5B31A

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31A00
5JRGB 1S32B 1M18C 1TZYA 5AV9A 4J8XB 4J8UC 5AY8A 1P3PC 3AYWB 3X1SD 5B2JB 3X1UC 3AFAA 4J8WC 3REIB 1F66D 3MGRB 4XUJB 3LJAC 4Z5TA 4H9SA 5B1MA 1TAFB 5B31A 4KUDB 5FUGB 3NQJA 4CAYB 5BT1C 1KX5C 5GSUA 5CPJC 2F8NB 4J8VA 5CP6D 5B1LA 2IO5B 3WA9B 3KXBA 5GT0B 5B32B 5AV6B 2NZDC 3UT9B 5G49A 3TU4C 5B0ZB 1F1EA 3LZ0C 4WU8C 3REJB 5E5AB 4R8PD 1ZLAD 1P3GB 3REHA 1P3FB 3VH5T 5CPIC 1HQ3C 2HIOA 5AV5A 3AZFC 3AZGA 3AN2A 1P3IA 4EO5B 3C1CC 5AV9D 5AY8D 2BYKB 3AFAD 5F99A 4WZSB 5JA4A 5GXQB 1M19B 3AYWA 3NQUB 5B1MD 5B31D 3B0BA 3B0CT 1P3KA 3C1BB 5B2IB 3AZJD 4Z2MG 3WTPC 3KUYB 4J8VD 5B1LD 1TAFA 3AZNB 1KX3A 3AZHD 1P3MA 2F8NA 3WKJB 4X23A 4E44A 2YFWB 3W97B 5B40B 3R45B 5AV6A 3MGPC 3REKB 1KX4A 3REHD 4KGCD 1P34C 5AV5D 2LY8A 3AZGD 3AN2D 1M18A 1P3ID 4H9PB 1A7WA 3AZKB 3AZMB 5AV8B 4H9OA 4YM6C 3X1UA 2PYOC 5CPKB 3MVDD 5F99D 1P3OB 5BNXA 1BFMA 1U35B 3AZEB 2BYKA 1TZYC 1KX5A 5AV9C 3MGQA 5AY8C 3X1VD 3AFAC 2CV5C 1KX3D 2RVQD 4CSRA 3AZIB 4YS3B 2NZDA 4Z5TC 5B24B 3UTBA 1P3BC 5B33A 3W98B 1H3OA 5GSUC 4WU9C 3WKJA 1KX4D 3KXBC 1M1AD 4UUZB 4JJND 3O62B 1Q9CA 4ZUXB 1M18D 5B32G 4HGAB 4J8UD 2CWEA 1P3PD 2HUEB 2HIOC 3X1UD 3MGSB 4J8WD 4H9PA 1EQZB 3B6GB 5BNVB 3LJAD 3AN2C 5AVCB 3X1TB 5BT1D 5CPKA 1KX5D 1ULYA 3MGQD 1ID3C 5CPJD 3WTPA 4ZBJB 3A6NA 1S32C 5F99C 1ZLAB 4H9NB 4J8XC 1P3LB 2NZDD 3AYWC 4WNNB 3UTBD 4XZQA 5B33D 3V9RB 1P3KC 2NQBA 3TU4D 2JSSA 4XUJC 3RELB 4WU8D 3UTAB 4KUDC 5CPID 1B6WA 1HQ3D 1P34A 1P3MC 4QLCB 4X23C 3WA9C 5AV6C 3C1CD 4YM6A 1KU5A 2AROA 4H9QA 5E5AC 1P3FC 3AZHB 3B6GA 3VH6W 3WTPD 3WAAB 2CV5A 4E45A 5C3IB 3AV2B 3W99A 4G92C 1P3BA 1B67A 3MGQC 4H9NA 4G91C 4WU9A 5GXQC 3MGPD 1JFIB 5GT3B 3V9RA 3C1BC 3LZ1A 5B2IC 3UTBC 1P34D 5B33C 5AVBB 3W96A 4QLCA 3WKJC 4LD9B 3LELA 3B6FB 4YM6D 2PYOD 2AROD 3X1VB 4Z66B 3MNNB 5DNNB 1TZYD 3B0CW 2F8NK 4NE6A 1BH8B 4H9RB 1ID3A 5JRGA 5BO0B 1S32A 2CV5D 4WV4B 4J8XA 4Z5TD 3W99D 3AV1B 5B2JA 3REIA 1P3BD 1M1AB 5CPKC 3MGRA 4XUJA 5GSUD 4JJNB 5KDMB 5DNMB 1P3OC 3A6NC 4WU9D 4KUDA 5FUGA 4CAYA 3KWQB 3KXBD 4J8UB 3LZ1D 4XZQC 2NQBC 3WA9A 3VH6A 5GT0A 5B32A 3W96D 3UT9A 5B0ZA 5AVBA 2HIOD 3REJA 5E5AA 5CPJB 1P3GA 1P3FA 2FJ7B 3VH5A 4ZUXC 5DNNA 4KHAB 1ID3D 2F8NH 5JRGD 2AROC 3TU4B 1S32D 3LZ0B 1AOIB 4WU8B 4J8XD 5BO0A 3AYWD 2HUEC 5B2JD 1HQ3B 1P3KD 4XUJD 1N1JB 3B6GC 3AZFB 1P3AB 5GXQA 1M19A 5B0YB 3X1TC 3NQUA 4KUDD 4AWLB 3C1BA 4NE3A 3C1CB 3AZLB 4DRBA 5B2IA 1P3MD 3W99C 3KUYA 2F8ND 4X23D 3AZNA 3KWQA 3WA9D 5GT0D 5AV6D 3W97A 2YFWA 5B0ZD 5B40A 3R45A 3LZ1C 3RELC 3REJD 5E5AD 3REKA 3X1SB 3UTAC 1P3GD 3W96C 1P3FD 1F66B 4DRAA 4QLCC 3LELC 4NE5A 3AZKA 5CP6B 3AZMA 5AV8A 3B0DC 1AOIA 1P3OA 5JRGC 1U35A 5GXQD 3AZEA 1M19D 4R8PB 3C1BD 5B2ID 3KUYD 5B2JC 3WAAC 3REIC 3MGRC 3AZND 2PYOB 3AZIA 4YS3A 3AV2C 5B24A 3WKJD 3W98A 1TZYB 5AV9B 5AY8B 2IO5C 1HTAA 3AFAB 5GT3C 5GT0C 5B32C 4UUZA 1WWSA 3UT9C 1R4VA 3O62A 4Z5TB 4ZUXA 5B1MB 3X1SA 5B0ZC 5AVBC 5B31B 1F66A 3NQJB 3REJC 3AZJB 1P3GC 4J8VB 5B1LB 5AV8D 3KXBB 3MGSA 5CPKD 1EQZA 5G49B 5BNVA 4Z66C 3MNNC 5DNNC 5AVCA 1P3OD 3A6ND 3X1TA 4EO5C 3AZED 3REHB 4KGCB 4XZQD 2NQBD 2HIOB 5AV5B 4R8PA 1ZLAA 1P3LA 1M19C 3AZGB 3AN2B 4WNNA 3AV1C 3VH5W 1P3IB 3W98D 3RELA 5DNMC 3KUYC 4Z2MH 3UTAA 3AZNC 3KWQC 3MVDB 5F99B 5JA4B 3O62D 4ZUXD 3W97C 5B40C 1P3KB 3REKC 1KX3B 3MGSD 1P3MB 3AZJA 1EQZD 3B6GD 3VH6T 4X23B 5AVCD 2FJ7C 3X1TD 3AZKC 3AZHA 1BH9B 3AZMC 5AV8C 1KX4B 3WAAA 1AOIC 3AV2A 1U35C 1P3LD 3AZEC 4KGCA 1M18B 3RELD 1P3AC 1P3PB 4H9OB 1JFIA 5B0YC 3UTAD 5GT3A 3X1UB 4J8WB 3AZIC 4YS3C 4AWLC 3AZLC 5B24C 3LJAB 5CHLB 4QLCD 5BNXB 4G92B 3LELD 3W98C 1KX5B 3MGQB 3MVDA 4G91B 4LD9A 3B6FA 4CSRB 3O62C 2L5AA 3X1VA 2NZDB 4Z66A 3MNNA 3UTBB 3X1SC 5B33B 1F66C 1H3OB 4HGAC 1BH8A 4H9RA 5CPIB 5B31G 3REID 3MGSC 3WAAD 3MGRD 1EQZC 1BH9A 5CP6C 3AV2D 5AVCC 3AV1A 1M1AA 5BS7A 4JJNA 5KDMA 5DNMA 4ZBJC 2BYMB 5GT3D 4R8PC 5B32D 1ZLAC 1P3LC 4J8UA 3UT9D 1P3PA 5AVBD 4J8WA 3LJAA 3WTPB 3A6NB 4LD9D 3B6FD 5CPJA 2YFVB 4Z66D 3MNND 5DNND 4XZQB 2FJ7A 2NQBB 3MGPB 4H9SC 5B1MC 4KHAA 5B31C 3TU4A 3LZ0A 4WU8A 1P34B 3AZJC 4J8VC 3WTPE 5B1LC 4M6BA 3AV1D 5CPIA 3AZHC 1HQ3A 1N1JA 3AZFA 5DNMD 1P3AA 2F8NG 4YM6B 5B0YA 2AROB 3KSYA 5C3IC 3KWQD 3C1CA 4H9QB 3AZLA 3REHC 4KGCC 2BYMA 3W97D 5AV5C 5B40D 3REKD 3AZGC 1P3IC 2CV5B 3W99B 1P3BB 1WWIA 5GSUB 2FJ7D 3MVDC 3AZKD 3AZMD 4WU9B 4LD9C 3B6FC 2YFVA 3X1VC 3LZ0D 3LZ1B 1AOID 5CP6A 3MGPA 1U35D 1KX3C 2RVQC 3W96B 3AZFD 1P3AD 3LELB 5B0YD 3AZID 4YS3D 1KX4C 3AZLD 5B24D 1M1AC 3B0DB 5BS7C 4NFTA 2PYOA 4JJNC 1ID3B
