5B32B

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32B00
4J8WB 5AV6B 5C3IB 5JRGD 2CV5B 3KWQD 2HUEB 3REHD 3REKD 5B24D 4Z5TA 3X1SB 2F8NG 5B31D 5JA4B 5BS7A 4ZUXC 4AWLB 3AV1D 4X23B 3WA9D 1M18D 2HIOC 3AZIA 5AY8C 3A6NB 1F1EA 3R45A 5KDMB 4KGCB 1BH9A 3B0DB 1N1JB 3C1CC 3MVDA 3AFAD 5AVCA 1P3FD 3C1BD 5B0YA 4DRAA 3MGPD 1P3MA 1P3GC 4YS3B 4NE3A 5AVBC 3REJD 3WTPD 3WKJA 1JFIA 5B1LA 2IO5C 1BH8A 3KUYC 1ID3C 1P3BB 1BFMA 4YM6C 3B0BA 1ULYA 2LY8A 5AV5C 3AZMA 4EO5B 3LJAC 4Z5TD 3REIB 5JA4A 2PYOC 1ZLAA 5BNVB 3AZGA 3X1UA 4X23A 3AV2C 5DNNB 2NZDC 5F99B 5DNMC 3LZ1A 3B6GC 3AZID 1M19A 3UTBC 1F66A 1KX5A 5CP6A 3NQJA 3RELC 3NQUA 4LD9A 4J8XC 3MVDD 5B2JB 5AV8C 2IO5B 5BNXA 5AVCD 4J8UB 5CPKC 3X1VC 3B6FC 5B0YD 1P3MD 4YM6B 3VH5T 3LELB 1P3LC 3WKJD 1KX4C 5B1LD 4ZUXA 2PYOB 1EQZC 2F8NB 2NZDB 2HIOA 4XUJC 3AZJC 4UUZB 3UTBB 3AZMD 5AY8A 3LZ0B 3RELB 5B40B 1ZLAD 5E5AC 3C1CA 3X1UD 3AZGD 4X23D 1P3KC 1TAFA 2L5AA 3LZ1D 3VH5A 3TU4C 1M19D 1P3GA 1F66D 1HTAA 5AVBA 3KSYA 1KX5D 3MGRB 1B6WA 5CP6D 1KX4B 3WAAC 3AN2C 4LD9D 3VH6W 1M1AC 1H3OB 4G91B 3KUYA 1ID3A 3W96B 3MNNB 4E44A 3AZJB 5AV5A 5B1MC 2FJ7B 4ZBJC 3LJAA 4ZUXD 5GXQA 2PYOA 4R8PC 5E5AB 3AYWC 3AV2A 2F8NA 2HIOD 5DNMA 3B6GA 3W99C 4J8WC 5AV6C 2NQBB 5AY8D 5C3IC 4H9NA 2CV5C 2HUEC 4XZQB 4J8VB 3AZEB 3WAAB 3C1CD 3AN2B 3X1SC 2YFWA 4J8XA 1M1AB 5AV8A 4E45A 3MGQB 4AWLC 3AZHB 5CPKA 3AZFB 3X1VA 3B6FA 5B33B 1P3GD 5AVBD 4Z66B 1P3LA 2YFVB 5B1MB 4ZBJB 3A6NC 1P34B 4KGCC 3KUYD 1TZYC 1KU5A 4R8PB 1ID3D 1EQZA 5CPJC 1P3IB 4XUJA 3W99B 5AV5D 1R4VA 4KHAA 3AZJA 1AOIB 4YS3C 3LJAD 5GT3C 4Z2MH 5GXQD 2PYOD 3AV2D 1P3KA 4CSRA 2F8ND 2NZDD 5DNMD 3B6GD 1P3BC 4JJNC 3TU4A 5GT0B 3UTBD 1S32B 3W97B 1P3AA 4EO5C 3WAAA 4QLCA 4J8XD 3REIC 4WNNB 5AV8D 4H9OA 1TZYB 3UTAB 