;  3WTP A;  3AZE B;  5AV5 C;  5B2J C;  1M18 A;  4DRA A;  3X1V D;  5AV5 B;  5B2J B;  3AZN A;  2FJ7 A;  5B0Y A;  4H9R A;  4R8P A;  1ID3 D;  5B1M A;  5CPJ D;  3W97 C;  5FUG A;  4J8W D;  2PYO A;  1P34 C;  5KDM B;  5AV9 A;  1BH8 A;  3AYW C;  1P34 B;  4EO5 C;  5GXQ A;  3C1B C;  3WKJ D;  4J8V D;  5G49 A;  4ZUX D;  3AYW B;  2F8N D;  1P3M D;  5AV5 A;  5BT1 C;  3VH6 W;  3MGS C;  5B2J A;  3VH5 A;  1AOI D;  3MGS B;  3MNN C;  1M19 D;  2F8N G;  4H9Q B;  3MNN B;  3AZJ C;  3WA9 C;  5KDM A;  3AZJ B;  3W97 A;  3WA9 B;  3X1U C;  3MGQ D;  1P34 A;  2CV5 C;  1BFM A;  4JJN D;  5BS7 C;  4XZQ C;  3AYW A;  3B6F D;  3X1U B;  1S32 C;  3C1B A;  2CV5 B;  5B32 C;  3WTP D;  5CPK C;  1P3K B;  4XZQ B;  1M18 D;  3AZG C;  3AZI C;  1S32 B;  1ULY A;  3MGS A;  5CPK B;  3REK C;  3AZN D;  3C1C C;  3AZI B;  3AFA A;  2FJ7 D;  1R4V A;  4H9Q A;  3MNN A;  5B0Y D;  3TU4 C;  3C1C B;  1H3O B;  4R8P D;  5B1M D;  3MGR A;  3KWQ C;  3UTB C;  3TU4 B;  3AZJ A;  1TZY C;  3LZ1 C;  2PYO D;  3WA9 A;  3KWQ B;  3UTB B;  1TZY B;  3LZ1 B;  5GXQ D;  3X1U A;  1HQ3 C;  5BS7 A;  4WZS B;  1S32 A;  1HQ3 B;  3REI C;  1ID3 C;  5B32 A;  5AV5 D;  5B2J D;  5CPK A;  3AZG A;  1ID3 B;  4M6B A;  3R45 B;  3REI B;  4H9O A;  3AZH C;  3REK A;  3C1C A;  4J8W B;  3WKJ C;  5C3I B;  3TU4 A;  3WKJ B;  3KWQ A;  2BYK B;  3W97 D;  1TZY A;  3LZ1 A;  2F8N B;  1P34 D;  1P3P C;  4YM6 C;  3AYW D;  4KUD C;  1AOI B;  1P3P B;  4YM6 B;  3C1B D;  1HQ3 A;  4KUD B;  4XUJ C;  5CHL B;  5GSU C;  1BH9 B;  3REI A;  3R45 A;  3MGS D;  4XUJ B;  5GSU B;  3AFA D;  3MNN D;  3AZH A;  5CPI C;  4G91 C;  1KX5 C;  3LZ0 A;  3AZJ D;  5CPI B;  2BYK A;  3AZK C;  5JA4 A;  3WA9 D;  4G91 B;  1KX5 B;  5AY8 C;  3AZK B;  3X1U D;  1P3P A;  4YM6 A;  2CV5 D;  5B0Z C;  5AY8 B;  5B2I A;  3LEL C;  1P3O C;  4R8P C;  4KUD A;  1S32 D;  5B0Z B;  5B32 D;  3LEL B;  1P3O B;  1KX3 C;  5CPK D;  2IO5 C;  4R8P B;  4XUJ A;  3AZG D;  3AZI D;  1P3B B;  5GSU A;  5AV9 C;  3REJ C;  2HIO C;  1KX3 B;  2IO5 B;  3REK D;  1EQZ C;  3C1C D;  5CP6 C;  3AZM A;  5AV9 B;  2HIO B;  1EQZ B;  3TU4 D;  5CPI A;  5B32 G;  5CP6 B;  1KX5 A;  3KWQ D;  3UTB D;  1TZY D;  3LZ1 D;  3AZK A;  5AY8 A;  5AVB C;  4Z2M H;  1HQ3 D;  5B0Z A;  3LEL A;  5B1L C;  3WAA C;  5AVB B;  1P3O A;  3REI D;  5B1L B;  3WAA B;  