5B31A

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31A00
5GSUA 5DNMA 5GT3B 4H9PA 3UT9D 4NE3A 3AZEC 3AZGC 4WU8C 3MGRB 1P3PB 3KUYA 3REJD 4Z5TC 5C3IC 2BYMB 3AZKD 3AV1A 1F1EA 5AVBD 1S32B 3LELA 4AWLB 5AV9B 1P3GC 5B24C 1TZYA 5DNND 3C1CA 5AV8B 1P3IC 4NE5A 3O62C 1Q9CA 3B6GC 1U35D 3AZMC 3AZGD 3AZED 4WU8D 4LD9C 4J8UD 1B67A 1TAFA 1ZLAC 3C1BA 1KU5A 3KWQB 4X23A 5AV6C 4XUJC 5B1LC 4KHAB 5B24D 3AZJB 1P3GD 1H3OB 3AV2A 4DRAA 5F99B 1M18B 3REHC 3MGQB 2F8ND 3O62D 5CPKB 2F8NH 5B0YB 3B6GD 3UTBB 2AROB 5FUGA 5G49A 1P3BA 4R8PC 3X1SA 3VH6T 3AZMD 5BS7C 3WAAB 4LD9D 1BH8B 5DNMB 4H9PB 5JA4B 3VH5A 3KUYB 3AZLC 3W96B 3W99C 4CSRA 5AVCA 5B0ZB 2PYOC 1ULYA 5AV6D 4XUJD 5KDMA 4Z66A 3LELB 3LJAB 3TU4C 1JFIB 3LZ1A 4J8WC 1P3AA 1KX3D 3REHD 1TZYB 4WZSB 1P3MA 5GT0A 4YM6C 4R8PD 4H9SC 5B31G 5CPIB 5CHLB 4Z5TB 1BFMA 5C3IB 3AZLD 4KUDC 3W99D 2PYOD 1TAFB 2HIOC 5B31A 5B2JA 3C1BB 3TU4D 2IO5C 4JJNA 4X23B 4J8XC 4KGCC 3X1UD 1KX4C 1F66A 3WKJA 1P3IB 3X1VA 5CP6C 4J8VC 1P3LC 3X1TC 3V9RA 4YM6D 5FUGB 5G49B 3AZHC 1P3BB 5AY8A 2BYKB 1M1AA 1ZLAB 1P34C 1WWIA 2HIOD 4CSRB 5B1LB 4KGCD 4J8XD 3R45B 4Z66B 3B0BA 5KDMB 1KX4D 5B1MC 3LZ1B 1P3AB 5JRGC 1P3PA 3MGRA 4WV4B 5CP6D 4J8VD 3X1TD 2NQBC 4G91C 4XZQC 5GT0B 1P3MB 5B32C 4QLCB 3MVDC 3AYWA 1P34D 1ID3B 5B40C 4Z2MG 4J8WB 5E5AC 5B31B 1P3KC 5B1MD 1P3OC 3WKJB 5JRGD 1F66B 2NQBD 3B0DB 3LZ0B 5GXQC 4XZQD 5B32D 3KWQA 5AVBC 3REIA 4YS3B 5AY8B 4EO5B 5BNVA 5F99A 1M1AB 4KUDB 5B40D 5AV5C 3MGQA 2HIOB 2L5AA 3AZFB 3B0CW 2IO5B 2AROA 3AZNB 1KX5C 3W98D 3MGPB 3A6NC 4ZUXA 1P3OD 3WA9B 1BH8A 3REJA 5JA4A 1P3LB 5GXQD 3W96A 3AZKA 4J8UC 4H9OB 5B0ZA 3AN2C 3WTPD 3AZHB 1EQZC 2CV5C 3LJAA 1JFIA 3AYWB 5DNNA 3AV1C 5AV5D 2F8NK 1HQ3D 5CPJC 1U35A 1KX5D 3A6ND 4G92B 3AZGA 5CPIA 4WU8A 1M19B 3RELB 4Z5TA 3NQJB 5GSUD 3AN2D 4WU9B 1EQZD 2F8NG 3MVDB 2CV5D 1P3GA 5B24A 3REIB 3AV1D 1P3IA 5BNVB 1KX3C 3O62A 5CPJD 3B6GA 1P3KB 5E5AB 3C1CD 3AZMA 4ZUXB 2BYKA 3UT9B 4CAYB 3UTAC 2NZDC 3REJB 1ZLAA 3AZKB 5BT1C 4WNNB 3KXBC 2FJ7C 4XUJA 5B1LA 5AVBB 4E44A 3R45A 3MNNC 4H9NB 2YFVA 5AVCC 4NE6A 3VH6W 3X1UC 5DNNB 3VH5T 3AV2D 4R8PA 1U35B 1B6WA 4QLCA 5BS7A 3W97C 3AZGB 3AZEB 3UTAD 4WU8B 3AFAC 4UUZA 3MGSC 2NZDD 3AZLA 3X1SD 4J8UB 1ID3A 3W99A 2PYOA 3KSYA 5BT1D 2FJ7D 3KXBD 4HGAC 4J8WA 1P3GB 5B24B 3MNND 5AVCD 1R4VA 3B6FC 2F8NB 3O62B 5B2IC 3LZ0A 4YM6A 3B6GB 4NFTA 4H9SA 3W97D 3X1VC 3AZMB 2HUEC 4LD9B 4YS3A 3AFAD 3MGSD 4KUDA 3REKC 2HIOA 3AZFA 1P3FC 4KGCA 3AZNA 5AV6B 4XUJB 1KX4A 3MGPA 2LY8A 3WA9A 5B33C 1AOIC 1KX3B 3REHB 2YFVB 5CP6A 5B2JD 1P3LA 4ZBJC 3X1TA 3B6FD 1A7WA 5B2ID 3AZIC 2YFWA 4H9OA 5GT3C 4R8PB 3AZHA 3X1VD 1P3PC 3MGRC 1P34A 4UUZB 1S32C 3REKD 3AZLB 4AWLC 3W99B 1P3FD 2PYOB 5AV9C 5B32G 3TU4B 5B1MA 5B33D 4DRBA 5AV8C 3X1UB 5JRGA 1AOID 3W98C 1M19A 3RELA 3AZID 2NQBA 3NQJA 4XZQA 5BNXB 5GT3D 4YM6B 4WU9A 3MVDA 1P3PD 3MGRD 3WTPC 3AFAB 5B40A 1S32D 5AV9D 1HQ3C 3AZJC 1P3KA 5E5AA 3WTPE 5F99C 1P3OA 1M18C 4KGCB 5AV8D 4J8XB 1KX4B 3MGQC 5CPKC 1N1JA 5B0YC 3UT9A 4CAYA 3UTBC 2AROC 5CP6B 4J8VB 3X1TB 2YFWB 4WNNA 3WAAC 5AVBA 5GSUC 2HUEB 5DNMC 3KUYC 4Z2MH 3W96C 4H9NA 3KWQD 1P34B 3NQUB 3AZJD 3LELC 1KX5A 5F99D 3A6NA 1M18D 3MGQD 1TZYC 1BH9B 5B1MB 3C1CC 5CPKD 5B0YD 4ZBJB 5JRGB 3AZEA 3UTBD 2AROD 4J8UA 2NQBB 3AN2A 4G91B 4XZQB 1EQZA 3WAAD 5CPIC 5B32B 2CV5A 5DNMD 4H9QB 1HTAA 3KUYD 3W96D 5B0ZD 5B40B 5CPJA 3C1BC 3LELD 3LJAD 2F8NA 4X23C 3AV2C 1TZYD 3W98B 1P3OB 4LD9A 1N1JB 5BO0A 5GXQB 1P3BC 3X1SC 5CPID 3WTPB 5AV6A 4Z5TD 1KX3A 3REHA 3VH6A 5AV5B 3C1BD 1HQ3B 4X23D 4Z66C 3LZ1C 1P3AC 1KX5B 1P3ID 3A6NB 3UTAA 2RVQC 2NZDA 1P3MC 5GT0C 4QLCC 1P3BD 2FJ7A 3KXBA 5GSUB 3AN2B 1EQZB 2CV5B 3VH5W 3TU4A 3MNNA 1ZLAD 4H9RA 1ID3C 3X1UA 3AV1B 5B1LD 5B31C 4Z66D 5B2JC 5CPJB 3LZ1D 4JJNC 5BNXA 1P3AD 3W97A 1F66C 3WKJC 3C1CB 3AFAA 2RVQD 3MGSA 3B0DC 3LZ0C 1P3MD 5GT0D 4QLCD 5BO0B 1WWSA 4YS3C 5AY8C 4EO5C 2JSSA 1M1AC 1ID3D 4J8XA 3AZFC 3B6FA 4J8WD 5B2IA 5B31D 3AZNC 4J8VA 3MGPC 4JJND 3AV2B 3WA9C 3WKJD 1F66D 3LZ0D 3UTAB 2NZDB 3REKA 3X1SB 1P3FA 3NQUA 2FJ7B 3KXBB 4YS3D 5AY8D 1M1AD 3AYWC 4KUDD 5B33A 1AOIA 1BH9A 3MNNB 4H9RB 5AVCB 3AZFD 3AZIA 3AZND 3MGPD 3WA9D 5GT3A 4E45A 4G92C 5B32A 4H9QA 1M19C 1P3LD 3W97B 3RELC 2BYMA 3MGSB 1S32A 3AZHD 4WU9C 5AV9A 3KWQC 4HGAB 3AYWD 3REIC 5AV8A 3W98A 5B2JB 3B6FB 5B2IB 4JJNB 5GXQA 4ZUXC 1M19D 3WTPA 3UT9C 3RELD 3X1VB 3REJC 3B0CT 4M6BA 2CWEA 3V9RB 4WU9D 3AZKC 3MVDD 5AV5A 5B0ZC 3REKB 1HQ3A 4KHAA 3AZJA 1H3OA 1P3FB 3LJAC 3REID 1M18A 5DNNC 5CPKA 5B33B 5B0YA 1AOIB 3UTBA 1P3KD 5E5AD 3AZIB 1U35C 3WAAA 4ZUXD