chains in the Genus database with same CATH superfamily
5JRGB 1S32B 1M18C 1TZYA 5AV9A 4J8XB 4J8UC 5AY8A 1P3PC 3AYWB 3X1SD 5B2JB 3X1UC 3AFAA 4J8WC 3REIB 1F66D 3MGRB 4XUJB 3LJAC 4Z5TA 4H9SA 5B1MA 1TAFB 5B31A 4KUDB 5FUGB 3NQJA 4CAYB 5BT1C 1KX5C 4WJ3C 5GSUA 5CPJC 2F8NB 4J8VA 5CP6D 5B1LA 2IO5B 3WA9B 3KXBA 5GT0B 5B32B 5AV6B 2NZDC 3UT9B 5G49A 3FDDA 3TU4C 5B0ZB 1F1EA 3LZ0C 4WU8C 3REJB 5E5AB 4R8PD 1ZLAD 1P3GB 3REHA 1P3FB 2Y2NA 3VH5T 5CPIC 1HQ3C 1PZRA 2HIOA 5AV5A 3AZFC 3AZGA 3AN2A 1P3IA 4EO5B 3C1CC 5AV9D 5AY8D 2BYKB 3AFAD 5F99A 4WZSB 2UWXA 5JA4A 5GXQB 1M19B 3AYWA 2XD5A 3NQUB 5B1MD 5B31D 3B0BA 3B0CT 1P3KA 3C1BB 5B2IB 4DQYB 3AZJD 4Z2MG 3WTPC 3KUYB 4J8VD 5B1LD 1TAFA 3AZNB 1KX3A 3AZHD 1P3MA 2F8NA 3WKJB 4X23A 4E44A 2YFWB 3W97B 5B40B 3R45B 5AV6A 3MGPC 3REKB 1KX4A 3REHD 4KGCD 1P34C 5AV5D 2LY8A 3AZGD 3AN2D 1M18A 1P3ID 4H9PB 1A7WA 2Y2LA 3AZKB 2Y2HA 3AZMB 5AV8B 4H9OA 4YM6C 3X1UA 2PYOC 5CPKB 3MVDD 5F99D 1P3OB 5BNXA 1BFMA 1U35B 3AZEB 2BYKA 1TZYC 1KX5A 5AV9C 3MGQA 5AY8C 3F6TA 3X1VD 3AFAC 2CV5C 1KX3D 2RVQD 2Y2KA 4CSRA 3AZIB 4YS3B 4Z5TC 2NZDA 5B24B 3UTBA 1P3BC 5B33A 3W98B 1H3OA 5GSUC 4WU9C 3WKJA 1KX4D 2ZY4A 3KXBC 1M1AD 4UUZB 4JJND 3O62B 1Q9CA 4ZUXB 1M18D 5B32G 4HGAB 4J8UD 2CWEA 1P3PD 2HUEB 2HIOC 3X1UD 3MGSB 4J8WD 4H9PA 1EQZB 3B6GB 5BNVB 3LJAD 3AN2C 5AVCB 3X1TB 2FFFB 5BT1D 5CPKA 1KX5D 1ULYA 3MGQD 1ID3C 5CPJD 3WTPA 4ZBJB 3A6NA 1S32C 1W2EA 5F99C 1ZLAB 4H9NB 4J8XC 1P3LB 2NZDD 2G5HC 3AYWC 4WNNB 3UTBD 4XZQA 2ZY3A 3V9RB 5B33D 1P3KC 3TU4D 2JSSA 2NQBA 4XUJC 3RELB 4WU8D 3UTAB 4KUDC 5CPID 1B6WA 1HQ3D 1P34A 1P3MC 4QLCB 4X23C 3WA9C 5AV6C 3C1CD 4YM6A 1KU5A 2AROA 4H9QA 5E5AC 1P3FC 3AZHB 3B6GA 3VH6W 3WTPD 3WAAB 2CV5A 4E45A 5C3IB 3AV2B 3W99A 4G92C 1P3BA 1B67A 3MGQC 4H9NA 4G91C 4WU9A 5GXQC 3MGPD 2G5IC 1JFIB 5GT3B 3V9RA 3C1BC 3LZ1A 5B2IC 3UTBC 1P34D 5B33C 5AVBB 3W96A 4QLCA 3WKJC 4LD9B 3LELA 3B6FB 4YM6D 3EPJA 2PYOD 2AROD 3X1VB 4Z66B 3MNNB 3H0MC 5DNNB 1TZYD 3B0CW 2F8NK 4NE6A 1BH8B 4H9RB 1ID3A 5JRGA 5BO0B 1S32A 2CV5D 4WV4B 4J8XA 4Z5TD 3W99D 3AV1B 5B2JA 3REIA 1P3BD 1M1AB 5CPKC 3MGRA 4XUJA 5GSUD 4JJNB 5KDMB 5DNMB 1P3OC 3A6NC 4WU9D 4KUDA 5FUGA 4CAYA 3KWQB 3KXBD 3H0RC 4J8UB 3LZ1D 4XZQC 2NQBC 3WA9A 3VH6A 5GT0A 5B32A 3W96D 3UT9A 5B0ZA 5AVBA 2HIOD 3REJA 5E5AA 5CPJB 3P5JB 1P3GA 1P3FA 2RIQA 2FJ7B 3VH5A 4ZUXC 5DNNA 4KHAB 1ID3D 2F8NH 5JRGD 2AROC 3TU4B 2DF4C 1S32D 3LZ0B 1AOIB 4WU8B 3EPLA 4J8XD 5BO0A 3AYWD 2HUEC 5B2JD 1HQ3B 1P3KD 4XUJD 1N1JB 3B6GC 3AZFB 1P3AB 5GXQA 1M19A 5B0YB 3X1TC 3NQUA 2Y2GA 4KUDD 4AWLB 3C1BA 4NE3A 3C1CB 3AZLB 4DRBA 5B2IA 1P3MD 3W99C 3KUYA 2F8ND 4X23D 3AZNA 3KWQA 3WA9D 5GT0D 5AV6D 2Y2JA 3W97A 2YFWA 5B0ZD 5B40A 3R45A 3LZ1C 3RELC 2VQRA 3REJD 5E5AD 3REKA 3X1SB 3UTAC 1P3GD 3W96C 2Y2OA 1P3FD 1F66B 4DRAA 4QLCC 3LELC 4NE5A 3AZKA 5CP6B 3AZMA 5AV8A 3B0DC 1AOIA 1P3OA 5JRGC 1U35A 5GXQD 3AZEA 1M19D 2ZY2A 4R8PB 3C1BD 5B2ID 3KUYD 5B2JC 3WAAC 3REIC 3MGRC 3AZND 2PYOB 3AZIA 4YS3A 3AV2C 5B24A 3WKJD 3W98A 1TZYB 5AV9B 5AY8B 2IO5C 1HTAA 3AFAB 5GT3C 5GT0C 5B32C 4UUZA 1WWSA 3UT9C 1R4VA 3O62A 4Z5TB 4ZUXA 5B1MB 3X1SA 5B0ZC 5AVBC 5B31B 1F66A 3NQJB 3REJC 3AZJB 1P3GC 4J8VB 5B1LB 2XD1A 5AV8D 3KXBB 3MGSA 5CPKD 1EQZA 5G49B 5BNVA 4Z66C 3MNNC 5DNNC 5AVCA 1P3OD 3A6ND 3X1TA 4EO5C 2F2AC 3AZED 3REHB 4KGCB 4XZQD 2NQBD 2HIOB 5AV5B 4R8PA 1ZLAA 1P3LA 1M19C 3AZGB 3AN2B 4WNNA 3AV1C 3VH5W 1P3IB 1T3UA 3W98D 3RELA 5DNMC 3KUYC 2ZY5A 4Z2MH 3UTAA 3AZNC 3KWQC 3MVDB 5F99B 5JA4B 3O62D 4ZUXD 3W97C 5B40C 1P3KB 3REKC 1KX3B 3MGSD 1P3MB 3AZJA 1EQZD 3B6GD 2DQNC 3VH6T 4X23B 5AVCD 2FJ7C 2JE5A 3X1TD 3AZKC 3AZHA 1BH9B 3AZMC 5AV8C 1KX4B 3IP4C 3WAAA 1AOIC 3AV2A 1U35C 1P3LD 3AZEC 4KGCA 1M18B 3RELD 1P3AC 1P3PB 4H9OB 1JFIA 5B0YC 3UTAD 5GT3A 3X1UB 4J8WB 3AZIC 4YS3C 4AWLC 3AZLC 5B24C 3LJAB 5CHLB 4QLCD 5BNXB 1Z2CB 2Y2QA 4G92B 3LELD 3EPKA 2Y2MA 3W98C 1KX5B 3MGQB 3MVDA 4G91B 4LD9A 2W8SA 3B6FA 3EPHA 4CSRB 3O62C 2L5AA 3X1VA 2NZDB 4Z66A 3MNNA 3UTBB 3X1SC 3A1IA 5B33B 1F66C 1H3OB 4HGAC 2J8PA 1BH8A 4H9RA 5CPIB 3A1KA 5B31G 3MGSC 3REID 3WAAD 3MGRD 1EQZC 1BH9A 5CP6C 3AV2D 5AVCC 3AV1A 1M1AA 5BS7A 4JJNA 5KDMA 5DNMA 4ZBJC 2BYMB 5GT3D 4R8PC 5B32D 1ZLAC 1P3LC 4J8UA 3UT9D 1P3PA 5AVBD 4J8WA 3H0LC 4UPKA 3LJAA 3WTPB 3A6NB 4LD9D 3B6FD 5CPJA 2YFVB 4Z66D 3MNND 5DNND 4XZQB 2FJ7A 2NQBB 2BG1A 3KFUG 3MGPB 2JCHA 4H9SC 5B1MC 4KHAA 5B31C 3TU4A 3LZ0A 4WU8A 1P34B 3AZJC 4J8VC 3WTPE 5B1LC 4M6BA 3AV1D 5CPIA 3AZHC 1HQ3A 1N1JA 3AZFA 5DNMD 1P3AA 2F8NG 4YM6B 5B0YA 2AROB 3KSYA 5C3IC 3KWQD 3C1CA 4H9QB 3AZLA 3REHC 4KGCC 2BYMA 3W97D 5AV5C 5B40D 3REKD 3AZGC 2ZM5A 2Y2IA 1P3IC 2CV5B 3W99B 1P3BB 3AL0C 1WWIA 5GSUB 2FJ7D 3MVDC 3AZKD 3AZMD 4WU9B 4LD9C 3B6FC 2YFVA 2Y2PA 3EG5B 3X1VC 3LZ0D 3LZ1B 1AOID 5CP6A 3MGPA 1U35D 1KX3C 2RVQC 3W96B 3AZFD 1P3AD 3LELB 5B0YD 3AZID 4YS3D 1KX4C 3AZLD 5B24D 1M1AC 3B0DB 5BS7C 4NFTA 2PYOA 4JJNC 1ID3B