1KX3 A;  4J8U A;  4Z5T C;  3REJ A;  2F8N H;  2HIO A;  3AZH D;  1EQZ A;  3W97 B;  4Z5T B;  5CP6 A;  1P3F C;  4WV4 B;  2RVQ C;  4EO5 B;  4Z2M G;  3C1B B;  3KXB C;  3REH C;  1P3F B;  5BNV B;  4X23 C;  3REH B;  1P3P D;  4YM6 D;  1F1E A;  3KXB B;  3AFA C;  4LD9 C;  4X23 B;  5AVB A;  4KUD D;  4LD9 B;  3AFA B;  3MGR C;  5B1L A;  3WAA A;  3UT9 C;  4XUJ D;  5GSU D;  5B31 C;  3MGR B;  1P3I A;  3A6N C;  1M1A C;  4Z5T A;  5B31 B;  3AZM D;  1WWS A;  5CPI D;  1B6W A;  3B0D C;  3A6N B;  1M1A B;  3AZF C;  5DNN C;  1P3F A;  1KX5 D;  3B0D B;  2ARO C;  5BNV A;  3AZK D;  3AZF B;  3B0C T;  3X1S C;  3AZL C;  3KUY C;  5DNN B;  3REH A;  3KXB A;  5B32 B;  1P3G C;  5AY8 D;  2ARO B;  4X23 A;  2NQB C;  3X1S B;  3AZL B;  3KUY B;  3AZG B;  4LD9 A;  1P3G B;  5B0Z D;  4H9N A;  3LEL D;  4H9O B;  1P3L A;  1P3O D;  3REK B;  2NQB B;  5AVC C;  4HGA C;  1KX3 D;  3UT9 A;  1F66 C;  5AVC B;  5B31 A;  4HGA B;  5AV9 D;  3REJ D;  2HIO D;  2CWE A;  1EQZ D;  1F66 B;  3A6N A;  5CP6 D;  1M1A A;  3AZF A;  5DNN A;  4CAY B;  2ARO A;  3X1S A;  3AZL A;  3KUY A;  1P3G A;  4E45 A;  5AVB D;  2NQB A;  5B33 C;  5B1L D;  2F8N K;  3WAA D;  3LZ0 C;  3AZH B;  3B0C W;  3VH5 W;  5B33 B;  5AVC A;  3W96 C;  1P3I D;  3LZ0 B;  1F66 A;  4Z5T D;  5JA4 B;  3B6G C;  3W96 B;  3NQU B;  5B2I C;  1N1J B;  2L5A A;  1P3F D;  5B2I B;  4CAY A;  2RVQ D;  3REH D;  3KXB D;  2YFW B;  3UTA C;  1ZLA C;  4X23 D;  4LD9 D;  3AZM C;  3UTA B;  5JRG C;  1ZLA B;  1P3L D;  4J8X C;  5B33 A;  3AZM B;  5JRG B;  5B24 C;  3MGR D;  1P3B C;  4H9S C;  2HUE C;  3UT9 D;  4J8X B;  4WU9 C;  5B31 D;  5B24 B;  3W96 A;  3NQU A; 
#chains in the Genus database with same CATH topology
 2HUE B;  3A6N D;  4WU9 B;  1M1A D;  4E44 A;  2Y2I A;  1N1J A;  3X1T C;  2BYM A;  3B6G A;  3KFU G;  3AZF D;  3X1T B;  5DNN D;  2YFW A;  3NQJ A;  3LJA C;  5B31 G;  2ARO D;  1KX4 C;  4J8U C;  3X1S D;  3AZL D;  3KUY D;  3AV2 C;  1P3G D;  3LJA B;  3UTA A;  3AV1 C;  3KSY A;  1ZLA A;  1KX4 B;  4J8U B;  2NQB D;  3AV2 B;  3VH6 A;  3AV1 B;  5JRG A;  3REJ B;  2NZD C;  4J8X A;  5AVC D;  5B24 A;  4AWL C;  2DQN C;  4H9S A;  1P3B A;  2NZD B;  1F66 D;  2Y2L A;  4Z66 C;  4WU9 A;  1U35 C;  4AWL B;  2BG1 A;  5B40 C;  3W99 C;  4WNN B;  4Z66 B;  3X1T A;  1U35 B;  5B40 B;  3W99 B;  3AN2 