3X1VD 5CPKD 3B6FD 5CPJB 5DNNC 5F99C 1P3LD 1P3PB 2YFVA 3V9RA 5BO0B 3X1TB 1Q9CA 5GT3B 2AROC 4R8PA 3AYWA 1EQZD 5B2JC 5AV9B 4XUJD 4J8UC 3AZJD 4JJNB 3W99A 4J8WA 5AV6A 5FUGB 5B0ZB 4H9RB 2CV5A 3LELC 3AZLB 5E5AD 3AZNB 3X1SA 3MGSB 1KX3B 1P3KD 4H9SC 3TU4D 1U35B 1P3AD 3B0CT 3A6NA 4QLCD 3WAAD 3LZ0C 1M1AD 5KDMA 4KGCA 2AROB 4CAYB 1N1JA 5G49B 5B40C 3KXBB 1HQ3B 3UT9B 5B1MD 4G92C 4YS3A 2BYMB 3O62B 5B32B 2BYKB 5B2IC 3AZKB 3MGRC 4R8PD 3AYWD 4G91C 4KUDB 5GSUB 3W99D 1P3BA 3W96C 4J8WD 5AV6D 3MNNC 3AV1C 4H9QB 5FUGA 2CV5D 4H9RA 2FJ7C 4WU9B 3X1SD 3REIA 5BNVA 5CPIC 5DNNA 5F99A 2NQBC 4G92B 3A6ND 5JRGB 1B67A 5B2IB 3KWQB 4WU8C 4KGCD 4XZQC 3REHB 4CAYA 4J8VC 5G49A 4NE5A 3AZEC 5B24B 5B2JA 5CPJD 5B31B 3MGQC 4J8UA 3AZHC 3AZFC 5B33C 3AV1B 4YM6A 4YS3D 3VH5W 3WA9B 1M18B 4Z66C 3LELA 1P34C 4WZSB 1P3BD 4H9SA 5CPIB 1WWSA 1P3IC 2NZDA 3AFAB 4H9PB 1P3FB 3C1BB 1AOIC 4UUZA 3UTBA 3MGPB 3REID 3LZ0A 4WU8B 3REJB 3W98C 3RELA 3WTPB 5B40A 3WTPE 5DNND 5F99D 5GT0C 1S32C 3W97C 5B2IA 3MGRA 2AROD 1KX4A 5B2JD 1H3OA 4J8UD 2RVQC 3UTAC 3W96A 4YM6D 3MNNA 5B32G 3LELD 3AZIB 1P3PC 2FJ7A 3X1TC 3W98B 3R45B 1BH9B 2JSSA 5E5AA 3MVDB 5AV9C 4NE6A 5AVCB 3LZ1C 4DRBA 5B0YB 1P3MB 5B0ZC 5BT1C 2NQBA 3AZLC 3LZ0D 4WU8A 4XZQA 3RELD 5B40D 4J8VA 3AZEA 1JFIB 3AN2A 3WKJB 3AZNC 3MGSC 1M1AA 1KX3C 5B1LB 1BH8B 3MGQA 3AZHA 3AZFA 1U35C 5B33A 2CWEA 5B2ID 4Z66A 3MGRD 5B1MA 1A7WA 3AZMB 1P34A 1KX4D 5B31G 1ZLAB 3W96D 3AZGB 3X1UB 1HQ3C 3MNND 3KXBC 1P3IA 2F8NH 3UT9C 3LZ1B 1AOIA 1M19B 2FJ7D 1P3OC 3O62C 1F66B 5B32C 3AZKC 3W98A 1KX5B 5CHLB 5CP6B 3NQJB 3NQUB 4LD9B 5CPID 4KUDC 5BNXB 5GSUC 5GT0A 2NQBD 1S32A 3W97A 4WU8D 4XZQD 4WU9C 4J8VD 3AZED 3AN2D 4WNNA 4ZUXB 3MGQD 3AZHD 1TZYA 3UTAA 3AZFD 5B33D 5CPJA 2HIOB 4Z66D 1P3PA 1P3OB 