chains in the Genus database with same CATH topology
5JRGB 1S32B 1M18C 1TZYA 5AV9A 4J8XB 4J8UC 5AY8A 1P3PC 3AYWB 3X1SD 5B2JB 3X1UC 3AFAA 4J8WC 3REIB 1F66D 3MGRB 4XUJB 3LJAC 4Z5TA 4H9SA 5B1MA 1TAFB 5B31A 4KUDB 5FUGB 3NQJA 4CAYB 5BT1C 1KX5C 4WJ3C 5GSUA 5CPJC 2F8NB 4J8VA 5CP6D 5B1LA 2IO5B 3WA9B 3KXBA 5GT0B 5B32B 5AV6B 2NZDC 3UT9B 5G49A 3FDDA 3TU4C 5B0ZB 1F1EA 3LZ0C 4WU8C 3REJB 5E5AB 4R8PD 1ZLAD 1P3GB 3REHA 1P3FB 2Y2NA 3VH5T 5CPIC 1HQ3C 1PZRA 2HIOA 5AV5A 3AZFC 3AZGA 3AN2A 1P3IA 4EO5B 3C1CC 5AV9D 5AY8D 2BYKB 3AFAD 5F99A 4WZSB 2UWXA 5JA4A 5GXQB 1M19B 3AYWA 2XD5A 3NQUB 5B1MD 5B31D 3B0BA 3B0CT 1P3KA 3C1BB 5B2IB 4DQYB 3AZJD 4Z2MG 3WTPC 3KUYB 4J8VD 5B1LD 1TAFA 3AZNB 1KX3A 3AZHD 1P3MA 2F8NA 3WKJB 4X23A 4E44A 2YFWB 3W97B 5B40B 3R45B 5AV6A 3MGPC 3REKB 1KX4A 3REHD 4KGCD 1P34C 5AV5D 2LY8A 3AZGD 3AN2D 1M18A 1P3ID 4H9PB 1A7WA 2Y2LA 3AZKB 2Y2HA 3AZMB 5AV8B 4H9OA 4YM6C 3X1UA 2PYOC 5CPKB 3MVDD 5F99D 1P3OB 5BNXA 1BFMA 1U35B 3AZEB 2BYKA 1TZYC 1KX5A 5AV9C 3MGQA 5AY8C 3F6TA 3X1VD 3AFAC 2CV5C 1KX3D 2RVQD 2Y2KA 4CSRA 3AZIB 4YS3B 4Z5TC 2NZDA 5B24B 3UTBA 1P3BC 5B33A 3W98B 1H3OA 5GSUC 4WU9C 3WKJA 1KX4D 2ZY4A 3KXBC 1M1AD 4UUZB 4JJND 3O62B 1Q9CA 4ZUXB 1M18D 5B32G 4HGAB 4J8UD 2CWEA 1P3PD 2HUEB 2HIOC 3X1UD 3MGSB 4J8WD 4H9PA 1EQZB 3B6GB 5BNVB 3LJAD 3AN2C 5AVCB 3X1TB 2FFFB 5BT1D 5CPKA 1KX5D 1ULYA 3MGQD 1ID3C 5CPJD 3WTPA 4ZBJB 3A6NA 1S32C 1W2EA 5F99C 1ZLAB 4H9NB 4J8XC 1P3LB 2NZDD 2G5HC 3AYWC 4WNNB 3UTBD 4XZQA 2ZY3A 3V9RB 5B33D 1P3KC 3TU4D 2JSSA 2NQBA 4XUJC 3RELB 4WU8D 3UTAB 4KUDC 5CPID 1B6WA 1HQ3D 1P34A 1P3MC 4QLCB 4X23C 3WA9C 5AV6C 3C1CD 4YM6A 1KU5A 2AROA 4H9QA 5E5AC 1P3FC 3AZHB 3B6GA 3VH6W 3WTPD 3WAAB 2CV5A 4E45A 5C3IB 3AV2B 3W99A 4G92C 1P3BA 1B67A 3MGQC 4H9NA 4G91C 4WU9A 5GXQC 3MGPD 2G5IC 1JFIB 5GT3B 3V9RA 3C1BC 3LZ1A 5B2IC 3UTBC 1P34D 5B33C 5AVBB 3W96A 4QLCA 3WKJC 4LD9B 3LELA 3B6FB 4YM6D 3EPJA 2PYOD 2AROD 3X1VB 4Z66B 3MNNB 3H0MC 5DNNB 1TZYD 3B0CW 2F8NK 4NE6A 1BH8B 4H9RB 1ID3A 5JRGA 5BO0B 1S32A 2CV5D 4WV4B 4J8XA 4Z5TD 3W99D 3AV1B 5B2JA 3REIA 1P3BD 1M1AB 5CPKC 3MGRA 4XUJA 5GSUD 4JJNB 5KDMB 5DNMB 1P3OC 3A6NC 4WU9D 4KUDA 5FUGA 4CAYA 3KWQB 3KXBD 3H0RC 4J8UB 3LZ1D 4XZQC 2NQBC 3WA9A 3VH6A 5GT0A 5B32A 3W96D 3UT9A 5B0ZA 5AVBA 2HIOD 3REJA 5E5AA 5CPJB 3P5JB 1P3GA 1P3FA 2RIQA 2FJ7B 3VH5A 4ZUXC 5DNNA 4KHAB 1ID3D 2F8NH 5JRGD 2AROC 3TU4B 2DF4C 1S32D 3LZ0B 1AOIB 4WU8B 3EPLA 4J8XD 5BO0A 3AYWD 2HUEC 5B2JD 1HQ3B 1P3KD 4XUJD 1N1JB 3B6GC 3AZFB 1P3AB 5GXQA 1M19A 5B0YB 3X1TC 3NQUA 2Y2GA 4KUDD 4AWLB 3C1BA 4NE3A 3C1CB 3AZLB 4DRBA 5B2IA 1P3MD 3W99C 3KUYA 2F8ND 4X23D 3AZNA 3KWQA 3WA9D 5GT0D 5AV6D 2Y2JA 3W97A 2YFWA 5B0ZD 5B40A 3R45A 3LZ1C 3RELC 2VQRA 3REJD 5E5AD 3REKA 3X1SB 3UTAC 1P3GD 3W96C 2Y2OA 1P3FD 1F66B 4DRAA 4QLCC 3LELC 4NE5A 3AZKA 5CP6B 3AZMA 5AV8A 3B0DC 1AOIA 1P3OA 5JRGC 1U35A 5GXQD 3AZEA 1M19D 2ZY2A 4R8PB 3C1BD 5B2ID 3KUYD 5B2JC 3WAAC 3REIC 3MGRC 3AZND 2PYOB 3AZIA 4YS3A 3AV2C 5B24A 3WKJD 3W98A 1TZYB 5AV9B 5AY8B 2IO5C 1HTAA 3AFAB 5GT3C 5GT0C 5B32C 4UUZA 1WWSA 3UT9C 1R4VA 3O62A 4Z5TB 4ZUXA 5B1MB 3X1SA 5B0ZC 5AVBC 5B31B 1F66A 3NQJB 3REJC 3AZJB 1P3GC 4J8VB 5B1LB 2XD1A 5AV8D 3KXBB 3MGSA 5CPKD 1EQZA 5G49B 5BNVA 4Z66C 3MNNC 5DNNC 5AVCA 1P3OD 3A6ND 3X1TA 4EO5C 2F2AC 3AZED 3REHB 4KGCB 4XZQD 2NQBD 2HIOB 5AV5B 4R8PA 1ZLAA 1P3LA 1M19C 3AZGB 3AN2B 4WNNA 3AV1C 3VH5W 1P3IB 1T3UA 3W98D 3RELA 5DNMC 3KUYC 2ZY5A 4Z2MH 3UTAA 3AZNC 3KWQC 3MVDB 5F99B 5JA4B 3O62D 4ZUXD 3W97C 5B40C 1P3KB 3REKC 1KX3B 3MGSD 1P3MB 3AZJA 1EQZD 3B6GD 2DQNC 3VH6T 4X23B 5AVCD 2FJ7C 2JE5A 3X1TD 3AZKC 3AZHA 1BH9B 3AZMC 5AV8C 1KX4B 3IP4C 3WAAA 1AOIC 3AV2A 1U35C 1P3LD 3AZEC 4KGCA 1M18B 3RELD 1P3AC 1P3PB 4H9OB 1JFIA 5B0YC 3UTAD 5GT3A 3X1UB 4J8WB 3AZIC 4YS3C 4AWLC 3AZLC 5B24C 3LJAB 5CHLB 4QLCD 5BNXB 1Z2CB 2Y2QA 4G92B 3LELD 3EPKA 2Y2MA 3W98C 1KX5B 3MGQB 3MVDA 4G91B 4LD9A 2W8SA 3B6FA 3EPHA 4CSRB 3O62C 2L5AA 3X1VA 2NZDB 4Z66A 3MNNA 3UTBB 