C;  5GT0 C;  3LJA A;  1P3I C;  1KX4 A;  4KHA A;  3AN2 B;  3AV2 A;  2FFF B;  5GT0 B;  3AV1 A;  1P3I B;  3MGQ A;  3MGP C;  5B33 D;  3MGP B;  3LZ0 D;  5GT3 C;  2NZD A;  3W96 D;  5GT3 B;  5F99 C;  4WNN A;  5AV6 C;  4Z66 A;  4CSR A;  1U35 A;  3B6G D;  4WU8 A;  5B2I D;  5B40 A;  5DNM C;  1P3L C;  3W99 A;  5F99 B;  5AV6 B;  1A7W A;  4H9N B;  5DNM B;  1P3L B;  4NE6 A;  5E5A A;  3AN2 A;  3UTA D;  5AV8 C;  1Q9C A;  5GT0 A;  1ZLA D;  3H0R C;  3UT9 B;  1W2E A;  2ZY3 A;  2ZY2 A;  5AV8 B;  5JRG D;  3MGP A;  3AZE A;  4J8X D;  5B24 D;  4WJ3 C;  1B67 A;  1P3B D;  4NE3 A;  2Y2G A;  5GT3 A;  4WU9 D;  3VH5 T;  5F99 A;  5AV6 A;  3X1T D;  3O62 C;  5DNM A;  1HTA A;  1TAF B;  1P3A C;  5BNX B;  4YS3 C;  3O62 B;  3LJA D;  1KU5 A;  1KX4 D;  4J8U D;  4ZBJ C;  4QLC C;  1P3A B;  3AV2 D;  1Z2C B;  4YS3 B;  3AV1 D;  5AV8 A;  4ZBJ B;  4QLC B;  3REL C;  1P3K C;  3W98 C;  2NZD D;  3REL B;  3W98 B;  3H0M C;  4Z66 D;  4H9P B;  3EPL A;  4KGC C;  1U35 D;  4WU8 D;  5B40 D;  3W99 D;  3AL0 C;  4KGC B;  1TAF A;  5BNX A;  3O62 A;  3MVD C;  3A1I A;  5E5A D;  1P3A A;  3AN2 D;  4DRB A;  4YS3 A;  5GT0 D;  3MVD B;  3X1V C;  4QLC A;  5BO0 B;  2CV5 A;  3MGP D;  3X1V B;  3AZE D;  3REL A;  1P3K A;  2BYM B;  4XZQ A;  3B6G B;  3W98 A;  4NE5 A;  5GT3 D;  2Y2H A;  2Y2N A;  4UUZ B;  5CPJ C;  4H9P A;  2J8P A;  4J8W C;  3NQJ B;  4G92 C;  3AZI A;  5F99 D;  5AV6 D;  5CPJ B;  4KGC A;  5C3I C;  1H3O A;  4G92 B;  3B0B A;  5DNM D;  2JE5 A;  4J8V C;  4ZUX C;  1JFI B;  3V9R B;  3MVD A;  1P3M C;  4J8V B;  4ZUX B;  3UTB A;  5BO0 A;  5AV8 D;  1AOI C;  2LY8 A;  1P3M B;  3X1V A;  2VQR A;  2JSS A;  2YFV B;  1M19 C;  4UUZ A;  1ID3 A;  1M19 B;  5BT1 D;  5CPJ A;  4J8W A;  3WTP E;  3MGQ C;  4KHA B;  4JJN C;  3B6F C;  3O62 D;  1JFI A;  3MGQ B;  3V9R A;  3WKJ A;  3WTP C;  4J8V A;  4JJN B;  4ZUX A;  1P3A D;  4YS3 D;  3B6F B;  2F8N A;  1M18 C;  1P3M A;  3WTP B;  4QLC D;  3AZN C;  1M18 B;  1AOI A;  4WU8 C;  2YFV A;  2FJ7 C;  3REL D;  1P3K D;  4CSR B;  5B0Y C;  4XZQ D;  3AZN B;  3W98 D;  4WU8 B;  5B1M C;  1BH9 A;  1WWI A;  2FJ7 B;  1M19 A;  5E5A C;  5B0Y B;  4H9R B;  5B1M B;  2PYO C;  4KGC D;  5E5A B;  3EPK A;  5FUG B;  3VH6 T;  2PYO B;  4NFT A;  5GXQ C;  3AZE C;  4JJN A;  1BH8 B;  3B6F A;  5GXQ B;  3MVD D;  2XD1 