chains in the Genus database with same CATH superfamily
2Y2OA 5GSUA 5GT3B 4H9PA 5DNMA 3UT9D 4NE3A 3AZEC 3AZGC 4WU8C 3MGRB 1P3PB 3KUYA 3REJD 4Z5TC 5C3IC 2BYMB 3AZKD 3AV1A 1F1EA 5AVBD 1S32B 3LELA 4AWLB 4UPKA 5AV9B 1P3GC 5B24C 2ZY5A 1TZYA 5DNND 3C1CA 5AV8B 1P3IC 4NE5A 3O62C 1Q9CA 3B6GC 1U35D 3AZMC 3AZGD 3AZED 4WU8D 4LD9C 4J8UD 2XD1A 1B67A 1TAFA 1ZLAC 3C1BA 1KU5A 3KWQB 4X23A 5AV6C 4XUJC 5B1LC 4KHAB 5B24D 3AZJB 1P3GD 1H3OB 3AV2A 4DRAA 5F99B 1M18B 3REHC 2G5IC 3MGQB 2F8ND 3O62D 5CPKB 2F8NH 5B0YB 3B6GD 4DQYB 3UTBB 2J8PA 2AROB 5FUGA 5G49A 1P3BA 4R8PC 3X1SA 3VH6T 3AZMD 5BS7C 3WAAB 4LD9D 1BH8B 5DNMB 4H9PB 5JA4B 3VH5A 3KUYB 3AZLC 3W96B 3W99C 4CSRA 5AVCA 5B0ZB 2PYOC 1ULYA 5AV6D 4XUJD 5KDMA 4Z66A 3LELB 3LJAB 3TU4C 1JFIB 3LZ1A 4J8WC 1P3AA 1KX3D 3REHD 1TZYB 4WZSB 1P3MA 5GT0A 4YM6C 4R8PD 1Z2CB 4H9SC 5B31G 5CPIB 5CHLB 4Z5TB 1BFMA 5C3IB 3AZLD 4KUDC 3W99D 2PYOD 1TAFB 2HIOC 5B31A 5B2JA 3C1BB 3TU4D 2IO5C 3F6TA 3P5JB 4X23B 4J8XC 3X1UD 4JJNA 1KX4C 1F66A 3WKJA 1P3IB 3X1VA 5CP6C 4J8VC 1P3LC 3X1TC 3V9RA 4YM6D 5FUGB 5G49B 3AZHC 1P3BB 5AY8A 2BYKB 1M1AA 1ZLAB 1P34C 1WWIA 2HIOD 4CSRB 5B1LB 4KGCD 4J8XD 3R45B 4Z66B 3B0BA 5KDMB 1KX4D 5B1MC 3LZ1B 1P3AB 5JRGC 1P3PA 3MGRA 4WV4B 5CP6D 4J8VD 3X1TD 2NQBC 4G91C 4XZQC 5GT0B 1P3MB 5B32C 1PZRA 4QLCB 3EPHA 3MVDC 3AYWA 2Y2PA 1P34D 1ID3B 5B40C 4Z2MG 4J8WB 5E5AC 5B31B 1P3KC 5B1MD 1P3OC 3WKJB 5JRGD 1F66B 2NQBD 3B0DB 3LZ0B 5GXQC 4XZQD 5B32D 3KWQA 5AVBC 3REIA 4YS3B 5AY8B 4EO5B 5BNVA 5F99A 1M1AB 4KUDB 2W8SA 5B40D 5AV5C 3MGQA 2HIOB 2L5AA 3AZFB 3B0CW 2IO5B 2AROA 3EPKA 3AZNB 1KX5C 3W98D 3MGPB 3A6NC 4ZUXA 1P3OD 3WA9B 1BH8A 3REJA 5JA4A 1P3LB 5GXQD 3W96A 3AZKA 4J8UC 4H9OB 5B0ZA 3AN2C 3WTPD 3AZHB 1EQZC 4KGCC 2CV5C 3H0LC 3LJAA 1JFIA 3AYWB 5DNNA 3AV1C 5AV5D 2F8NK 1HQ3D 5CPJC 1U35A 1KX5D 3EPLA 3A6ND 4G92B 3AZGA 5CPIA 2VQRA 4WU8A 1M19B 3RELB 4Z5TA 3NQJB 5GSUD 3AN2D 4WU9B 1EQZD 2F8NG 3MVDB 2CV5D 1P3GA 5B24A 3REIB 3AV1D 1P3IA 5BNVB 1KX3C 3O62A 5CPJD 3B6GA 1P3KB 5E5AB 3C1CD 3AZMA 4ZUXB 2BYKA 3UT9B 4CAYB 3UTAC 2NZDC 3REJB 1ZLAA 3AZKB 4WJ3C 5BT1C 4WNNB 3KXBC 2FJ7C 5AVBB 4XUJA 3H0MC 5B1LA 4E44A 3R45A 3MNNC 4H9NB 2YFVA 2Y2KA 4NE6A 5AVCC 2ZY3A 3VH6W 3X1UC 5DNNB 3VH5T 3AV2D 4R8PA 1U35B 1B6WA 2ZY4A 4QLCA 5BS7A 3W97C 3AZGB 3AZEB 3UTAD 4WU8B 3AFAC 4UUZA 3MGSC 2NZDD 3AZLA 3X1SD 4J8UB 1ID3A 3W99A 2PYOA 2DQNC 3KSYA 5BT1D 2FJ7D 3KXBD 4HGAC 4J8WA 1P3GB 5B24B 3MNND 5AVCD 2F2AC 1R4VA 3B6FC 2F8NB 3O62B 5B2IC 3LZ0A 4YM6A 3B6GB 4NFTA 4H9SA 3W97D 3X1VC 3AZMB 2HUEC 4LD9B 4YS3A 3AFAD 3MGSD 4KUDA 3REKC 2HIOA 3AZFA 1P3FC 4KGCA 3A1KA 3AZNA 5AV6B 4XUJB 1KX4A 3MGPA 2LY8A 3WA9A 5B33C 1AOIC 1KX3B 3REHB 2YFVB 5CP6A 5B2JD 1P3LA 4ZBJC 3X1TA 3B6FD 1A7WA 5B2ID 3AZIC 2YFWA 4H9OA 5GT3C 4R8PB 3AZHA 3X1VD 1P3PC 3MGRC 2Y2HA 1P34A 2Y2NA 4UUZB 1S32C 3REKD 2FFFB 4AWLC 3AZLB 3W99B 1P3FD 2PYOB 5AV9C 5B32G 2Y2JA 3TU4B 2XD5A 5B1MA 5B33D 4DRBA 5AV8C 3X1UB 5JRGA 1AOID 3W98C 1M19A 2BG1A 3RELA 3AZID 2NQBA 3NQJA 4XZQA 5BNXB 5GT3D 4YM6B 4WU9A 2UWXA 3MVDA 1P3PD 3MGRD 3WTPC 3AFAB 5B40A 1S32D 5AV9D 1HQ3C 3AZJC 1P3KA 5E5AA 3WTPE 5F99C 1P3OA 1M18C 4KGCB 5AV8D 4J8XB 1KX4B 3MGQC 5CPKC 1N1JA 5B0YC 3UT9A 4CAYA 3UTBC 2AROC 5CP6B 4J8VB 3X1TB 2YFWB 4WNNA 3WAAC 5AVBA 5GSUC 2HUEB 5DNMC 2Y2LA 3KUYC 4Z2MH 3W96C 4H9NA 3KWQD 1P34B 3NQUB 3AZJD 3LELC 1KX5A 5F99D 3A6NA 1M18D 3MGQD 1TZYC 1BH9B 5B1MB 3C1CC 5CPKD 5B0YD 4ZBJB 5JRGB 3AZEA 3UTBD 2AROD 4J8UA 2NQBB 3AN2A 4G91B 4XZQB 1EQZA 3WAAD 5CPIC 5B32B 2CV5A 5DNMD 4H9QB 1HTAA 1W2EA 3KUYD 3W96D 5B0ZD 5B40B 5CPJA 3C1BC 3LELD 2JCHA 3LJAD 2F8NA 4X23C 3AV2C 1TZYD 3W98B 1P3OB 2Y2GA 4LD9A 1N1JB 2ZY2A 5BO0A 5GXQB 1P3BC 3X1SC 5CPID 3WTPB 5AV6A 4Z5TD 1KX3A 3REHA 3VH6A 5AV5B 3C1BD 1HQ3B 4X23D 4Z66C 3LZ1C 1P3AC 1KX5B 1P3ID 3A6NB 3UTAA 2DF4C 2RVQC 2NZDA 1P3MC 5GT0C 3A1IA 4QLCC 1P3BD 3IP4C 2FJ7A 3KXBA 5GSUB 3AN2B 1EQZB 2CV5B 3VH5W 3KFUG 2RIQA 3TU4A 3MNNA 1ZLAD 4H9RA 1ID3C 3X1UA 3AV1B 5B1LD 5B31C 4Z66D 5B2JC 5CPJB 3LZ1D 4JJNC 5BNXA 1P3AD 3W97A 1F66C 3WKJC 2Y2IA 3C1CB 3AFAA 2RVQD 3MGSA 3B0DC 3LZ0C 1P3MD 5GT0D 4QLCD 3H0RC 5BO0B 1WWSA 4YS3C 5AY8C 4EO5C 2JSSA 1M1AC 1ID3D 4J8XA 3AZFC 3B6FA 4J8WD 5B2IA 5B31D 3AZNC 4J8VA 3MGPC 4JJND 3AV2B 3WA9C 3WKJD 1F66D 2Y2MA 3LZ0D 3UTAB 2NZDB 3REKA 3X1SB 1P3FA 3NQUA 2ZM5A 1T3UA 3FDDA 2FJ7B 3KXBB 4YS3D 5AY8D 3EG5B 1M1AD 3AYWC 4KUDD 5B33A 1AOIA 1BH9A 3MNNB 4H9RB 5AVCB 3AZFD 3AZIA 3AZND 3MGPD 3WA9D 5GT3A 4E45A 4G92C 5B32A 4H9QA 1M19C 1P3LD 3W97B 3RELC 2BYMA 3MGSB 2Y2QA 1S32A 3AZHD 4WU9C 5AV9A 3KWQC 4HGAB 2JE5A 3AYWD 3REIC 5AV8A 3W98A 5B2JB 2G5HC 3B6FB 5B2IB 4JJNB 5GXQA 3AL0C 4ZUXC 1M19D 3WTPA 3UT9C 3RELD 3X1VB 3REJC 3B0CT 4M6BA 2CWEA 3V9RB 4WU9D 3AZKC 3MVDD 5AV5A 5B0ZC 3REKB 1HQ3A 4KHAA 3AZJA 1H3OA 1P3FB 3EPJA 3LJAC 3REID 1M18A 5DNNC 5CPKA 5B33B 5B0YA 1AOIB 3UTBA 1P3KD 5E5AD 3AZIB 1U35C 3WAAA 4ZUXD