3X1SC 3A1IA 5B33B 1F66C 1H3OB 4HGAC 2J8PA 1BH8A 4H9RA 5CPIB 3A1KA 5B31G 3MGSC 3REID 3WAAD 3MGRD 1EQZC 1BH9A 5CP6C 3AV2D 5AVCC 3AV1A 1M1AA 5BS7A 4JJNA 5KDMA 5DNMA 4ZBJC 2BYMB 5GT3D 4R8PC 5B32D 1ZLAC 1P3LC 4J8UA 3UT9D 1P3PA 5AVBD 4J8WA 3H0LC 4UPKA 3LJAA 3WTPB 3A6NB 4LD9D 3B6FD 5CPJA 2YFVB 4Z66D 3MNND 5DNND 4XZQB 2FJ7A 2NQBB 2BG1A 3KFUG 3MGPB 2JCHA 4H9SC 5B1MC 4KHAA 5B31C 3TU4A 3LZ0A 4WU8A 1P34B 3AZJC 4J8VC 3WTPE 5B1LC 4M6BA 3AV1D 5CPIA 3AZHC 1HQ3A 1N1JA 3AZFA 5DNMD 1P3AA 2F8NG 4YM6B 5B0YA 2AROB 3KSYA 5C3IC 3KWQD 3C1CA 4H9QB 3AZLA 3REHC 4KGCC 2BYMA 3W97D 5AV5C 5B40D 3REKD 3AZGC 2ZM5A 2Y2IA 1P3IC 2CV5B 3W99B 1P3BB 3AL0C 1WWIA 5GSUB 2FJ7D 3MVDC 3AZKD 3AZMD 4WU9B 4LD9C 3B6FC 2YFVA 2Y2PA 3EG5B 3X1VC 3LZ0D 3LZ1B 1AOID 5CP6A 3MGPA 1U35D 1KX3C 2RVQC 3W96B 3AZFD 1P3AD 3LELB 5B0YD 3AZID 4YS3D 1KX4C 3AZLD 5B24D 1M1AC 3B0DB 5BS7C 4NFTA 2PYOA 4JJNC 1ID3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG B;  1S32 B;  1M18 C;  1TZY A;  5AV9 A;  4J8X B;  4J8U C;  5AY8 A;  1P3P C;  3AYW B;  3X1S D;  5B2J B;  3X1U C;  3AFA A;  4J8W C;  3REI B;  1F66 D;  3MGR B;  4XUJ B;  3LJA C;  4Z5T A;  4H9S A;  5B1M A;  1TAF B;  5B31 A;  4KUD B;  5FUG B;  3NQJ A;  4CAY B;  5BT1 C;  1KX5 C;  5GSU A;  5CPJ C;  2F8N B;  4J8V A;  5CP6 D;  5B1L A;  2IO5 B;  3WA9 B;  3KXB A;  5GT0 B;  5B32 B;  5AV6 B;  2NZD C;  3UT9 B;  5G49 A;  3TU4 C;  5B0Z B;  1F1E A;  3LZ0 C;  4WU8 C;  3REJ B;  5E5A B;  4R8P D;  1ZLA D;  1P3G B;  3REH A;  1P3F B;  3VH5 T;  5CPI C;  1HQ3 C;  2HIO A;  5AV5 A;  3AZF C;  3AZG A;  3AN2 A;  1P3I A;  4EO5 B;  3C1C C;  5AV9 D;  5AY8 D;  2BYK B;  3AFA D;  5F99 A;  4WZS B;  5JA4 A;  5GXQ B;  1M19 B;  3AYW A;  3NQU B;  5B1M D;  5B31 D;  3B0B A;  3B0C T;  1P3K A;  3C1B B;  5B2I B;  3AZJ D;  4Z2M G;  3WTP C;  3KUY B;  4J8V D;  5B1L D;  1TAF A;  3AZN B;  1KX3 A;  3AZH D;  1P3M A;  2F8N A;  3WKJ B;  4X23 A;  4E44 A;  2YFW B;  3W97 B;  5B40 B;  3R45 B;  5AV6 A;  3MGP C;  3REK B;  1KX4 A;  3REH D;  4KGC D;  1P34 C;  5AV5 D;  2LY8 A;  3AZG D;  3AN2 D;  1M18 A;  1P3I D;  4H9P B;  1A7W A;  3AZK B;  3AZM B;  5AV8 B;  4H9O A;  4YM6 C;  3X1U A;  2PYO C;  5CPK B;  3MVD D;  5F99 D;  1P3O B;  5BNX A;  1BFM A;  1U35 B;  3AZE B;  2BYK A;  1TZY C;  1KX5 A;  5AV9 C;  3MGQ A;  5AY8 C;  3X1V D;  3AFA C;  2CV5 C;  1KX3 D;  2RVQ D;  4CSR A;  3AZI B;  4YS3 B;  2NZD A;  4Z5T C;  5B24 B;  3UTB A;  1P3B C;  5B33 A;  3W98 B;  1H3O A;  5GSU C;  4WU9 C;  3WKJ A;  1KX4 D;  3KXB C;  1M1A D;  4UUZ B;  4JJN D;  3O62 B;  1Q9C A;  4ZUX B;  1M18 D;  5B32 G;  4HGA B;  4J8U D;  2CWE A;  1P3P D;  2HUE B;  2HIO C;  3X1U D;  3MGS B;  4J8W D;  4H9P A;  1EQZ B;  3B6G B;  5BNV B;  3LJA D;  3AN2 C;  5AVC B;  3X1T B;  5BT1 D;  5CPK A;  1KX5 D;  1ULY A;  3MGQ D;  1ID3 C;  5CPJ D;  3WTP A;  4ZBJ B;  3A6N A;  1S32 C;  5F99 C;  1ZLA B;  4H9N B;  4J8X C;  1P3L B;  2NZD D;  3AYW C;  4WNN B;  3UTB D;  4XZQ A;  5B33 D;  3V9R B;  1P3K C;  2NQB A;  3TU4 D;  2JSS A;  4XUJ C;  3REL B;  4WU8 D;  3UTA B;  4KUD C;  5CPI D;  1B6W A;  1HQ3 D;  1P34 A;  1P3M C;  4QLC B;  4X23 C;  3WA9 C;  5AV6 C;  3C1C D;  4YM6 A;  1KU5 A;  2ARO A;  4H9Q A;  5E5A C;  1P3F C;  3AZH B;  3B6G A;  3VH6 W;  3WTP D;  3WAA B;  2CV5 A;  4E45 A;  5C3I B;  3AV2 B;  3W99 A;  4G92 C;  1P3B A;  1B67 A;  3MGQ C;  4H9N A;  4G91 C;  4WU9 A;  5GXQ C;  3MGP D;  1JFI B;  5GT3 B;  3V9R A;  3C1B C;  3LZ1 A;  5B2I C;  3UTB C;  1P34 D;  5B33 C;  5AVB B;  3W96 A;  4QLC A;  3WKJ C;  4LD9 B;  3LEL A;  3B6F B;  4YM6 D;  2PYO D;  2ARO D;  3X1V B;  4Z66 B;  3MNN B;  5DNN B;  1TZY D;  3B0C W;  2F8N K;  4NE6 A;  1BH8 B;  4H9R B;  1ID3 A;  5JRG A;  5BO0 B;  1S32 A;  2CV5 D;  4WV4 B;  4J8X A;  4Z5T D;  3W99 D;  3AV1 B;  5B2J A;  3REI A;  1P3B D;  1M1A B;  5CPK C;  3MGR A;  4XUJ A;  5GSU D;  4JJN B;  5KDM B;  5DNM B;  1P3O C;  3A6N C;  4WU9 D;  4KUD A;  5FUG A;  4CAY A;  3KWQ B;  3KXB D;  4J8U B;  3LZ1 D;  4XZQ C;  2NQB C;  3WA9 A;  3VH6 A;  5GT0 A;  5B32 A;  3W96 D;  3UT9 A;  5B0Z A;  5AVB A;  2HIO D;  3REJ A;  5E5A A;  5CPJ B;  1P3G A;  1P3F A;  2FJ7 B;  3VH5 A;  4ZUX C;  5DNN A;  4KHA B;  1ID3 D;  2F8N H;  5JRG D;  2ARO C;  3TU4 B;  1S32 D;  3LZ0 B;  1AOI B;  4WU8 B;  4J8X D;  5BO0 A;  3AYW D;  2HUE C;  5B2J D;  1HQ3 B;  1P3K D;  4XUJ D;  1N1J B;  3B6G C;  3AZF B;  1P3A B;  5GXQ A;  1M19 A;  5B0Y B;  3X1T C;  3NQU A;  4KUD