5BO0A 5JRGC 5AY8B 3X1TA 1P34D 5GT3A 3KWQC 3REHC 5GXQC 3REKC 4HGAC 5B24C 3C1CB 5B31C 1P3ID 1TAFB 5AV9A 4JJNA 1AOID 5B0ZA 1P3GB 3WA9C 5AVBB 1M18C 3AZLA 3W98D 3AZNA 3VH6T 3MGSA 1KX3A 3KUYB 1ID3B 1U35A 5GT0D 3AFAC 1S32D 1P3FC 3W97D 3C1BC 5AV5B 3B0CW 1WWIA 3MGPC 3LJAB 3REJC 2AROA 3WTPC 5GXQB 1TZYD 2RVQD 4HGAB 3REKB 3UTAD 3KXBA 1HQ3A 3AV2B 3UT9A 5DNMB 3B6GB 1P3PD 1P3OA 3X1TD 2BYMA 4H9NB 5B32A 2BYKA 5GT3D 3O62A 3AZKA 3VH6A 4Z5TC 2YFWB 4J8XB 5AV8B 5BS7C 5AV9D 4KUDA 5GSUA 4JJND 5CPKB 3X1VB 3B6FB 5B0ZD 5BT1D 4H9QA 3AZLD 4NFTA 3AZIC 1P3LB 1P3AC 4WU9A 3AZND 4QLCC 3MGSD 1KX3D 1U35D 1EQZB 3MVDC 5AVCC 4XUJB 4KHAB 5B0YC 1P3MC 4WV4B 5JRGA 4M6BA 3KWQA 3REHA 3WKJC 3REKA 4Z5TB 5B24A 3KXBD 1HQ3D 5B1LC 5B31A 3UT9D 4CSRB 1P3KB 3TU4B 3AV1A 1P3OD 3WA9A 3O62D 5B32D 3AZKD 4Z2MG 1M18A 1P3AB 3AZMC 4QLCB 4KUDD 4H9OB 5GSUD 1ZLAC 3AZGC 3X1UC 5CPIA 4X23C 2F8NK 3AFAA 4H9PA 1P3FA 3C1BA 1M19C 3V9RB 4WU9D 3MGPA 1F66C 3REJA 1KX5C 5CP6C 3WTPA 3B0DC 3AYWB 4LD9C
chains in the Genus database with same CATH superfamily
4J8WB 2XD5A 5AV6B 5C3IB 5JRGD 2CV5B 3KWQD 2HUEB 3REHD 3REKD 5B24D 4Z5TA 3X1SB 2Y2HA 5B31D 2F8NG 5JA4B 5BS7A 4ZUXC 4AWLB 3A1KA 3AV1D 4X23B 3WA9D 1M18D 2HIOC 3AZIA 5AY8C 1T3UA 3A6NB 1F1EA 3R45A 5KDMB 4KGCB 1BH9A 2ZY3A 3B0DB 1N1JB 3C1CC 3MVDA 3AFAD 3IP4C 5AVCA 1P3FD 3C1BD 5B0YA 4DRAA 3MGPD 1P3MA 1P3GC 3H0RC 4YS3B 4NE3A 5AVBC 3REJD 2ZY5A 3WTPD 3WKJA 1JFIA 5B1LA 2IO5C 1BH8A 3KUYC 1ID3C 1P3BB 1BFMA 4YM6C 3B0BA 1ULYA 2LY8A 3FDDA 5AV5C 4UPKA 3AZMA 4EO5B 3LJAC 4Z5TD 3REIB 5JA4A 2PYOC 1ZLAA 5BNVB 3AZGA 3X1UA 4X23A 3AV2C 5DNNB 2NZDC 5F99B 5DNMC 3LZ1A 3B6GC 3AZID 1M19A 3UTBC 1F66A 2FFFB 1KX5A 5CP6A 3NQJA 3RELC 3NQUA 4LD9A 4J8XC 3MVDD 5B2JB 5AV8C 2IO5B 5BNXA 5AVCD 