chains in the Genus database with same CATH topology
2Y2OA 5GSUA 5GT3B 4H9PA 5DNMA 3UT9D 4NE3A 3AZEC 3AZGC 4WU8C 3MGRB 1P3PB 3KUYA 3REJD 4Z5TC 5C3IC 2BYMB 3AZKD 3AV1A 1F1EA 5AVBD 1S32B 3LELA 4AWLB 4UPKA 5AV9B 1P3GC 5B24C 2ZY5A 1TZYA 5DNND 3C1CA 5AV8B 1P3IC 4NE5A 3O62C 1Q9CA 3B6GC 1U35D 3AZMC 3AZGD 3AZED 4WU8D 4LD9C 4J8UD 2XD1A 1B67A 1TAFA 1ZLAC 3C1BA 1KU5A 3KWQB 4X23A 5AV6C 4XUJC 5B1LC 4KHAB 5B24D 3AZJB 1P3GD 1H3OB 3AV2A 4DRAA 5F99B 1M18B 3REHC 2G5IC 3MGQB 2F8ND 3O62D 5CPKB 2F8NH 5B0YB 3B6GD 4DQYB 3UTBB 2J8PA 2AROB 5FUGA 5G49A 1P3BA 4R8PC 3X1SA 3VH6T 3AZMD 5BS7C 3WAAB 4LD9D 1BH8B 5DNMB 4H9PB 5JA4B 3VH5A 3KUYB 3AZLC 3W96B 3W99C 4CSRA 5AVCA 5B0ZB 2PYOC 1ULYA 5AV6D 4XUJD 5KDMA 4Z66A 3LELB 3LJAB 3TU4C 1JFIB 3LZ1A 4J8WC 1P3AA 1KX3D 3REHD 1TZYB 4WZSB 1P3MA 5GT0A 4YM6C 4R8PD 1Z2CB 4H9SC 5B31G 5CPIB 5CHLB 4Z5TB 1BFMA 5C3IB 3AZLD 4KUDC 3W99D 2PYOD 1TAFB 2HIOC 5B31A 5B2JA 3C1BB 3TU4D 2IO5C 3F6TA 3P5JB 4X23B 4J8XC 3X1UD 4JJNA 1KX4C 1F66A 3WKJA 1P3IB 3X1VA 5CP6C 4J8VC 1P3LC 3X1TC 3V9RA 4YM6D 5FUGB 5G49B 3AZHC 1P3BB 5AY8A 2BYKB 1M1AA 1ZLAB 1P34C 1WWIA 2HIOD 4CSRB 5B1LB 4KGCD 4J8XD 3R45B 4Z66B 3B0BA 5KDMB 1KX4D 5B1MC 3LZ1B 1P3AB 5JRGC 1P3PA 3MGRA 4WV4B 5CP6D 4J8VD 3X1TD 2NQBC 4G91C 4XZQC 5GT0B 1P3MB 5B32C 1PZRA 4QLCB 3EPHA 3MVDC 3AYWA 2Y2PA 1P34D 1ID3B 5B40C 4Z2MG 4J8WB 5E5AC 5B31B 1P3KC 5B1MD 1P3OC 3WKJB 5JRGD 1F66B 2NQBD 3B0DB 3LZ0B 5GXQC 4XZQD 5B32D 3KWQA 5AVBC 3REIA 4YS3B 5AY8B 4EO5B 5BNVA 5F99A 1M1AB 4KUDB 2W8SA 5B40D 5AV5C 3MGQA 2HIOB 2L5AA 3AZFB 3B0CW 2IO5B 2AROA 3EPKA 3AZNB 1KX5C 3W98D 3MGPB 3A6NC 4ZUXA 1P3OD 3WA9B 1BH8A 3REJA 5JA4A 1P3LB 5GXQD 3W96A 3AZKA 4J8UC 4H9OB 5B0ZA 3AN2C 3WTPD 3AZHB 1EQZC 4KGCC 2CV5C 3H0LC 3LJAA 1JFIA 3AYWB 5DNNA 3AV1C 5AV5D 2F8NK 1HQ3D 5CPJC 1U35A 1KX5D 3EPLA 3A6ND 4G92B 3AZGA 5CPIA 2VQRA 4WU8A 1M19B 3RELB 4Z5TA 3NQJB 5GSUD 3AN2D 4WU9B 1EQZD 2F8NG 3MVDB 2CV5D 1P3GA 5B24A 3REIB 3AV1D 1P3IA 5BNVB 1KX3C 3O62A 5CPJD 3B6GA 1P3KB 5E5AB 3C1CD 3AZMA 4ZUXB 2BYKA 3UT9B 4CAYB 3UTAC 2NZDC 3REJB 1ZLAA 3AZKB 4WJ3C 5BT1C 4WNNB 3KXBC 2FJ7C 5AVBB 4XUJA 3H0MC 5B1LA 4E44A 3R45A 3MNNC 4H9NB 2YFVA 2Y2KA 4NE6A 5AVCC 2ZY3A 3VH6W 3X1UC 5DNNB 3VH5T 3AV2D 4R8PA 1U35B 1B6WA 2ZY4A 4QLCA 5BS7A 3W97C 3AZGB 3AZEB 3UTAD 4WU8B 3AFAC 4UUZA 3MGSC 2NZDD 3AZLA 3X1SD 4J8UB 1ID3A 3W99A 2PYOA 2DQNC 3KSYA 5BT1D 2FJ7D 3KXBD 4HGAC 4J8WA 1P3GB 5B24B 3MNND 5AVCD 2F2AC 1R4VA 3B6FC 2F8NB 3O62B 5B2IC 3LZ0A 4YM6A 3B6GB 4NFTA 4H9SA 3W97D 3X1VC 3AZMB 2HUEC 4LD9B 4YS3A 3AFAD 3MGSD 4KUDA 3REKC 2HIOA 3AZFA 1P3FC 4KGCA 3A1KA 3AZNA 5AV6B 4XUJB 1KX4A 3MGPA 2LY8A 3WA9A 5B33C 1AOIC 1KX3B 3REHB 2YFVB 5CP6A 5B2JD 1P3LA 4ZBJC 3X1TA 3B6FD 1A7WA 5B2ID 3AZIC 2YFWA 4H9OA 5GT3C 4R8PB 3AZHA 3X1VD 1P3PC 3MGRC 2Y2HA 1P34A 2Y2NA 4UUZB 1S32C 3REKD 2FFFB 4AWLC 3AZLB 3W99B 1P3FD 2PYOB 5AV9C 5B32G 2Y2JA 3TU4B 2XD5A 5B1MA 5B33D 4DRBA 5AV8C 3X1UB 5JRGA 1AOID 3W98C 1M19A 2BG1A 3RELA 3AZID 2NQBA 3NQJA 4XZQA 5BNXB 5GT3D 4YM6B 4WU9A 2UWXA 3MVDA 1P3PD 3MGRD 3WTPC 3AFAB 5B40A 1S32D 5AV9D 1HQ3C 3AZJC 1P3KA 5E5AA 3WTPE 5F99C 1P3OA 1M18C 4KGCB 5AV8D 4J8XB 1KX4B 3MGQC 5CPKC 1N1JA 5B0YC 3UT9A 4CAYA 3UTBC 2AROC 5CP6B 4J8VB 3X1TB 2YFWB 4WNNA 3WAAC 5AVBA 5GSUC 2HUEB 5DNMC 2Y2LA 3KUYC 4Z2MH 3W96C 4H9NA 3KWQD 1P34B 3NQUB 3AZJD 3LELC 1KX5A 5F99D 3A6NA 1M18D 3MGQD 1TZYC 1BH9B 5B1MB 3C1CC 5CPKD 5B0YD 4ZBJB 5JRGB 3AZEA 3UTBD 2AROD 4J8UA 2NQBB 3AN2A 4G91B 4XZQB 1EQZA 3WAAD 5CPIC 5B32B 2CV5A 5DNMD 4H9QB 1HTAA 1W2EA 3KUYD 3W96D 5B0ZD 5B40B 5CPJA 3C1BC 3LELD 2JCHA 3LJAD 2F8NA 4X23C 3AV2C 1TZYD 3W98B 1P3OB 2Y2GA 4LD9A 1N1JB 2ZY2A 5BO0A 5GXQB 1P3BC 3X1SC 5CPID 3WTPB 5AV6A 4Z5TD 1KX3A 3REHA 3VH6A 5AV5B 3C1BD 1HQ3B 4X23D 4Z66C 3LZ1C 1P3AC 1KX5B 1P3ID 3A6NB 3UTAA 2DF4C 2RVQC 2NZDA 1P3MC 5GT0C 3A1IA 4QLCC 1P3BD 3IP4C 2FJ7A 3KXBA 5GSUB 3AN2B 1EQZB 2CV5B 3VH5W 3KFUG 2RIQA 3TU4A 3MNNA 1ZLAD 4H9RA 1ID3C 3X1UA 3AV1B 5B1LD 