A;  5G49 B;  3WTP A;  3AZE B;  5AV5 C;  5B2J C;  1M18 A;  4DRA A;  3X1V D;  5AV5 B;  5B2J B;  3AZN A;  2FJ7 A;  5B0Y A;  4H9R A;  4R8P A;  1ID3 D;  5B1M A;  5CPJ D;  3W97 C;  5FUG A;  4J8W D;  2PYO A;  1P34 C;  5KDM B;  5AV9 A;  1BH8 A;  3AYW C;  1P34 B;  4EO5 C;  5GXQ A;  3C1B C;  3WKJ D;  4J8V D;  5G49 A;  4ZUX D;  2Y2O A;  3AYW B;  2F8N D;  1P3M D;  5AV5 A;  5BT1 C;  3VH6 W;  3MGS C;  2W8S A;  5B2J A;  3VH5 A;  1AOI D;  2XD5 A;  2UWX A;  3MGS B;  3MNN C;  1M19 D;  2F8N G;  4H9Q B;  3MNN B;  3AZJ C;  3WA9 C;  5KDM A;  3AZJ B;  3W97 A;  3WA9 B;  3X1U C;  3MGQ D;  1P34 A;  2CV5 C;  1BFM A;  3H0L C;  4JJN D;  5BS7 C;  1T3U A;  4XZQ C;  3AYW A;  3X1U B;  3B6F D;  1S32 C;  3C1B A;  2CV5 B;  5B32 C;  3WTP D;  5CPK C;  1P3K B;  4XZQ B;  1M18 D;  3AZG C;  3AZI C;  1S32 B;  2Y2P A;  1ULY A;  3MGS A;  5CPK B;  3REK C;  3AZN D;  3C1C C;  3AZI B;  3AFA A;  3EPJ A;  2FJ7 D;  1R4V A;  4H9Q A;  3MNN A;  5B0Y D;  3TU4 C;  3C1C B;  1H3O B;  4R8P D;  5B1M D;  3MGR A;  3IP4 C;  3KWQ C;  3UTB C;  2ZM5 A;  3TU4 B;  3AZJ A;  1TZY C;  3LZ1 C;  2PYO D;  3WA9 A;  3KWQ B;  3UTB B;  1TZY B;  3LZ1 B;  3EPH A;  5GXQ D;  3X1U A;  1HQ3 C;  5BS7 A;  4WZS B;  1S32 A;  1HQ3 B;  3REI C;  1ID3 C;  5B32 A;  5AV5 D;  5B2J D;  5CPK A;  3AZG A;  1ID3 B;  4M6B A;  3R45 B;  3REI B;  4H9O A;  3AZH C;  3REK A;  3C1C A;  4J8W B;  3WKJ C;  5C3I B;  3TU4 A;  3WKJ B;  3KWQ A;  2BYK B;  3W97 D;  1TZY A;  3LZ1 A;  2F8N B;  1P34 D;  1P3P C;  4YM6 C;  2Y2K A;  2G5I C;  3AYW D;  4KUD C;  1AOI B;  1P3P B;  4YM6 B;  3C1B D;  1HQ3 A;  4KUD B;  4XUJ C;  3A1K A;  5CHL B;  5GSU C;  1BH9 B;  3REI A;  3R45 A;  3MGS D;  4XUJ B;  5GSU B;  3AFA D;  3MNN D;  3AZH A;  5CPI C;  4G91 C;  1KX5 C;  2Y2Q A;  3LZ0 A;  3AZJ D;  2BYK A;  5CPI B;  3AZK C;  5JA4 A;  3WA9 D;  4G91 B;  1KX5 B;  5AY8 C;  3AZK B;  3X1U D;  1P3P A;  4YM6 A;  2Y2M A;  2CV5 D;  5B0Z C;  5AY8 B;  5B2I A;  3LEL C;  1P3O C;  4R8P C;  4KUD A;  1S32 D;  5B0Z B;  5B32 D;  3LEL B;  1P3O B;  1KX3 C;  5CPK D;  2IO5 C;  4R8P B;  4XUJ A;  3AZG D;  3AZI D;  1P3B B;  5GSU A;  5AV9 C;  3REJ C;  2HIO C;  1KX3 B;  2IO5 B;  3REK D;  1EQZ C;  3C1C D;  5CP6 C;  3AZM A;  5AV9 B;  2HIO B;  1EQZ B;  3TU4 D;  5CPI A;  5B32 G;  5CP6 B;  1KX5 A;  3KWQ D;  