D;  4AWL B;  3C1B A;  4NE3 A;  3C1C B;  3AZL B;  4DRB A;  5B2I A;  1P3M D;  3W99 C;  3KUY A;  2F8N D;  4X23 D;  3AZN A;  3KWQ A;  3WA9 D;  5GT0 D;  5AV6 D;  3W97 A;  2YFW A;  5B0Z D;  5B40 A;  3R45 A;  3LZ1 C;  3REL C;  3REJ D;  5E5A D;  3REK A;  3X1S B;  3UTA C;  1P3G D;  3W96 C;  1P3F D;  1F66 B;  4DRA A;  4QLC C;  3LEL C;  4NE5 A;  3AZK A;  5CP6 B;  3AZM A;  5AV8 A;  3B0D C;  1AOI A;  1P3O A;  5JRG C;  1U35 A;  5GXQ D;  3AZE A;  1M19 D;  4R8P B;  3C1B D;  5B2I D;  3KUY D;  5B2J C;  3WAA C;  3REI C;  3MGR C;  3AZN D;  2PYO B;  3AZI A;  4YS3 A;  3AV2 C;  5B24 A;  3WKJ D;  3W98 A;  1TZY B;  5AV9 B;  5AY8 B;  2IO5 C;  1HTA A;  3AFA B;  5GT3 C;  5GT0 C;  5B32 C;  4UUZ A;  1WWS A;  3UT9 C;  1R4V A;  3O62 A;  4Z5T B;  4ZUX A;  5B1M B;  3X1S A;  5B0Z C;  5AVB C;  5B31 B;  1F66 A;  3NQJ B;  3REJ C;  3AZJ B;  1P3G C;  4J8V B;  5B1L B;  5AV8 D;  3KXB B;  3MGS A;  5CPK D;  1EQZ A;  5G49 B;  5BNV A;  4Z66 C;  3MNN C;  5DNN C;  5AVC A;  1P3O D;  3A6N D;  3X1T A;  4EO5 C;  3AZE D;  3REH B;  4KGC B;  4XZQ D;  2NQB D;  2HIO B;  5AV5 B;  4R8P A;  1ZLA A;  1P3L A;  1M19 C;  3AZG B;  3AN2 B;  4WNN A;  3AV1 C;  3VH5 W;  1P3I B;  3W98 D;  3REL A;  5DNM C;  3KUY C;  4Z2M H;  3UTA A;  3AZN C;  3KWQ C;  3MVD B;  5F99 B;  5JA4 B;  3O62 D;  4ZUX D;  3W97 C;  5B40 C;  1P3K B;  3REK C;  1KX3 B;  3MGS D;  1P3M B;  3AZJ A;  1EQZ D;  3B6G D;  3VH6 T;  4X23 B;  5AVC D;  2FJ7 C;  3X1T D;  3AZK C;  3AZH A;  1BH9 B;  3AZM C;  5AV8 C;  1KX4 B;  3WAA A;  1AOI C;  3AV2 A;  1U35 C;  1P3L D;  3AZE C;  4KGC A;  1M18 B;  3REL D;  1P3A C;  1P3P B;  4H9O B;  1JFI A;  5B0Y C;  3UTA D;  5GT3 A;  3X1U B;  4J8W B;  3AZI C;  4YS3 C;  4AWL C;  3AZL C;  5B24 C;  3LJA B;  5CHL B;  4QLC D;  5BNX B;  4G92 B;  3LEL D;  3W98 C;  1KX5 B;  3MGQ B;  3MVD A;  4G91 B;  4LD9 A;  3B6F A;  4CSR B;  3O62 C;  2L5A A;  3X1V A;  2NZD B;  4Z66 A;  3MNN A;  3UTB B;  3X1S C;  5B33 B;  1F66 C;  1H3O B;  4HGA C;  1BH8 A;  4H9R A;  5CPI B;  5B31 G;  3REI D;  3MGS C;  3WAA D;  3MGR D;  1EQZ C;  1BH9 A;  5CP6 C;  3AV2 D;  5AVC C;  3AV1 A;  1M1A A;  5BS7 A;  4JJN A;  5KDM A;  5DNM A;  4ZBJ C;  2BYM B;  5GT3 D;  4R8P C;  5B32 D;  1ZLA C;  1P3L C;  4J8U A;  3UT9 D;  1P3P A;  5AVB D;  4J8W A;  3LJA A;  3WTP B;  3A6N B;  4LD9 D;  3B6F D;  5CPJ A;  2YFV B;  4Z66 D;  3MNN D;  5DNN D;  4XZQ B;  2FJ7 A;  2NQB B;  3MGP B;  4H9S C;  5B1M C;  4KHA A;  5B31 C;  3TU4 A;  3LZ0 A;  4WU8 A;  1P34 B;  3AZJ C;  4J8V C;  3WTP E;  5B1L C;  4M6B A;  3AV1 D;  5CPI A;  3AZH C;  1HQ3 A;  1N1J A;  3AZF A;  5DNM D;  1P3A A;  2F8N G;  4YM6 B;  5B0Y A;  2ARO B;  3KSY A;  5C3I C;  3KWQ D;  3C1C A;  4H9Q B;  3AZL A;  3REH C;  4KGC C;  2BYM A;  3W97 D;  5AV5 C;  5B40 D;  3REK D;  3AZG C;  1P3I C;  2CV5 B;  3W99 B;  1P3B B;  1WWI A;  5GSU B;  2FJ7 D;  3MVD C;  3AZK D;  3AZM D;  4WU9 B;  4LD9 C;  3B6F C;  2YFV A;  3X1V C;  3LZ0 D;  3LZ1 B;  1AOI D;  5CP6 A;  3MGP A;  1U35 D;  1KX3 C;  2RVQ C;  3W96 B;  3AZF D;  1P3A D;  3LEL B;  5B0Y D;  3AZI D;  4YS3 D;  1KX4 C;  3AZL D;  5B24 D;  1M1A C;  3B0D B;  5BS7 C;  4NFT A;  2PYO A;  4JJN C;  1ID3 B; 
#chains in the Genus database with same CATH topology
 5JRG B;  1S32 B;  1M18 C;  1TZY A;  5AV9 A;  4J8X B;  4J8U C;  5AY8 A;  1P3P C;  3AYW B;  3X1S D;  5B2J B;  3X1U C;  3AFA A;  4J8W C;  3REI B;  1F66 D;  3MGR B;  4XUJ B;  3LJA C;  4Z5T A;  4H9S A;  5B1M A;  1TAF B;  5B31 A;  4KUD B;  5FUG B;  3NQJ A;  4CAY B;  5BT1 C;  1KX5 C;  4WJ3 C;  5GSU A;  5CPJ C;  2F8N B;  4J8V A;  5CP6 D;  5B1L A;  2IO5 B;  3WA9 B;  3KXB A;  5GT0 B;  5B32 B;  5AV6 B;  2NZD C;  3UT9 B;  5G49 A;  3FDD A;  3TU4 C;  5B0Z B;  1F1E A;  3LZ0 C;  4WU8 C;  3REJ B;  5E5A B;  4R8P D;  1ZLA D;  1P3G B;  3REH A;  1P3F B;  2Y2N A;  3VH5 T;  5CPI C;  1HQ3 C;  1PZR A;  2HIO A;  5AV5 A;  3AZF C;  3AZG A;  3AN2 A;  1P3I A;  4EO5 B;  3C1C C;  5AV9 D;  5AY8 D;  2BYK B;  3AFA D;  5F99 A;  4WZS B;  2UWX A;  5JA4 A;  5GXQ B;  1M19 B;  3AYW A;  2XD5 A;  3NQU B;  5B1M D;  5B31 D;  3B0B A;  3B0C T;  1P3K A;  3C1B B;  5B2I B;  4DQY B;  3AZJ D;  4Z2M G;  3WTP C;  3KUY B;  4J8V D;  5B1L D;  1TAF A;  3AZN B;  1KX3 A;  3AZH D;  1P3M A;  2F8N A;  3WKJ B;  4X23 A;  4E44 A;  2YFW B;  3W97 B;  5B40 B;  3R45 B;  5AV6 A;  3MGP C;  3REK B;  1KX4 A;  3REH D;  4KGC D;  1P34 C;  5AV5 D;  2LY8 A;  3AZG D;  3AN2 D;  