5B31C 4Z66D 5B2JC 5CPJB 3LZ1D 4JJNC 5BNXA 1P3AD 3W97A 1F66C 3WKJC 2Y2IA 3C1CB 3AFAA 2RVQD 3MGSA 3B0DC 3LZ0C 1P3MD 5GT0D 4QLCD 3H0RC 5BO0B 1WWSA 4YS3C 5AY8C 4EO5C 2JSSA 1M1AC 1ID3D 4J8XA 3AZFC 3B6FA 4J8WD 5B2IA 5B31D 3AZNC 4J8VA 3MGPC 4JJND 3AV2B 3WA9C 3WKJD 1F66D 2Y2MA 3LZ0D 3UTAB 2NZDB 3REKA 3X1SB 1P3FA 3NQUA 2ZM5A 1T3UA 3FDDA 2FJ7B 3KXBB 4YS3D 5AY8D 3EG5B 1M1AD 3AYWC 4KUDD 5B33A 1AOIA 1BH9A 3MNNB 4H9RB 5AVCB 3AZFD 3AZIA 3AZND 3MGPD 3WA9D 5GT3A 4E45A 4G92C 5B32A 4H9QA 1M19C 1P3LD 3W97B 3RELC 2BYMA 3MGSB 2Y2QA 1S32A 3AZHD 4WU9C 5AV9A 3KWQC 4HGAB 2JE5A 3AYWD 3REIC 5AV8A 3W98A 5B2JB 2G5HC 3B6FB 5B2IB 4JJNB 5GXQA 3AL0C 4ZUXC 1M19D 3WTPA 3UT9C 3RELD 3X1VB 3REJC 3B0CT 4M6BA 2CWEA 3V9RB 4WU9D 3AZKC 3MVDD 5AV5A 5B0ZC 3REKB 1HQ3A 4KHAA 3AZJA 1H3OA 1P3FB 3EPJA 3LJAC 3REID 1M18A 5DNNC 5CPKA 5B33B 5B0YA 1AOIB 3UTBA 1P3KD 5E5AD 3AZIB 1U35C 3WAAA 4ZUXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU A;  5DNM A;  5GT3 B;  4H9P A;  3UT9 D;  4NE3 A;  3AZE C;  3AZG C;  4WU8 C;  3MGR B;  1P3P B;  3KUY A;  3REJ D;  4Z5T C;  5C3I C;  2BYM B;  3AZK D;  3AV1 A;  1F1E A;  5AVB D;  1S32 B;  3LEL A;  4AWL B;  5AV9 B;  1P3G C;  5B24 C;  1TZY A;  5DNN D;  3C1C A;  5AV8 B;  1P3I C;  4NE5 A;  3O62 C;  1Q9C A;  3B6G C;  1U35 D;  3AZM C;  3AZG D;  3AZE D;  4WU8 D;  4LD9 C;  4J8U D;  1B67 A;  1TAF A;  1ZLA C;  3C1B A;  1KU5 A;  3KWQ B;  4X23 A;  5AV6 C;  4XUJ C;  5B1L C;  4KHA B;  5B24 D;  3AZJ B;  1P3G D;  1H3O B;  3AV2 A;  4DRA A;  5F99 B;  1M18 B;  3REH C;  3MGQ B;  2F8N D;  3O62 D;  5CPK B;  2F8N H;  5B0Y B;  3B6G D;  3UTB B;  2ARO B;  5FUG A;  5G49 A;  1P3B A;  4R8P C;  3X1S A;  3VH6 T;  3AZM D;  5BS7 C;  3WAA B;  4LD9 D;  1BH8 B;  5DNM B;  4H9P B;  5JA4 B;  3VH5 A;  3KUY B;  3AZL C;  3W96 B;  3W99 C;  4CSR A;  5AVC A;  5B0Z B;  2PYO C;  1ULY A;  5AV6 D;  4XUJ D;  5KDM A;  4Z66 A;  3LEL B;  3LJA B;  3TU4 C;  1JFI B;  3LZ1 A;  4J8W C;  1P3A A;  1KX3 D;  3REH D;  1TZY B;  4WZS B;  1P3M A;  5GT0 A;  4YM6 C;  4R8P D;  4H9S C;  5B31 G;  5CPI B;  5CHL B;  4Z5T B;  1BFM A;  5C3I B;  3AZL D;  4KUD C;  3W99 D;  2PYO D;  1TAF B;  2HIO C;  5B31 A;  5B2J A;  3C1B B;  3TU4 D;  2IO5 C;  4JJN A;  4X23 B;  4J8X C;  4KGC C;  3X1U D;  1KX4 C;  1F66 A;  3WKJ A;  1P3I B;  3X1V A;  5CP6 C;  4J8V C;  1P3L C;  3X1T C;  3V9R A;  4YM6 D;  5FUG B;  5G49 B;  3AZH C;  1P3B B;  5AY8 A;  2BYK B;  1M1A A;  1ZLA B;  1P34 C;  1WWI A;  2HIO D;  4CSR B;  5B1L B;  4KGC D;  4J8X D;  3R45 B;  4Z66 B;  3B0B A;  5KDM B;  1KX4 D;  5B1M C;  3LZ1 B;  1P3A B;  5JRG C;  1P3P A;  3MGR A;  4WV4 B;  5CP6 D;  4J8V D;  3X1T D;  2NQB C;  4G91 C;  4XZQ C;  5GT0 B;  1P3M B;  5B32 C;  4QLC B;  3MVD C;  3AYW A;  1P34 D;  1ID3 B;  5B40 C;  4Z2M G;  4J8W B;  5E5A C;  5B31 B;  1P3K C;  5B1M D;  1P3O C;  3WKJ B;  5JRG D;  1F66 B;  2NQB D;  3B0D B;  3LZ0 B;  5GXQ C;  4XZQ D;  5B32 D;  3KWQ A;  5AVB C;  3REI A;  4YS3 B;  5AY8 B;  4EO5 B;  5BNV A;  5F99 A;  1M1A B;  4KUD B;  5B40 D;  5AV5 C;  3MGQ A;  2HIO B;  2L5A A;  3AZF B;  3B0C W;  2IO5 B;  2ARO A;  3AZN B;  1KX5 C;  3W98 D;  3MGP B;  3A6N C;  4ZUX A;  1P3O D;  3WA9 B;  1BH8 A;  3REJ A;  5JA4 A;  1P3L B;  5GXQ D;  3W96 A;  3AZK A;  4J8U C;  4H9O B;  5B0Z A;  3AN2 C;  3WTP D;  3AZH B;  1EQZ C;  2CV5 C;  3LJA A;  1JFI A;  3AYW B;  5DNN A;  3AV1 C;  5AV5 D;  2F8N K;  1HQ3 D;  5CPJ C;  1U35 A;  1KX5 D;  3A6N D;  4G92 B;  3AZG A;  5CPI A;  4WU8 A;  1M19 B;  3REL B;  4Z5T A;  3NQJ B;  5GSU D;  3AN2 D;  4WU9 B;  1EQZ D;  2F8N G;  3MVD B;  2CV5 D;  1P3G A;  5B24 A;  3REI B;  3AV1 D;  1P3I A;  5BNV B;  1KX3 C;  3O62 A;  5CPJ D;  3B6G A;  1P3K B;  5E5A B;  3C1C D;  3AZM A;  4ZUX B;  2BYK A;  3UT9 B;  4CAY B;  3UTA C;  2NZD C;  3REJ B;  1ZLA A;  3AZK B;  5BT1 C;  4WNN B;  3KXB C;  2FJ7 C;  4XUJ A;  5B1L A;  5AVB B;  4E44 A;  3R45 A;  3MNN C;  4H9N B;  2YFV A;  5AVC C;  4NE6 A;  3VH6 W;  3X1U C;  5DNN B;  3VH5 T;  3AV2 D;  4R8P A;  1U35 B;  1B6W A;  4QLC A;  5BS7 A;  3W97 C;  3AZG B;  3AZE B;  3UTA D;  4WU8 B;  3AFA C;  4UUZ A;  3MGS C;  2NZD D;  3AZL A;  3X1S D;  4J8U B;  1ID3 A;  3W99 A;  2PYO A;  3KSY A;  5BT1 D;  2FJ7 D;  3KXB D;  4HGA C;  4J8W A;  1P3G B;  5B24 B;  3MNN D;  5AVC D;  1R4V A;  3B6F C;  2F8N B;  3O62 B;  5B2I C;  3LZ0 A;  4YM6 A;  3B6G B;  4NFT A;  4H9S A;  3W97 D;  3X1V C;  3AZM B;  2HUE C;  4LD9 B;  4YS3 