3EG5 B;  3UTB D;  3FDD A;  1TZY D;  3LZ1 D;  3AZK A;  5AY8 A;  5AVB C;  2Y2J A;  4Z2M H;  1HQ3 D;  5B0Z A;  3LEL A;  5B1L C;  3WAA C;  5AVB B;  1P3O A;  3REI D;  4UPK A;  5B1L B;  3WAA B;  1KX3 A;  4J8U A;  4Z5T C;  3REJ A;  2F8N H;  2HIO A;  2G5H C;  3AZH D;  1EQZ A;  3W97 B;  4Z5T B;  5CP6 A;  1P3F C;  4WV4 B;  4DQY B;  2RVQ C;  4EO5 B;  4Z2M G;  3C1B B;  3KXB C;  3REH C;  1P3F B;  5BNV B;  2ZY4 A;  4X23 C;  3REH B;  1P3P D;  4YM6 D;  1F1E A;  3KXB B;  3AFA C;  4LD9 C;  4X23 B;  5AVB A;  4KUD D;  4LD9 B;  3AFA B;  2DF4 C;  3MGR C;  5B1L A;  3WAA A;  3UT9 C;  4XUJ D;  5GSU D;  5B31 C;  3MGR B;  1P3I A;  3A6N C;  1M1A C;  4Z5T A;  5B31 B;  3AZM D;  1WWS A;  3P5J B;  5CPI D;  1B6W A;  3B0D C;  3A6N B;  1M1A B;  3AZF C;  5DNN C;  1P3F A;  1KX5 D;  3B0D B;  2ARO C;  5BNV A;  3AZK D;  3AZF B;  3B0C T;  3X1S C;  3AZL C;  3KUY C;  5DNN B;  3REH A;  3KXB A;  5B32 B;  1P3G C;  5AY8 D;  2ARO B;  4X23 A;  2NQB C;  3X1S B;  3AZL B;  3KUY B;  3AZG B;  4LD9 A;  1P3G B;  5B0Z D;  4H9N A;  3LEL D;  4H9O B;  1P3L A;  1P3O D;  3REK B;  2NQB B;  2F2A C;  5AVC C;  4HGA C;  1KX3 D;  3UT9 A;  2ZY5 A;  1F66 C;  5AVC B;  5B31 A;  4HGA B;  5AV9 D;  3REJ D;  2HIO D;  2RIQ A;  2CWE A;  1EQZ D;  1F66 B;  3A6N A;  5CP6 D;  1M1A A;  3F6T A;  3AZF A;  5DNN A;  4CAY B;  2ARO A;  3X1S A;  3AZL A;  3KUY A;  1P3G A;  4E45 A;  5AVB D;  2NQB A;  5B33 C;  5B1L D;  2F8N K;  3WAA D;  3LZ0 C;  3AZH B;  3B0C W;  3VH5 W;  5B33 B;  5AVC A;  3W96 C;  1P3I D;  3LZ0 B;  1F66 A;  1PZR A;  4Z5T D;  5JA4 B;  3B6G C;  3W96 B;  3NQU B;  5B2I C;  1N1J B;  2L5A A;  1P3F D;  5B2I B;  4CAY A;  2RVQ D;  3REH D;  3KXB D;  2YFW B;  3UTA C;  2JCH A;  1ZLA C;  4X23 D;  4LD9 D;  3AZM C;  3UTA B;  5JRG C;  1ZLA B;  1P3L D;  4J8X C;  5B33 A;  3AZM B;  5JRG B;  5B24 C;  3MGR D;  1P3B C;  4H9S C;  2HUE C;  3UT9 D;  4J8X B;  4WU9 C;  5B31 D;  5B24 B;  3W96 A;  3NQU A; 
#chains in the Genus database with same CATH homology