1M18 A;  1P3I D;  4H9P B;  1A7W A;  2Y2L A;  3AZK B;  2Y2H A;  3AZM B;  5AV8 B;  4H9O A;  4YM6 C;  3X1U A;  2PYO C;  5CPK B;  3MVD D;  5F99 D;  1P3O B;  5BNX A;  1BFM A;  1U35 B;  3AZE B;  2BYK A;  1TZY C;  1KX5 A;  5AV9 C;  3MGQ A;  5AY8 C;  3F6T A;  3X1V D;  3AFA C;  2CV5 C;  1KX3 D;  2RVQ D;  2Y2K A;  4CSR A;  3AZI B;  4YS3 B;  4Z5T C;  2NZD A;  5B24 B;  3UTB A;  1P3B C;  5B33 A;  3W98 B;  1H3O A;  5GSU C;  4WU9 C;  3WKJ A;  1KX4 D;  2ZY4 A;  3KXB C;  1M1A D;  4UUZ B;  4JJN D;  3O62 B;  1Q9C A;  4ZUX B;  1M18 D;  5B32 G;  4HGA B;  4J8U D;  2CWE A;  1P3P D;  2HUE B;  2HIO C;  3X1U D;  3MGS B;  4J8W D;  4H9P A;  1EQZ B;  3B6G B;  5BNV B;  3LJA D;  3AN2 C;  5AVC B;  3X1T B;  2FFF B;  5BT1 D;  5CPK A;  1KX5 D;  1ULY A;  3MGQ D;  1ID3 C;  5CPJ D;  3WTP A;  4ZBJ B;  3A6N A;  1S32 C;  1W2E A;  5F99 C;  1ZLA B;  4H9N B;  4J8X C;  1P3L B;  2NZD D;  2G5H C;  3AYW C;  4WNN B;  3UTB D;  4XZQ A;  2ZY3 A;  3V9R B;  5B33 D;  1P3K C;  3TU4 D;  2JSS A;  2NQB A;  4XUJ C;  3REL B;  4WU8 D;  3UTA B;  4KUD C;  5CPI D;  1B6W A;  1HQ3 D;  1P34 A;  1P3M C;  4QLC B;  4X23 C;  3WA9 C;  5AV6 C;  3C1C D;  4YM6 A;  1KU5 A;  2ARO A;  4H9Q A;  5E5A C;  1P3F C;  3AZH B;  3B6G A;  3VH6 W;  3WTP D;  3WAA B;  2CV5 A;  4E45 A;  5C3I B;  3AV2 B;  3W99 A;  4G92 C;  1P3B A;  1B67 A;  3MGQ C;  4H9N A;  4G91 C;  4WU9 A;  5GXQ C;  3MGP D;  2G5I C;  1JFI B;  5GT3 B;  3V9R A;  3C1B C;  3LZ1 A;  5B2I C;  3UTB C;  1P34 D;  5B33 C;  5AVB B;  3W96 A;  4QLC A;  3WKJ C;  4LD9 B;  3LEL A;  3B6F B;  4YM6 D;  3EPJ A;  2PYO D;  2ARO D;  3X1V B;  4Z66 B;  3MNN B;  3H0M C;  5DNN B;  1TZY D;  3B0C W;  2F8N K;  4NE6 A;  1BH8 B;  4H9R B;  1ID3 A;  5JRG A;  5BO0 B;  1S32 A;  2CV5 D;  4WV4 B;  4J8X A;  4Z5T D;  3W99 D;  3AV1 B;  5B2J A;  3REI A;  1P3B D;  1M1A B;  5CPK C;  3MGR A;  4XUJ A;  5GSU D;  4JJN B;  5KDM B;  5DNM B;  1P3O C;  3A6N C;  4WU9 D;  4KUD A;  5FUG A;  4CAY A;  3KWQ B;  3KXB D;  3H0R C;  4J8U B;  3LZ1 D;  4XZQ C;  2NQB C;  3WA9 A;  3VH6 A;  5GT0 A;  5B32 A;  3W96 D;  3UT9 A;  5B0Z A;  5AVB A;  2HIO D;  3REJ A;  5E5A A;  5CPJ B;  3P5J B;  1P3G A;  1P3F A;  2RIQ A;  2FJ7 B;  3VH5 A;  4ZUX C;  5DNN A;  4KHA B;  1ID3 D;  2F8N H;  5JRG D;  2ARO C;  3TU4 B;  2DF4 C;  1S32 D;  3LZ0 B;  1AOI B;  4WU8 B;  3EPL A;  4J8X D;  5BO0 A;  3AYW D;  2HUE C;  5B2J D;  1HQ3 B;  1P3K D;  4XUJ D;  1N1J B;  3B6G C;  3AZF B;  1P3A B;  5GXQ A;  1M19 A;  5B0Y B;  3X1T C;  3NQU A;  2Y2G A;  4KUD D;  4AWL B;  3C1B A;  4NE3 A;  3C1C B;  3AZL B;  4DRB A;  5B2I A;  1P3M D;  3W99 C;  3KUY A;  2F8N D;  4X23 D;  3AZN A;  3KWQ A;  3WA9 D;  5GT0 D;  5AV6 D;  2Y2J A;  3W97 A;  2YFW A;  5B0Z D;  5B40 A;  3R45 A;  3LZ1 C;  3REL C;  2VQR A;  3REJ D;  5E5A D;  3REK A;  3X1S B;  3UTA C;  1P3G D;  3W96 C;  2Y2O A;  1P3F D;  1F66 B;  4DRA A;  4QLC C;  3LEL C;  4NE5 A;  3AZK A;  5CP6 B;  3AZM A;  5AV8 A;  3B0D C;  1AOI A;  1P3O A;  5JRG C;  1U35 A;  5GXQ D;  3AZE A;  1M19 D;  2ZY2 A;  4R8P B;  3C1B D;  5B2I D;  3KUY D;  5B2J C;  3WAA C;  3REI C;  3MGR C;  3AZN D;  2PYO B;  3AZI A;  4YS3 A;  3AV2 C;  5B24 A;  3WKJ D;  3W98 A;  1TZY B;  5AV9 B;  5AY8 B;  2IO5 C;  1HTA A;  3AFA B;  5GT3 C;  5GT0 C;  5B32 C;  4UUZ A;  1WWS A;  3UT9 C;  1R4V A;  3O62 A;  4Z5T B;  4ZUX A;  5B1M B;  3X1S A;  5B0Z C;  5AVB C;  5B31 B;  1F66 A;  3NQJ B;  3REJ C;  3AZJ B;  1P3G C;  4J8V B;  5B1L B;  2XD1 A;  5AV8 D;  3KXB B;  3MGS A;  5CPK D;  1EQZ A;  5G49 B;  5BNV A;  4Z66 C;  3MNN C;  5DNN C;  5AVC A;  1P3O D;  3A6N D;  3X1T A;  4EO5 C;  2F2A C;  3AZE D;  3REH B;  4KGC B;  4XZQ D;  2NQB D;  2HIO B;  5AV5 B;  4R8P A;  1ZLA A;  1P3L A;  1M19 C;  3AZG B;  3AN2 B;  4WNN A;  3AV1 C;  3VH5 W;  1P3I B;  1T3U A;  3W98 D;  3REL A;  5DNM C;  3KUY C;  2ZY5 A;  4Z2M H;  3UTA A;  3AZN C;  3KWQ C;  3MVD B;  5F99 B;  5JA4 B;  3O62 D;  4ZUX D;  3W97 C;  5B40 C;  1P3K B;  3REK C;  1KX3 B;  3MGS D;  1P3M B;  3AZJ A;  1EQZ D;  3B6G D;  2DQN C;  3VH6 T;  4X23 B;  5AVC D;  2FJ7 C;  2JE5 A;  3X1T D;  3AZK C;  3AZH A;  1BH9 B;  3AZM C;  5AV8 C;  1KX4 B;  3IP4 C;  3WAA A;  1AOI C;  3AV2 A;  1U35 C;  1P3L D;  3AZE C;  4KGC A;  1M18 B;  3REL D;  1P3A C;  1P3P B;  4H9O B;  1JFI A;  5B0Y C;  3UTA D;  5GT3 A;  3X1U B;  4J8W B;  3AZI C;  4YS3 C;  4AWL C;  3AZL C;  5B24 C;  3LJA B;  5CHL B;  4QLC D;  5BNX B;  1Z2C B;  2Y2Q