A;  3AFA D;  3MGS D;  4KUD A;  3REK C;  2HIO A;  3AZF A;  1P3F C;  4KGC A;  3AZN A;  5AV6 B;  4XUJ B;  1KX4 A;  3MGP A;  2LY8 A;  3WA9 A;  5B33 C;  1AOI C;  1KX3 B;  3REH B;  2YFV B;  5CP6 A;  5B2J D;  1P3L A;  4ZBJ C;  3X1T A;  3B6F D;  1A7W A;  5B2I D;  3AZI C;  2YFW A;  4H9O A;  5GT3 C;  4R8P B;  3AZH A;  3X1V D;  1P3P C;  3MGR C;  1P34 A;  4UUZ B;  1S32 C;  3REK D;  3AZL B;  4AWL C;  3W99 B;  1P3F D;  2PYO B;  5AV9 C;  5B32 G;  3TU4 B;  5B1M A;  5B33 D;  4DRB A;  5AV8 C;  3X1U B;  5JRG A;  1AOI D;  3W98 C;  1M19 A;  3REL A;  3AZI D;  2NQB A;  3NQJ A;  4XZQ A;  5BNX B;  5GT3 D;  4YM6 B;  4WU9 A;  3MVD A;  1P3P D;  3MGR D;  3WTP C;  3AFA B;  5B40 A;  1S32 D;  5AV9 D;  1HQ3 C;  3AZJ C;  1P3K A;  5E5A A;  3WTP E;  5F99 C;  1P3O A;  1M18 C;  4KGC B;  5AV8 D;  4J8X B;  1KX4 B;  3MGQ C;  5CPK C;  1N1J A;  5B0Y C;  3UT9 A;  4CAY A;  3UTB C;  2ARO C;  5CP6 B;  4J8V B;  3X1T B;  2YFW B;  4WNN A;  3WAA C;  5AVB A;  5GSU C;  2HUE B;  5DNM C;  3KUY C;  4Z2M H;  3W96 C;  4H9N A;  3KWQ D;  1P34 B;  3NQU B;  3AZJ D;  3LEL C;  1KX5 A;  5F99 D;  3A6N A;  1M18 D;  3MGQ D;  1TZY C;  1BH9 B;  5B1M B;  3C1C C;  5CPK D;  5B0Y D;  4ZBJ B;  5JRG B;  3AZE A;  3UTB D;  2ARO D;  4J8U A;  2NQB B;  3AN2 A;  4G91 B;  4XZQ B;  1EQZ A;  3WAA D;  5CPI C;  5B32 B;  2CV5 A;  5DNM D;  4H9Q B;  1HTA A;  3KUY D;  3W96 D;  5B0Z D;  5B40 B;  5CPJ A;  3C1B C;  3LEL D;  3LJA D;  2F8N A;  4X23 C;  3AV2 C;  1TZY D;  3W98 B;  1P3O B;  4LD9 A;  1N1J B;  5BO0 A;  5GXQ B;  1P3B C;  3X1S C;  5CPI D;  3WTP B;  5AV6 A;  4Z5T D;  1KX3 A;  3REH A;  3VH6 A;  5AV5 B;  3C1B D;  1HQ3 B;  4X23 D;  4Z66 C;  3LZ1 C;  1P3A C;  1KX5 B;  1P3I D;  3A6N B;  3UTA A;  2RVQ C;  2NZD A;  1P3M C;  5GT0 C;  4QLC C;  1P3B D;  2FJ7 A;  3KXB A;  5GSU B;  3AN2 B;  1EQZ B;  2CV5 B;  3VH5 W;  3TU4 A;  3MNN A;  1ZLA D;  4H9R A;  1ID3 C;  3X1U A;  3AV1 B;  5B1L D;  5B31 C;  4Z66 D;  5B2J C;  5CPJ B;  3LZ1 D;  4JJN C;  5BNX A;  1P3A D;  3W97 A;  1F66 C;  3WKJ C;  3C1C B;  3AFA A;  2RVQ D;  3MGS A;  3B0D C;  3LZ0 C;  1P3M D;  5GT0 D;  4QLC D;  5BO0 B;  1WWS A;  4YS3 C;  5AY8 C;  4EO5 C;  2JSS A;  1M1A C;  1ID3 D;  4J8X A;  3AZF C;  3B6F A;  4J8W D;  5B2I A;  5B31 D;  3AZN C;  4J8V A;  3MGP C;  4JJN D;  3AV2 B;  3WA9 C;  3WKJ D;  1F66 D;  3LZ0 D;  3UTA B;  2NZD B;  3REK A;  3X1S B;  1P3F A;  3NQU A;  2FJ7 B;  3KXB B;  4YS3 D;  5AY8 D;  1M1A D;  3AYW C;  4KUD D;  5B33 A;  1AOI A;  1BH9 A;  3MNN B;  4H9R B;  5AVC B;  3AZF D;  3AZI A;  3AZN D;  3MGP D;  3WA9 D;  5GT3 A;  4E45 A;  4G92 C;  5B32 A;  4H9Q A;  1M19 C;  1P3L D;  3W97 B;  3REL C;  2BYM A;  3MGS B;  1S32 A;  3AZH D;  4WU9 C;  5AV9 A;  3KWQ C;  4HGA B;  3AYW D;  3REI C;  5AV8 A;  3W98 A;  5B2J B;  3B6F B;  5B2I B;  4JJN B;  5GXQ A;  4ZUX C;  1M19 D;  3WTP A;  3UT9 C;  3REL D;  3X1V B;  3REJ C;  3B0C T;  4M6B A;  2CWE A;  3V9R B;  4WU9 D;  3AZK C;  3MVD D;  5AV5 A;  5B0Z C;  3REK B;  1HQ3 A;  4KHA A;  3AZJ A;  1H3O A;  1P3F B;  3LJA C;  3REI D;  1M18 A;  5DNN C;  5CPK A;  5B33 B;  5B0Y A;  1AOI B;  3UTB A;  1P3K D;  5E5A D;  3AZI B;  1U35 C;  3WAA A;  4ZUX D; 
#chains in the Genus database with same CATH topology
 2Y2O A;  5GSU A;  5GT3 B;  4H9P A;  5DNM A;  3UT9 D;  4NE3 A;  3AZE C;  3AZG C;  4WU8 C;  3MGR B;  1P3P B;  3KUY A;  3REJ D;  4Z5T C;  5C3I C;  2BYM B;  3AZK D;  3AV1 A;  1F1E A;  5AVB D;  1S32 B;  3LEL A;  4AWL B;  4UPK A;  5AV9 B;  1P3G C;  5B24 C;  2ZY5 A;  1TZY A;  5DNN D;  3C1C A;  5AV8 B;  1P3I C;  4NE5 A;  3O62 C;  1Q9C A;  3B6G C;  1U35 D;  3AZM C;  3AZG D;  3AZE D;  4WU8 D;  4LD9 C;  4J8U D;  2XD1 A;  1B67 A;  1TAF A;  1ZLA C;  3C1B A;  1KU5 A;  3KWQ B;  4X23 A;  5AV6 C;  4XUJ C;  5B1L C;  4KHA B;  5B24 D;  3AZJ B;  1P3G D;  1H3O B;  3AV2 A;  4DRA A;  5F99 B;  1M18 B;  3REH C;  2G5I C;  3MGQ B;  2F8N D;  3O62 D;  5CPK B;  2F8N H;  5B0Y B;  3B6G D;  4DQY B;  3UTB B;  2J8P A;  2ARO B;  5FUG A;  5G49 A;  1P3B A;  4R8P C;  3X1S A;  3VH6 T;  3AZM D;  5BS7 C;  3WAA B;  4LD9 D;  1BH8 B;  5DNM B;  4H9P B;  5JA4 B;  3VH5 A;  3KUY B;  3AZL C;  3W96 B;  3W99 C;  4CSR A;  5AVC A;  5B0Z B;  2PYO C;  1ULY A;  5AV6 D;  4XUJ D;  5KDM A;  4Z66 A;  3LEL B;  3LJA B;  3TU4 C;  1JFI B;  3LZ1 A;  4J8W C;  1P3A A;  1KX3 D;  3REH D;  1TZY B;  4WZS B;  1P3M A;  5GT0 A;  4YM6 C;  4R8P D;  1Z2C B;  4H9S C;  5B31 G;  