 2HUE B;  3A6N D;  4WU9 B;  1M1A D;  4E44 A;  2Y2I A;  1N1J A;  3X1T C;  2BYM A;  3B6G A;  3KFU G;  3AZF D;  3X1T B;  5DNN D;  2YFW A;  3NQJ A;  3LJA C;  5B31 G;  2ARO D;  1KX4 C;  4J8U C;  3X1S D;  3AZL D;  3KUY D;  3AV2 C;  1P3G D;  3LJA B;  3UTA A;  3AV1 C;  3KSY A;  1ZLA A;  1KX4 B;  4J8U B;  2NQB D;  3AV2 B;  3VH6 A;  3AV1 B;  5JRG A;  3REJ B;  2NZD C;  4J8X A;  5AVC D;  5B24 A;  4AWL C;  2DQN C;  4H9S A;  1P3B A;  2NZD B;  1F66 D;  2Y2L A;  4Z66 C;  4WU9 A;  1U35 C;  4AWL B;  2BG1 A;  5B40 C;  3W99 C;  4WNN B;  4Z66 B;  3X1T A;  1U35 B;  5B40 B;  3W99 B;  3AN2 C;  5GT0 C;  3LJA A;  1P3I C;  1KX4 A;  4KHA A;  3AN2 B;  3AV2 A;  2FFF B;  5GT0 B;  3AV1 A;  1P3I B;  3MGQ A;  3MGP C;  5B33 D;  3MGP B;  3LZ0 D;  5GT3 C;  2NZD A;  3W96 D;  5GT3 B;  5F99 C;  4WNN A;  5AV6 C;  4Z66 A;  4CSR A;  1U35 A;  3B6G D;  4WU8 A;  5B2I D;  5B40 A;  5DNM C;  1P3L C;  3W99 A;  5F99 B;  5AV6 B;  1A7W A;  4H9N B;  5DNM B;  1P3L B;  4NE6 A;  5E5A A;  3AN2 A;  3UTA D;  5AV8 C;  1Q9C A;  5GT0 A;  1ZLA D;  3H0R C;  3UT9 B;  1W2E A;  2ZY3 A;  2ZY2 A;  5AV8 B;  5JRG D;  3MGP A;  3AZE A;  4J8X D;  5B24 D;  4WJ3 C;  1B67 A;  1P3B D;  4NE3 A;  2Y2G A;  5GT3 A;  4WU9 D;  3VH5 T;  5F99 A;  5AV6 A;  3X1T D;  3O62 C;  5DNM A;  1HTA A;  1TAF B;  1P3A C;  5BNX B;  4YS3 C;  3O62 B;  3LJA D;  1KU5 A;  1KX4 D;  4J8U D;  4ZBJ C;  4QLC C;  1P3A B;  3AV2 D;  1Z2C B;  4YS3 B;  3AV1 D;  5AV8 A;  4ZBJ B;  4QLC B;  3REL C;  1P3K C;  3W98 C;  2NZD D;  3REL B;  3W98 B;  3H0M C;  4Z66 D;  4H9P B;  3EPL A;  4KGC C;  1U35 D;  4WU8 D;  5B40 D;  3W99 D;  3AL0 C;  4KGC B;  1TAF A;  5BNX A;  3O62 A;  3MVD C;  3A1I A;  5E5A D;  1P3A A;  3AN2 D;  4DRB A;  4YS3 A;  5GT0 D;  3MVD B;  3X1V C;  4QLC A;  5BO0 B;  2CV5 A;  3MGP D;  3X1V B;  3AZE D;  3REL A;  1P3K A;  2BYM B;  4XZQ A;  3B6G B;  3W98 A;  4NE5 A;  5GT3 D;  2Y2H A;  2Y2N A;  4UUZ B;  5CPJ C;  4H9P A;  2J8P A;  4J8W C;  3NQJ B;  4G92 C;  3AZI A;  5F99 D;  5AV6 D;  5CPJ B;  4KGC A;  5C3I C;  1H3O A;  4G92 B;  3B0B A;  5DNM D;  2JE5 A;  4J8V C;  4ZUX C;  1JFI B;  3V9R B;  3MVD A;  1P3M C;  4J8V B;  4ZUX B;  3UTB A;  5BO0 A;  5AV8 D;  1AOI C;  2LY8 A;  1P3M B;  3X1V A;  2VQR A;  2JSS A;  2YFV B;  1M19 C;  4UUZ A;  1ID3 A;  1M19 B;  5BT1 D;  5CPJ A;  4J8W A;  3WTP E;  3MGQ C;  4KHA B;  4JJN C;  3B6F C;  3O62 D;  1JFI A;  3MGQ B;  3V9R A;  3WKJ A;  3WTP C;  4J8V A;  4JJN B;  4ZUX A;  1P3A D;  4YS3 D;  3B6F B;  2F8N A;  1M18 C;  1P3M A;  3WTP B;  4QLC D;  3AZN C;  1M18 B;  1AOI A;  4WU8 C;  2YFV A;  2FJ7 C;  3REL