A;  4G92 B;  3LEL D;  3EPK A;  2Y2M A;  3W98 C;  1KX5 B;  3MGQ B;  3MVD A;  4G91 B;  4LD9 A;  2W8S A;  3B6F A;  3EPH A;  4CSR B;  3O62 C;  2L5A A;  3X1V A;  2NZD B;  4Z66 A;  3MNN A;  3UTB B;  3X1S C;  3A1I A;  5B33 B;  1F66 C;  1H3O B;  4HGA C;  2J8P A;  1BH8 A;  4H9R A;  5CPI B;  3A1K A;  5B31 G;  3MGS C;  3REI D;  3WAA D;  3MGR D;  1EQZ C;  1BH9 A;  5CP6 C;  3AV2 D;  5AVC C;  3AV1 A;  1M1A A;  5BS7 A;  4JJN A;  5KDM A;  5DNM A;  4ZBJ C;  2BYM B;  5GT3 D;  4R8P C;  5B32 D;  1ZLA C;  1P3L C;  4J8U A;  3UT9 D;  1P3P A;  5AVB D;  4J8W A;  3H0L C;  4UPK A;  3LJA A;  3WTP B;  3A6N B;  4LD9 D;  3B6F D;  5CPJ A;  2YFV B;  4Z66 D;  3MNN D;  5DNN D;  4XZQ B;  2FJ7 A;  2NQB B;  2BG1 A;  3KFU G;  3MGP B;  2JCH A;  4H9S C;  5B1M C;  4KHA A;  5B31 C;  3TU4 A;  3LZ0 A;  4WU8 A;  1P34 B;  3AZJ C;  4J8V C;  3WTP E;  5B1L C;  4M6B A;  3AV1 D;  5CPI A;  3AZH C;  1HQ3 A;  1N1J A;  3AZF A;  5DNM D;  1P3A A;  2F8N G;  4YM6 B;  5B0Y A;  2ARO B;  3KSY A;  5C3I C;  3KWQ D;  3C1C A;  4H9Q B;  3AZL A;  3REH C;  4KGC C;  2BYM A;  3W97 D;  5AV5 C;  5B40 D;  3REK D;  3AZG C;  2ZM5 A;  2Y2I A;  1P3I C;  2CV5 B;  3W99 B;  1P3B B;  3AL0 C;  1WWI A;  5GSU B;  2FJ7 D;  3MVD C;  3AZK D;  3AZM D;  4WU9 B;  4LD9 C;  3B6F C;  2YFV A;  2Y2P A;  3EG5 B;  3X1V C;  3LZ0 D;  3LZ1 B;  1AOI D;  5CP6 A;  3MGP A;  1U35 D;  1KX3 C;  2RVQ C;  3W96 B;  3AZF D;  1P3A D;  3LEL B;  5B0Y D;  3AZI D;  4YS3 D;  1KX4 C;  3AZL D;  5B24 D;  1M1A C;  3B0D B;  5BS7 C;  4NFT A;  2PYO A;  4JJN C;  1ID3 B; 
#chains in the Genus database with same CATH homology
 5JRG B;  1S32 B;  1M18 C;  1TZY A;  5AV9 A;  4J8X B;  4J8U C;  5AY8 A;  1P3P C;  3AYW B;  3X1S D;  5B2J B;  3X1U C;  3AFA A;  4J8W C;  3REI B;  1F66 D;  3MGR B;  4XUJ B;  3LJA C;  4Z5T A;  4H9S A;  5B1M A;  1TAF B;  5B31 A;  4KUD B;  5FUG B;  3NQJ A;  4CAY B;  5BT1 C;  1KX5 C;  4WJ3 C;  5GSU A;  5CPJ C;  2F8N B;  4J8V A;  5CP6 D;  5B1L A;  2IO5 B;  3WA9 B;  3KXB A;  5GT0 B;  5B32 B;  5AV6 B;  2NZD C;  3UT9 B;  5G49 A;  3FDD A;  3TU4 C;  5B0Z B;  1F1E A;  3LZ0 C;  4WU8 C;  3REJ B;  5E5A B;  4R8P D;  1ZLA D;  1P3G B;  3REH A;  1P3F B;  2Y2N A;  3VH5 T;  5CPI C;  1HQ3 C;  1PZR A;  2HIO A;  5AV5 A;  3AZF C;  3AZG A;  3AN2 A;  1P3I A;  4EO5 B;  3C1C C;  5AV9 D;  5AY8 D;  2BYK B;  3AFA D;  5F99 A;  4WZS B;  2UWX A;  5JA4 A;  5GXQ B;  1M19 B;  3AYW A;  2XD5 A;  3NQU B;  5B1M D;  5B31 D;  3B0B A;  3B0C T;  1P3K A;  3C1B B;  5B2I B;  4DQY B;  3AZJ D;  4Z2M G;  3WTP C;  3KUY B;  4J8V D;  5B1L D;  1TAF A;  3AZN B;  1KX3 A;  3AZH D;  1P3M A;  2F8N A;  3WKJ B;  4X23 A;  4E44 A;  2YFW B;  3W97 B;  5B40 B;  3R45 B;  5AV6 A;  3MGP C;  3REK B;  1KX4 A;  3REH D;  4KGC D;  1P34 C;  5AV5 D;  2LY8 A;  3AZG D;  3AN2 D;  1M18 A;  1P3I D;  4H9P B;  1A7W A;  2Y2L A;  3AZK B;  2Y2H A;  3AZM B;  5AV8 B;  4H9O A;  4YM6 C;  3X1U A;  2PYO C;  5CPK B;  3MVD D;  5F99 D;  1P3O B;  5BNX A;  1BFM A;  1U35 B;  3AZE B;  2BYK A;  1TZY C;  1KX5 A;  5AV9 C;  3MGQ A;  5AY8 C;  3F6T A;  3X1V D;  3AFA C;  2CV5 C;  1KX3 D;  2RVQ D;  2Y2K A;  4CSR A;  3AZI B;  4YS3 B;  4Z5T C;  2NZD A;  5B24 B;  3UTB A;  1P3B C;  5B33 A;  3W98 B;  1H3O A;  5GSU C;  4WU9 C;  3WKJ A;  1KX4 D;  2ZY4 A;  3KXB C;  1M1A D;  4UUZ B;  4JJN D;  3O62 B;  1Q9C A;  4ZUX B;  1M18 D;  5B32 G;  4HGA B;  4J8U D;  2CWE A;  1P3P D;  2HUE B;  2HIO C;  3X1U D;  3MGS B;  4J8W D;  4H9P A;  1EQZ B;  3B6G B;  5BNV B;  3LJA D;  3AN2 C;  5AVC B;  3X1T B;  2FFF B;  5BT1 D;  5CPK A;  1KX5 D;  1ULY A;  3MGQ D;  1ID3 C;  5CPJ D;  3WTP A;  4ZBJ B;  3A6N A;  1S32 C;  1W2E A;  5F99 C;  1ZLA B;  4H9N B;  4J8X C;  1P3L B;  2NZD D;  2G5H C;  3AYW C;  4WNN B;  3UTB D;  4XZQ A;  2ZY3 A;  3V9R B;  5B33 D;  1P3K C;  3TU4 D;  2JSS A;  2NQB A;  4XUJ C;  3REL B;  4WU8 D;  3UTA B;  4KUD C;  5CPI D;  1B6W A;  1HQ3 D;  1P34 A;  1P3M C;  4QLC B;  4X23 C;  3WA9 C;  5AV6 C;  3C1C D;  4YM6 A;  1KU5 A;  2ARO A;  4H9Q A;  5E5A C;  1P3F C;  3AZH B;  3B6G A;  3VH6 W;  3WTP D;  3WAA B;  2CV5 A;  4E45 A;  5C3I B;  3AV2 B;  3W99 A;  4G92 C;  1P3B A;  1B67 A;  3MGQ C;  4H9N A;  4G91 C;  4WU9 A;  5GXQ C;  3MGP D;  2G5I C;  1JFI B;  5GT3 B;  3V9R A;  3C1B C;  3LZ1 A;  5B2I C;  3UTB C;  1P34 D;  5B33 C;  5AVB B;  3W96 A;  4QLC A;  3WKJ C;  4LD9 B;  3LEL A;  3B6F B;  4YM6 D;  3EPJ A;  2PYO D;  2ARO D;  3X1V B;  