5CPI B;  5CHL B;  4Z5T B;  1BFM A;  5C3I B;  3AZL D;  4KUD C;  3W99 D;  2PYO D;  1TAF B;  2HIO C;  5B31 A;  5B2J A;  3C1B B;  3TU4 D;  2IO5 C;  3F6T A;  3P5J B;  4X23 B;  4J8X C;  3X1U D;  4JJN A;  1KX4 C;  1F66 A;  3WKJ A;  1P3I B;  3X1V A;  5CP6 C;  4J8V C;  1P3L C;  3X1T C;  3V9R A;  4YM6 D;  5FUG B;  5G49 B;  3AZH C;  1P3B B;  5AY8 A;  2BYK B;  1M1A A;  1ZLA B;  1P34 C;  1WWI A;  2HIO D;  4CSR B;  5B1L B;  4KGC D;  4J8X D;  3R45 B;  4Z66 B;  3B0B A;  5KDM B;  1KX4 D;  5B1M C;  3LZ1 B;  1P3A B;  5JRG C;  1P3P A;  3MGR A;  4WV4 B;  5CP6 D;  4J8V D;  3X1T D;  2NQB C;  4G91 C;  4XZQ C;  5GT0 B;  1P3M B;  5B32 C;  1PZR A;  4QLC B;  3EPH A;  3MVD C;  3AYW A;  2Y2P A;  1P34 D;  1ID3 B;  5B40 C;  4Z2M G;  4J8W B;  5E5A C;  5B31 B;  1P3K C;  5B1M D;  1P3O C;  3WKJ B;  5JRG D;  1F66 B;  2NQB D;  3B0D B;  3LZ0 B;  5GXQ C;  4XZQ D;  5B32 D;  3KWQ A;  5AVB C;  3REI A;  4YS3 B;  5AY8 B;  4EO5 B;  5BNV A;  5F99 A;  1M1A B;  4KUD B;  2W8S A;  5B40 D;  5AV5 C;  3MGQ A;  2HIO B;  2L5A A;  3AZF B;  3B0C W;  2IO5 B;  2ARO A;  3EPK A;  3AZN B;  1KX5 C;  3W98 D;  3MGP B;  3A6N C;  4ZUX A;  1P3O D;  3WA9 B;  1BH8 A;  3REJ A;  5JA4 A;  1P3L B;  5GXQ D;  3W96 A;  3AZK A;  4J8U C;  4H9O B;  5B0Z A;  3AN2 C;  3WTP D;  3AZH B;  1EQZ C;  4KGC C;  2CV5 C;  3H0L C;  3LJA A;  1JFI A;  3AYW B;  5DNN A;  3AV1 C;  5AV5 D;  2F8N K;  1HQ3 D;  5CPJ C;  1U35 A;  1KX5 D;  3EPL A;  3A6N D;  4G92 B;  3AZG A;  5CPI A;  2VQR A;  4WU8 A;  1M19 B;  3REL B;  4Z5T A;  3NQJ B;  5GSU D;  3AN2 D;  4WU9 B;  1EQZ D;  2F8N G;  3MVD B;  2CV5 D;  1P3G A;  5B24 A;  3REI B;  3AV1 D;  1P3I A;  5BNV B;  1KX3 C;  3O62 A;  5CPJ D;  3B6G A;  1P3K B;  5E5A B;  3C1C D;  3AZM A;  4ZUX B;  2BYK A;  3UT9 B;  4CAY B;  3UTA C;  2NZD C;  3REJ B;  1ZLA A;  3AZK B;  4WJ3 C;  5BT1 C;  4WNN B;  3KXB C;  2FJ7 C;  5AVB B;  4XUJ A;  3H0M C;  5B1L A;  4E44 A;  3R45 A;  3MNN C;  4H9N B;  2YFV A;  2Y2K A;  4NE6 A;  5AVC C;  2ZY3 A;  3VH6 W;  3X1U C;  5DNN B;  3VH5 T;  3AV2 D;  4R8P A;  1U35 B;  1B6W A;  2ZY4 A;  4QLC A;  5BS7 A;  3W97 C;  3AZG B;  3AZE B;  3UTA D;  4WU8 B;  3AFA C;  4UUZ A;  3MGS C;  2NZD D;  3AZL A;  3X1S D;  4J8U B;  1ID3 A;  3W99 A;  2PYO A;  2DQN C;  3KSY A;  5BT1 D;  2FJ7 D;  3KXB D;  4HGA C;  4J8W A;  1P3G B;  5B24 B;  3MNN D;  5AVC D;  2F2A C;  1R4V A;  3B6F C;  2F8N B;  3O62 B;  5B2I C;  3LZ0 A;  4YM6 A;  3B6G B;  4NFT A;  4H9S A;  3W97 D;  3X1V C;  3AZM B;  2HUE C;  4LD9 B;  4YS3 A;  3AFA D;  3MGS D;  4KUD A;  3REK C;  2HIO A;  3AZF A;  1P3F C;  4KGC A;  3A1K A;  3AZN A;  5AV6 B;  4XUJ B;  1KX4 A;  3MGP A;  2LY8 A;  3WA9 A;  5B33 C;  1AOI C;  1KX3 B;  3REH B;  2YFV B;  5CP6 A;  5B2J D;  1P3L A;  4ZBJ C;  3X1T A;  3B6F D;  1A7W A;  5B2I D;  3AZI C;  2YFW A;  4H9O A;  5GT3 C;  4R8P B;  3AZH A;  3X1V D;  1P3P C;  3MGR C;  2Y2H A;  1P34 A;  2Y2N A;  4UUZ B;  1S32 C;  3REK D;  2FFF B;  4AWL C;  3AZL B;  3W99 B;  1P3F D;  2PYO B;  5AV9 C;  5B32 G;  2Y2J A;  3TU4 B;  2XD5 A;  5B1M A;  5B33 D;  4DRB A;  5AV8 C;  3X1U B;  5JRG A;  1AOI D;  3W98 C;  1M19 A;  2BG1 A;  3REL A;  3AZI D;  2NQB A;  3NQJ A;  4XZQ A;  5BNX B;  5GT3 D;  4YM6 B;  4WU9 A;  2UWX A;  3MVD A;  1P3P D;  3MGR D;  3WTP C;  3AFA B;  5B40 A;  1S32 D;  5AV9 D;  1HQ3 C;  3AZJ C;  1P3K A;  5E5A A;  3WTP E;  5F99 C;  1P3O A;  1M18 C;  4KGC B;  5AV8 D;  4J8X B;  1KX4 B;  3MGQ C;  5CPK C;  1N1J A;  5B0Y C;  3UT9 A;  4CAY A;  3UTB C;  2ARO C;  5CP6 B;  4J8V B;  3X1T B;  2YFW B;  4WNN A;  3WAA C;  5AVB A;  5GSU C;  2HUE B;  5DNM C;  2Y2L A;  3KUY C;  4Z2M H;  3W96 C;  4H9N A;  3KWQ D;  1P34 B;  3NQU B;  3AZJ D;  3LEL C;  1KX5 A;  5F99 D;  3A6N A;  1M18 D;  3MGQ D;  1TZY C;  1BH9 B;  5B1M B;  3C1C C;  5CPK D;  5B0Y D;  4ZBJ B;  5JRG B;  3AZE A;  3UTB D;  2ARO D;  4J8U A;  2NQB B;  3AN2 A;  4G91 B;  4XZQ B;  1EQZ A;  3WAA D;  5CPI C;  5B32 B;  2CV5 A;  5DNM D;  4H9Q B;  1HTA A;  1W2E A;  3KUY D;  3W96 D;  5B0Z D;  5B40 B;  5CPJ A;  3C1B C;  3LEL D;  2JCH A;  3LJA D;  2F8N A;  4X23 C;  3AV2 C;  1TZY D;  3W98 B;  1P3O B;  2Y2G A;  4LD9 A;  1N1J B;  2ZY2 A;  5BO0 A;  5GXQ B;  1P3B C;  3X1S C;  5CPI D;  3WTP B;  5AV6 A;  4Z5T D;  1KX3 A;  3REH A;  3VH6 A;  5AV5 B;  3C1B D;  1HQ3 B;  4X23 D;  4Z66 C;  3LZ1 C;  1P3A C;  1KX5 B;  1P3I D;  3A6N B;  3UTA A;  2DF4 C;  2RVQ C;  2NZD A;  1P3M C;  5GT0 