D;  1P3K D;  4CSR B;  5B0Y C;  4XZQ D;  3AZN B;  3W98 D;  4WU8 B;  5B1M C;  1BH9 A;  1WWI A;  2FJ7 B;  1M19 A;  5E5A C;  5B0Y B;  4H9R B;  5B1M B;  2PYO C;  4KGC D;  5E5A B;  3EPK A;  5FUG B;  3VH6 T;  2PYO B;  4NFT A;  5GXQ C;  3AZE C;  4JJN A;  1BH8 B;  3B6F A;  5GXQ B;  3MVD D;  2XD1 A;  5G49 B;  3WTP A;  3AZE B;  5AV5 C;  5B2J C;  1M18 A;  4DRA A;  3X1V D;  5AV5 B;  5B2J B;  3AZN A;  2FJ7 A;  5B0Y A;  4H9R A;  4R8P A;  1ID3 D;  5B1M A;  5CPJ D;  3W97 C;  5FUG A;  4J8W D;  2PYO A;  1P34 C;  5KDM B;  5AV9 A;  1BH8 A;  3AYW C;  1P34 B;  4EO5 C;  5GXQ A;  3C1B C;  3WKJ D;  4J8V D;  5G49 A;  4ZUX D;  2Y2O A;  3AYW B;  2F8N D;  1P3M D;  5AV5 A;  5BT1 C;  3VH6 W;  3MGS C;  2W8S A;  5B2J A;  3VH5 A;  1AOI D;  2XD5 A;  2UWX A;  3MGS B;  3MNN C;  1M19 D;  2F8N G;  4H9Q B;  3MNN B;  3AZJ C;  3WA9 C;  5KDM A;  3AZJ B;  3W97 A;  3WA9 B;  3X1U C;  3MGQ D;  1P34 A;  2CV5 C;  1BFM A;  3H0L C;  4JJN D;  5BS7 C;  1T3U A;  4XZQ C;  3AYW A;  3X1U B;  3B6F D;  1S32 C;  3C1B A;  2CV5 B;  5B32 C;  3WTP D;  5CPK C;  1P3K B;  4XZQ B;  1M18 D;  3AZG C;  3AZI C;  1S32 B;  2Y2P A;  1ULY A;  3MGS A;  5CPK B;  3REK C;  3AZN D;  3C1C C;  3AZI B;  3AFA A;  3EPJ A;  2FJ7 D;  1R4V A;  4H9Q A;  3MNN A;  5B0Y D;  3TU4 C;  3C1C B;  1H3O B;  4R8P D;  5B1M D;  3MGR A;  3IP4 C;  3KWQ C;  3UTB C;  2ZM5 A;  3TU4 B;  3AZJ A;  1TZY C;  3LZ1 C;  2PYO D;  3WA9 A;  3KWQ B;  3UTB B;  1TZY B;  3LZ1 B;  3EPH A;  5GXQ D;  3X1U A;  1HQ3 C;  5BS7 A;  4WZS B;  1S32 A;  1HQ3 B;  3REI C;  1ID3 C;  5B32 A;  5AV5 D;  5B2J D;  5CPK A;  3AZG A;  1ID3 B;  4M6B A;  3R45 B;  3REI B;  4H9O A;  3AZH C;  3REK A;  3C1C A;  4J8W B;  3WKJ C;  5C3I B;  3TU4 A;  3WKJ B;  3KWQ A;  2BYK B;  3W97 D;  1TZY A;  3LZ1 A;  2F8N B;  1P34 D;  1P3P C;  4YM6 C;  2Y2K A;  2G5I C;  3AYW D;  4KUD C;  1AOI B;  1P3P B;  4YM6 B;  3C1B D;  1HQ3 A;  4KUD B;  4XUJ C;  3A1K A;  5CHL B;  5GSU C;  1BH9 B;  3REI A;  3R45 A;  3MGS D;  4XUJ B;  5GSU B;  3AFA D;  3MNN D;  3AZH A;  5CPI C;  4G91 C;  1KX5 C;  2Y2Q A;  3LZ0 A;  3AZJ D;  2BYK A;  5CPI B;  3AZK C;  5JA4 A;  3WA9 D;  4G91 B;  1KX5 B;  5AY8 C;  3AZK B;  3X1U D;  1P3P A;  4YM6 A;  2Y2M A;  2CV5 D;  5B0Z C;  5AY8 B;  5B2I A;  3LEL C;  1P3O C;  4R8P C;  4KUD A;  1S32 D;  