4Z66 B;  3MNN B;  3H0M C;  5DNN B;  1TZY D;  3B0C W;  2F8N K;  4NE6 A;  1BH8 B;  4H9R B;  1ID3 A;  5JRG A;  5BO0 B;  1S32 A;  2CV5 D;  4WV4 B;  4J8X A;  4Z5T D;  3W99 D;  3AV1 B;  5B2J A;  3REI A;  1P3B D;  1M1A B;  5CPK C;  3MGR A;  4XUJ A;  5GSU D;  4JJN B;  5KDM B;  5DNM B;  1P3O C;  3A6N C;  4WU9 D;  4KUD A;  5FUG A;  4CAY A;  3KWQ B;  3KXB D;  3H0R C;  4J8U B;  3LZ1 D;  4XZQ C;  2NQB C;  3WA9 A;  3VH6 A;  5GT0 A;  5B32 A;  3W96 D;  3UT9 A;  5B0Z A;  5AVB A;  2HIO D;  3REJ A;  5E5A A;  5CPJ B;  3P5J B;  1P3G A;  1P3F A;  2RIQ A;  2FJ7 B;  3VH5 A;  4ZUX C;  5DNN A;  4KHA B;  1ID3 D;  2F8N H;  5JRG D;  2ARO C;  3TU4 B;  2DF4 C;  1S32 D;  3LZ0 B;  1AOI B;  4WU8 B;  3EPL A;  4J8X D;  5BO0 A;  3AYW D;  2HUE C;  5B2J D;  1HQ3 B;  1P3K D;  4XUJ D;  1N1J B;  3B6G C;  3AZF B;  1P3A B;  5GXQ A;  1M19 A;  5B0Y B;  3X1T C;  3NQU A;  2Y2G A;  4KUD D;  4AWL B;  3C1B A;  4NE3 A;  3C1C B;  3AZL B;  4DRB A;  5B2I A;  1P3M D;  3W99 C;  3KUY A;  2F8N D;  4X23 D;  3AZN A;  3KWQ A;  3WA9 D;  5GT0 D;  5AV6 D;  2Y2J A;  3W97 A;  2YFW A;  5B0Z D;  5B40 A;  3R45 A;  3LZ1 C;  3REL C;  2VQR A;  3REJ D;  5E5A D;  3REK A;  3X1S B;  3UTA C;  1P3G D;  3W96 C;  2Y2O A;  1P3F D;  1F66 B;  4DRA A;  4QLC C;  3LEL C;  4NE5 A;  3AZK A;  5CP6 B;  3AZM A;  5AV8 A;  3B0D C;  1AOI A;  1P3O A;  5JRG C;  1U35 A;  5GXQ D;  3AZE A;  1M19 D;  2ZY2 A;  4R8P B;  3C1B D;  5B2I D;  3KUY D;  5B2J C;  3WAA C;  3REI C;  3MGR C;  3AZN D;  2PYO B;  3AZI A;  4YS3 A;  3AV2 C;  5B24 A;  3WKJ D;  3W98 A;  1TZY B;  5AV9 B;  5AY8 B;  2IO5 C;  1HTA A;  3AFA B;  5GT3 C;  5GT0 C;  5B32 C;  4UUZ A;  1WWS A;  3UT9 C;  1R4V A;  3O62 A;  4Z5T B;  4ZUX A;  5B1M B;  3X1S A;  5B0Z C;  5AVB C;  5B31 B;  1F66 A;  3NQJ B;  3REJ C;  3AZJ B;  1P3G C;  4J8V B;  5B1L B;  2XD1 A;  5AV8 D;  3KXB B;  3MGS A;  5CPK D;  1EQZ A;  5G49 B;  5BNV A;  4Z66 C;  3MNN C;  5DNN C;  5AVC A;  1P3O D;  3A6N D;  3X1T A;  4EO5 C;  2F2A C;  3AZE D;  3REH B;  4KGC B;  4XZQ D;  2NQB D;  2HIO B;  5AV5 B;  4R8P A;  1ZLA A;  1P3L A;  1M19 C;  3AZG B;  3AN2 B;  4WNN A;  3AV1 C;  3VH5 W;  1P3I B;  1T3U A;  3W98 D;  3REL A;  5DNM C;  3KUY C;  2ZY5 A;  4Z2M H;  3UTA A;  3AZN C;  3KWQ C;  3MVD B;  5F99 B;  5JA4 B;  3O62 D;  4ZUX D;  3W97 C;  5B40 C;  1P3K B;  3REK C;  1KX3 B;  3MGS D;  1P3M B;  3AZJ A;  1EQZ D;  3B6G D;  2DQN C;  3VH6 T;  4X23 B;  5AVC D;  2FJ7 C;  2JE5 A;  3X1T D;  3AZK C;  3AZH A;  1BH9 B;  3AZM C;  5AV8 C;  1KX4 B;  3IP4 C;  3WAA A;  1AOI C;  3AV2 A;  1U35 C;  1P3L D;  3AZE C;  4KGC A;  1M18 B;  3REL D;  1P3A C;  1P3P B;  4H9O B;  1JFI A;  5B0Y C;  3UTA D;  5GT3 A;  3X1U B;  4J8W B;  3AZI C;  4YS3 C;  4AWL C;  3AZL C;  5B24 C;  3LJA B;  5CHL B;  4QLC D;  5BNX B;  1Z2C B;  2Y2Q A;  4G92 B;  3LEL D;  3EPK A;  2Y2M A;  3W98 C;  1KX5 B;  3MGQ B;  3MVD A;  4G91 B;  4LD9 A;  2W8S A;  3B6F A;  3EPH A;  4CSR B;  3O62 C;  2L5A A;  3X1V A;  2NZD B;  4Z66 A;  3MNN A;  3UTB B;  3X1S C;  3A1I A;  5B33 B;  1F66 C;  1H3O B;  4HGA C;  2J8P A;  1BH8 A;  4H9R A;  5CPI B;  3A1K A;  5B31 G;  3MGS C;  3REI D;  3WAA D;  3MGR D;  1EQZ C;  1BH9 A;  5CP6 C;  3AV2 D;  5AVC C;  3AV1 A;  1M1A A;  5BS7 A;  4JJN A;  5KDM A;  5DNM A;  4ZBJ C;  2BYM B;  5GT3 D;  4R8P C;  5B32 D;  1ZLA C;  1P3L C;  4J8U A;  3UT9 D;  1P3P A;  5AVB D;  4J8W A;  3H0L C;  4UPK A;  3LJA A;  3WTP B;  3A6N B;  4LD9 D;  3B6F D;  5CPJ A;  2YFV B;  4Z66 D;  3MNN D;  5DNN D;  4XZQ B;  2FJ7 A;  2NQB B;  2BG1 A;  3KFU G;  3MGP B;  2JCH A;  4H9S C;  5B1M C;  4KHA A;  5B31 C;  3TU4 A;  3LZ0 A;  4WU8 A;  1P34 B;  3AZJ C;  4J8V C;  3WTP E;  5B1L C;  4M6B A;  3AV1 D;  5CPI A;  3AZH C;  1HQ3 A;  1N1J A;  3AZF A;  5DNM D;  1P3A A;  2F8N G;  4YM6 B;  5B0Y A;  2ARO B;  3KSY A;  5C3I C;  3KWQ D;  3C1C A;  4H9Q B;  3AZL A;  3REH C;  4KGC C;  2BYM A;  3W97 D;  5AV5 C;  5B40 D;  3REK D;  3AZG C;  2ZM5 A;  2Y2I A;  1P3I C;  2CV5 B;  3W99 B;  1P3B B;  3AL0 C;  1WWI A;  5GSU B;  2FJ7 D;  3MVD C;  3AZK D;  3AZM D;  4WU9 B;  4LD9 C;  3B6F C;  2YFV A;  2Y2P A;  3EG5 B;  3X1V C;  3LZ0 D;  3LZ1 B;  1AOI D;  5CP6 A;  3MGP A;  1U35 D;  1KX3 C;  2RVQ C;  3W96 B;  3AZF D;  1P3A D;  3LEL B;  5B0Y D;  3AZI D;  4YS3 D;  1KX4 C;  3AZL D;  5B24 D;  1M1A C;  3B0D B;  5BS7 C;  4NFT A;  2PYO A;  4JJN C;  1ID3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...