C;  3A1I A;  4QLC C;  1P3B D;  3IP4 C;  2FJ7 A;  3KXB A;  5GSU B;  3AN2 B;  1EQZ B;  2CV5 B;  3VH5 W;  3KFU G;  2RIQ A;  3TU4 A;  3MNN A;  1ZLA D;  4H9R A;  1ID3 C;  3X1U A;  3AV1 B;  5B1L D;  5B31 C;  4Z66 D;  5B2J C;  5CPJ B;  3LZ1 D;  4JJN C;  5BNX A;  1P3A D;  3W97 A;  1F66 C;  3WKJ C;  2Y2I A;  3C1C B;  3AFA A;  2RVQ D;  3MGS A;  3B0D C;  3LZ0 C;  1P3M D;  5GT0 D;  4QLC D;  3H0R C;  5BO0 B;  1WWS A;  4YS3 C;  5AY8 C;  4EO5 C;  2JSS A;  1M1A C;  1ID3 D;  4J8X A;  3AZF C;  3B6F A;  4J8W D;  5B2I A;  5B31 D;  3AZN C;  4J8V A;  3MGP C;  4JJN D;  3AV2 B;  3WA9 C;  3WKJ D;  1F66 D;  2Y2M A;  3LZ0 D;  3UTA B;  2NZD B;  3REK A;  3X1S B;  1P3F A;  3NQU A;  2ZM5 A;  1T3U A;  3FDD A;  2FJ7 B;  3KXB B;  4YS3 D;  5AY8 D;  3EG5 B;  1M1A D;  3AYW C;  4KUD D;  5B33 A;  1AOI A;  1BH9 A;  3MNN B;  4H9R B;  5AVC B;  3AZF D;  3AZI A;  3AZN D;  3MGP D;  3WA9 D;  5GT3 A;  4E45 A;  4G92 C;  5B32 A;  4H9Q A;  1M19 C;  1P3L D;  3W97 B;  3REL C;  2BYM A;  3MGS B;  2Y2Q A;  1S32 A;  3AZH D;  4WU9 C;  5AV9 A;  3KWQ C;  4HGA B;  2JE5 A;  3AYW D;  3REI C;  5AV8 A;  3W98 A;  5B2J B;  2G5H C;  3B6F B;  5B2I B;  4JJN B;  5GXQ A;  3AL0 C;  4ZUX C;  1M19 D;  3WTP A;  3UT9 C;  3REL D;  3X1V B;  3REJ C;  3B0C T;  4M6B A;  2CWE A;  3V9R B;  4WU9 D;  3AZK C;  3MVD D;  5AV5 A;  5B0Z C;  3REK B;  1HQ3 A;  4KHA A;  3AZJ A;  1H3O A;  1P3F B;  3EPJ A;  3LJA C;  3REI D;  1M18 A;  5DNN C;  5CPK A;  5B33 B;  5B0Y A;  1AOI B;  3UTB A;  1P3K D;  5E5A D;  3AZI B;  1U35 C;  3WAA A;  4ZUX D; 
#chains in the Genus database with same CATH homology
 2Y2O A;  5GSU A;  5GT3 B;  4H9P A;  5DNM A;  3UT9 D;  4NE3 A;  3AZE C;  3AZG C;  4WU8 C;  3MGR B;  1P3P B;  3KUY A;  3REJ D;  4Z5T C;  5C3I C;  2BYM B;  3AZK D;  3AV1 A;  1F1E A;  5AVB D;  1S32 B;  3LEL A;  4AWL B;  4UPK A;  5AV9 B;  1P3G C;  5B24 C;  2ZY5 A;  1TZY A;  5DNN D;  3C1C A;  5AV8 B;  1P3I C;  4NE5 A;  3O62 C;  1Q9C A;  3B6G C;  1U35 D;  3AZM C;  3AZG D;  3AZE D;  4WU8 D;  4LD9 C;  4J8U D;  2XD1 A;  1B67 A;  1TAF A;  1ZLA C;  3C1B A;  1KU5 A;  3KWQ B;  4X23 A;  5AV6 C;  4XUJ C;  5B1L C;  4KHA B;  5B24 D;  3AZJ B;  1P3G D;  1H3O B;  3AV2 A;  4DRA A;  5F99 B;  1M18 B;  3REH C;  2G5I C;  3MGQ B;  2F8N D;  3O62 D;  5CPK B;  2F8N H;  5B0Y B;  3B6G D;  4DQY B;  3UTB B;  2J8P A;  2ARO B;  5FUG A;  5G49 A;  1P3B A;  4R8P C;  3X1S A;  3VH6 T;  3AZM D;  5BS7 C;  3WAA B;  4LD9 D;  1BH8 B;  5DNM B;  4H9P B;  5JA4 B;  3VH5 A;  3KUY B;  3AZL C;  3W96 B;  3W99 C;  4CSR A;  5AVC A;  5B0Z B;  2PYO C;  1ULY A;  5AV6 D;  4XUJ D;  5KDM A;  4Z66 A;  3LEL B;  3LJA B;  3TU4 C;  1JFI B;  3LZ1 A;  4J8W C;  1P3A A;  1KX3 D;  3REH D;  1TZY B;  4WZS B;  1P3M A;  5GT0 A;  4YM6 C;  4R8P D;  1Z2C B;  4H9S C;  5B31 G;  5CPI B;  5CHL B;  4Z5T B;  1BFM A;  5C3I B;  3AZL D;  4KUD C;  3W99 D;  2PYO D;  1TAF B;  2HIO C;  5B31 A;  5B2J A;  3C1B B;  3TU4 D;  2IO5 C;  3F6T A;  3P5J B;  4X23 B;  4J8X C;  3X1U D;  4JJN A;  1KX4 C;  1F66 A;  3WKJ A;  1P3I B;  3X1V A;  5CP6 C;  4J8V C;  1P3L C;  3X1T C;  3V9R A;  4YM6 D;  5FUG B;  5G49 B;  3AZH C;  1P3B B;  5AY8 A;  2BYK B;  1M1A A;  1ZLA B;  1P34 C;  1WWI A;  2HIO D;  4CSR B;  5B1L B;  4KGC D;  4J8X D;  3R45 B;  4Z66 B;  3B0B A;  5KDM B;  1KX4 D;  5B1M C;  3LZ1 B;  1P3A B;  5JRG C;  1P3P A;  3MGR A;  4WV4 B;  5CP6 D;  4J8V D;  3X1T D;  2NQB C;  4G91 C;  4XZQ C;  5GT0 B;  1P3M B;  5B32 C;  1PZR A;  4QLC B;  3EPH A;  3MVD C;  3AYW A;  2Y2P A;  1P34 D;  1ID3 B;  5B40 C;  4Z2M G;  4J8W B;  5E5A C;  5B31 B;  1P3K C;  5B1M D;  1P3O C;  3WKJ B;  5JRG D;  1F66 B;  2NQB D;  3B0D B;  3LZ0 B;  5GXQ C;  4XZQ D;  5B32 D;  3KWQ A;  5AVB C;  3REI A;  4YS3 B;  5AY8 B;  4EO5 B;  5BNV A;  5F99 A;  1M1A B;  4KUD B;  2W8S A;  5B40 D;  5AV5 C;  3MGQ A;  2HIO B;  2L5A A;  3AZF B;  3B0C W;  2IO5 B;  2ARO A;  3EPK A;  3AZN B;  1KX5 C;  3W98 D;  3MGP B;  3A6N C;  4ZUX A;  1P3O D;  3WA9 B;  1BH8 A;  3REJ A;  5JA4 A;  1P3L B;  5GXQ D;  3W96 A;  3AZK A;  4J8U C;  4H9O B;  5B0Z A;  3AN2 C;  3WTP D;  3AZH B;  1EQZ C;  4KGC C;  2CV5 C;  3H0L C;  3LJA A;  1JFI A;  3AYW B;  5DNN A;  3AV1 C;  5AV5 D;  2F8N K;  1HQ3 D;  5CPJ C;  1U35 A;  1KX5 D;  3EPL A;  3A6N D;  4G92 B;  3AZG A;  5CPI A;  2VQR A;  4WU8 A;  1M19 B;  3REL B;  4Z5T A;  3NQJ B;  5GSU D;  3AN2 D;  4WU9 B;  1EQZ D;  2F8N G;  3MVD B;  2CV5 D;  