5B0Z B;  5B32 D;  3LEL B;  1P3O B;  1KX3 C;  5CPK D;  2IO5 C;  4R8P B;  4XUJ A;  3AZG D;  3AZI D;  1P3B B;  5GSU A;  5AV9 C;  3REJ C;  2HIO C;  1KX3 B;  2IO5 B;  3REK D;  1EQZ C;  3C1C D;  5CP6 C;  3AZM A;  5AV9 B;  2HIO B;  1EQZ B;  3TU4 D;  5CPI A;  5B32 G;  5CP6 B;  1KX5 A;  3KWQ D;  3EG5 B;  3UTB D;  3FDD A;  1TZY D;  3LZ1 D;  3AZK A;  5AY8 A;  5AVB C;  2Y2J A;  4Z2M H;  1HQ3 D;  5B0Z A;  3LEL A;  5B1L C;  3WAA C;  5AVB B;  1P3O A;  3REI D;  4UPK A;  5B1L B;  3WAA B;  1KX3 A;  4J8U A;  4Z5T C;  3REJ A;  2F8N H;  2HIO A;  2G5H C;  3AZH D;  1EQZ A;  3W97 B;  4Z5T B;  5CP6 A;  1P3F C;  4WV4 B;  4DQY B;  2RVQ C;  4EO5 B;  4Z2M G;  3C1B B;  3KXB C;  3REH C;  1P3F B;  5BNV B;  2ZY4 A;  4X23 C;  3REH B;  1P3P D;  4YM6 D;  1F1E A;  3KXB B;  3AFA C;  4LD9 C;  4X23 B;  5AVB A;  4KUD D;  4LD9 B;  3AFA B;  2DF4 C;  3MGR C;  5B1L A;  3WAA A;  3UT9 C;  4XUJ D;  5GSU D;  5B31 C;  3MGR B;  1P3I A;  3A6N C;  1M1A C;  4Z5T A;  5B31 B;  3AZM D;  1WWS A;  3P5J B;  5CPI D;  1B6W A;  3B0D C;  3A6N B;  1M1A B;  3AZF C;  5DNN C;  1P3F A;  1KX5 D;  3B0D B;  2ARO C;  5BNV A;  3AZK D;  3AZF B;  3B0C T;  3X1S C;  3AZL C;  3KUY C;  5DNN B;  3REH A;  3KXB A;  5B32 B;  1P3G C;  5AY8 D;  2ARO B;  4X23 A;  2NQB C;  3X1S B;  3AZL B;  3KUY B;  3AZG B;  4LD9 A;  1P3G B;  5B0Z D;  4H9N A;  3LEL D;  4H9O B;  1P3L A;  1P3O D;  3REK B;  2NQB B;  2F2A C;  5AVC C;  4HGA C;  1KX3 D;  3UT9 A;  2ZY5 A;  1F66 C;  5AVC B;  5B31 A;  4HGA B;  5AV9 D;  3REJ D;  2HIO D;  2RIQ A;  2CWE A;  1EQZ D;  1F66 B;  3A6N A;  5CP6 D;  1M1A A;  3F6T A;  3AZF A;  5DNN A;  4CAY B;  2ARO A;  3X1S A;  3AZL A;  3KUY A;  1P3G A;  4E45 A;  5AVB D;  2NQB A;  5B33 C;  5B1L D;  2F8N K;  3WAA D;  3LZ0 C;  3AZH B;  3B0C W;  3VH5 W;  5B33 B;  5AVC A;  3W96 C;  1P3I D;  3LZ0 B;  1F66 A;  1PZR A;  4Z5T D;  5JA4 B;  3B6G C;  3W96 B;  3NQU B;  5B2I C;  1N1J B;  2L5A A;  1P3F D;  5B2I B;  4CAY A;  2RVQ D;  3REH D;  3KXB D;  2YFW B;  3UTA C;  2JCH A;  1ZLA C;  4X23 D;  4LD9 D;  3AZM C;  3UTA B;  5JRG C;  1ZLA B;  1P3L D;  4J8X C;  5B33 A;  3AZM B;  5JRG B;  5B24 C;  3MGR D;  1P3B C;  4H9S C;  2HUE C;  3UT9 D;  4J8X B;  4WU9 C;  5B31 D;  5B24 B;  3W96 A;  3NQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...