1P3G A;  5B24 A;  3REI B;  3AV1 D;  1P3I A;  5BNV B;  1KX3 C;  3O62 A;  5CPJ D;  3B6G A;  1P3K B;  5E5A B;  3C1C D;  3AZM A;  4ZUX B;  2BYK A;  3UT9 B;  4CAY B;  3UTA C;  2NZD C;  3REJ B;  1ZLA A;  3AZK B;  4WJ3 C;  5BT1 C;  4WNN B;  3KXB C;  2FJ7 C;  5AVB B;  4XUJ A;  3H0M C;  5B1L A;  4E44 A;  3R45 A;  3MNN C;  4H9N B;  2YFV A;  2Y2K A;  4NE6 A;  5AVC C;  2ZY3 A;  3VH6 W;  3X1U C;  5DNN B;  3VH5 T;  3AV2 D;  4R8P A;  1U35 B;  1B6W A;  2ZY4 A;  4QLC A;  5BS7 A;  3W97 C;  3AZG B;  3AZE B;  3UTA D;  4WU8 B;  3AFA C;  4UUZ A;  3MGS C;  2NZD D;  3AZL A;  3X1S D;  4J8U B;  1ID3 A;  3W99 A;  2PYO A;  2DQN C;  3KSY A;  5BT1 D;  2FJ7 D;  3KXB D;  4HGA C;  4J8W A;  1P3G B;  5B24 B;  3MNN D;  5AVC D;  2F2A C;  1R4V A;  3B6F C;  2F8N B;  3O62 B;  5B2I C;  3LZ0 A;  4YM6 A;  3B6G B;  4NFT A;  4H9S A;  3W97 D;  3X1V C;  3AZM B;  2HUE C;  4LD9 B;  4YS3 A;  3AFA D;  3MGS D;  4KUD A;  3REK C;  2HIO A;  3AZF A;  1P3F C;  4KGC A;  3A1K A;  3AZN A;  5AV6 B;  4XUJ B;  1KX4 A;  3MGP A;  2LY8 A;  3WA9 A;  5B33 C;  1AOI C;  1KX3 B;  3REH B;  2YFV B;  5CP6 A;  5B2J D;  1P3L A;  4ZBJ C;  3X1T A;  3B6F D;  1A7W A;  5B2I D;  3AZI C;  2YFW A;  4H9O A;  5GT3 C;  4R8P B;  3AZH A;  3X1V D;  1P3P C;  3MGR C;  2Y2H A;  1P34 A;  2Y2N A;  4UUZ B;  1S32 C;  3REK D;  2FFF B;  4AWL C;  3AZL B;  3W99 B;  1P3F D;  2PYO B;  5AV9 C;  5B32 G;  2Y2J A;  3TU4 B;  2XD5 A;  5B1M A;  5B33 D;  4DRB A;  5AV8 C;  3X1U B;  5JRG A;  1AOI D;  3W98 C;  1M19 A;  2BG1 A;  3REL A;  3AZI D;  2NQB A;  3NQJ A;  4XZQ A;  5BNX B;  5GT3 D;  4YM6 B;  4WU9 A;  2UWX A;  3MVD A;  1P3P D;  3MGR D;  3WTP C;  3AFA B;  5B40 A;  1S32 D;  5AV9 D;  1HQ3 C;  3AZJ C;  1P3K A;  5E5A A;  3WTP E;  5F99 C;  1P3O A;  1M18 C;  4KGC B;  5AV8 D;  4J8X B;  1KX4 B;  3MGQ C;  5CPK C;  1N1J A;  5B0Y C;  3UT9 A;  4CAY A;  3UTB C;  2ARO C;  5CP6 B;  4J8V B;  3X1T B;  2YFW B;  4WNN A;  3WAA C;  5AVB A;  5GSU C;  2HUE B;  5DNM C;  2Y2L A;  3KUY C;  4Z2M H;  3W96 C;  4H9N A;  3KWQ D;  1P34 B;  3NQU B;  3AZJ D;  3LEL C;  1KX5 A;  5F99 D;  3A6N A;  1M18 D;  3MGQ D;  1TZY C;  1BH9 B;  5B1M B;  3C1C C;  5CPK D;  5B0Y D;  4ZBJ B;  5JRG B;  3AZE A;  3UTB D;  2ARO D;  4J8U A;  2NQB B;  3AN2 A;  4G91 B;  4XZQ B;  1EQZ A;  3WAA D;  5CPI C;  5B32 B;  2CV5 A;  5DNM D;  4H9Q B;  1HTA A;  1W2E A;  3KUY D;  3W96 D;  5B0Z D;  5B40 B;  5CPJ A;  3C1B C;  3LEL D;  2JCH A;  3LJA D;  2F8N A;  4X23 C;  3AV2 C;  1TZY D;  3W98 B;  1P3O B;  2Y2G A;  4LD9 A;  1N1J B;  2ZY2 A;  5BO0 A;  5GXQ B;  1P3B C;  3X1S C;  5CPI D;  3WTP B;  5AV6 A;  4Z5T D;  1KX3 A;  3REH A;  3VH6 A;  5AV5 B;  3C1B D;  1HQ3 B;  4X23 D;  4Z66 C;  3LZ1 C;  1P3A C;  1KX5 B;  1P3I D;  3A6N B;  3UTA A;  2DF4 C;  2RVQ C;  2NZD A;  1P3M C;  5GT0 C;  3A1I A;  4QLC C;  1P3B D;  3IP4 C;  2FJ7 A;  3KXB A;  5GSU B;  3AN2 B;  1EQZ B;  2CV5 B;  3VH5 W;  3KFU G;  2RIQ A;  3TU4 A;  3MNN A;  1ZLA D;  4H9R A;  1ID3 C;  3X1U A;  3AV1 B;  5B1L D;  5B31 C;  4Z66 D;  5B2J C;  5CPJ B;  3LZ1 D;  4JJN C;  5BNX A;  1P3A D;  3W97 A;  1F66 C;  3WKJ C;  2Y2I A;  3C1C B;  3AFA A;  2RVQ D;  3MGS A;  3B0D C;  3LZ0 C;  1P3M D;  5GT0 D;  4QLC D;  3H0R C;  5BO0 B;  1WWS A;  4YS3 C;  5AY8 C;  4EO5 C;  2JSS A;  1M1A C;  1ID3 D;  4J8X A;  3AZF C;  3B6F A;  4J8W D;  5B2I A;  5B31 D;  3AZN C;  4J8V A;  3MGP C;  4JJN D;  3AV2 B;  3WA9 C;  3WKJ D;  1F66 D;  2Y2M A;  3LZ0 D;  3UTA B;  2NZD B;  3REK A;  3X1S B;  1P3F A;  3NQU A;  2ZM5 A;  1T3U A;  3FDD A;  2FJ7 B;  3KXB B;  4YS3 D;  5AY8 D;  3EG5 B;  1M1A D;  3AYW C;  4KUD D;  5B33 A;  1AOI A;  1BH9 A;  3MNN B;  4H9R B;  5AVC B;  3AZF D;  3AZI A;  3AZN D;  3MGP D;  3WA9 D;  5GT3 A;  4E45 A;  4G92 C;  5B32 A;  4H9Q A;  1M19 C;  1P3L D;  3W97 B;  3REL C;  2BYM A;  3MGS B;  2Y2Q A;  1S32 A;  3AZH D;  4WU9 C;  5AV9 A;  3KWQ C;  4HGA B;  2JE5 A;  3AYW D;  3REI C;  5AV8 A;  3W98 A;  5B2J B;  2G5H C;  3B6F B;  5B2I B;  4JJN B;  5GXQ A;  3AL0 C;  4ZUX C;  1M19 D;  3WTP A;  3UT9 C;  3REL D;  3X1V B;  3REJ C;  3B0C T;  4M6B A;  2CWE A;  3V9R B;  4WU9 D;  3AZK C;  3MVD D;  5AV5 A;  5B0Z C;  3REK B;  1HQ3 A;  4KHA A;  3AZJ A;  1H3O A;  1P3F B;  3EPJ A;  3LJA C;  3REI D;  1M18 A;  5DNN C;  5CPK A;  5B33 B;  5B0Y A;  1AOI B;  3UTB A;  1P3K D;  5E5A D;  3AZI B;  1U35 C;  3WAA A;  4ZUX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...