4J8UB 5CPKC 3X1VC 3B6FC 5B0YD 1P3MD 4YM6B 3VH5T 3LELB 1P3LC 3WKJD 1KX4C 5B1LD 4ZUXA 3EPJA 2PYOB 1EQZC 2F8NB 2NZDB 2HIOA 4XUJC 3AZJC 4UUZB 3UTBB 3AZMD 2Y2JA 5AY8A 3LZ0B 3RELB 5B40B 1ZLAD 5E5AC 3C1CA 3X1UD 3AZGD 3KFUG 4X23D 3EG5B 1TAFA 1P3KC 2L5AA 3LZ1D 3VH5A 3TU4C 1M19D 1P3GA 1F66D 1HTAA 2DF4C 3KSYA 5AVBA 1KX5D 3MGRB 1B6WA 5CP6D 1KX4B 3WAAC 3AN2C 4LD9D 3VH6W 1M1AC 1H3OB 3H0MC 4G91B 3KUYA 1ID3A 3W96B 3MNNB 4E44A 3AZJB 5AV5A 5B1MC 2FJ7B 2BG1A 4ZBJC 3LJAA 4ZUXD 5GXQA 2PYOA 4R8PC 5E5AB 3AYWC 3AV2A 2F8NA 2HIOD 5DNMA 3B6GA 3W99C 3AL0C 4J8WC 5AV6C 2NQBB 5AY8D 5C3IC 4H9NA 2CV5C 2HUEC 4XZQB 3F6TA 4J8VB 3AZEB 3WAAB 3C1CD 3AN2B 3X1SC 2YFWA 4J8XA 1M1AB 5AV8A 4E45A 3MGQB 4AWLC 3AZHB 5CPKA 3AZFB 3X1VA 3B6FA 3EPLA 5B33B 1P3GD 5AVBD 4Z66B 1P3LA 2YFVB 5B1MB 4ZBJB 3A6NC 1P34B 4KGCC 3KUYD 1TZYC 1KU5A 4R8PB 1ID3D 1EQZA 5CPJC 1P3IB 4XUJA 3W99B 5AV5D 1R4VA 4KHAA 3AZJA 1AOIB 1Z2CB 4YS3C 3LJAD 5GT3C 4Z2MH 5GXQD 2PYOD 3AV2D 1P3KA 4CSRA 2F8ND 2NZDD 5DNMD 3B6GD 1P3BC 4JJNC 3TU4A 5GT0B 3UTBD 1S32B 3W97B 1P3AA 4EO5C 3WAAA 4QLCA 4J8XD 3REIC 4WNNB 5AV8D 2XD1A 4H9OA 1TZYB 3UTAB 3X1VD 5CPKD 3B6FD 4WJ3C 5CPJB 5DNNC 5F99C 1P3LD 1P3PB 2YFVA 3V9RA 5BO0B 3X1TB 1Q9CA 2Y2GA 5GT3B 2AROC 4R8PA 3AYWA 1EQZD 5B2JC 5AV9B 4XUJD 2Y2NA 4J8UC 4DQYB 3AZJD 4JJNB 3W99A 4J8WA 5AV6A 5FUGB 5B0ZB 4H9RB 2CV5A 2Y2QA 3LELC 3AZLB 5E5AD 3AZNB 3X1SA 3MGSB 1KX3B 1P3KD 4H9SC 3TU4D 1U35B 2Y2OA 1P3AD 3B0CT 3A6NA 4QLCD 3WAAD 3LZ0C 1M1AD 5KDMA 4KGCA 2AROB 4CAYB 1N1JA 5G49B 5B40C 3KXBB 1HQ3B 3UT9B 5B1MD 4G92C 4YS3A 2BYMB 3O62B 5B32B 2BYKB 5B2IC 3AZKB 3MGRC 4R8PD 3AYWD 4G91C 2Y2IA 4KUDB 5GSUB 3W99D 1P3BA 3W96C 4J8WD 5AV6D 3MNNC 3AV1C 4H9QB 5FUGA 2CV5D 4H9RA 2FJ7C 4WU9B 3X1SD 3REIA 2G5HC 5BNVA 5CPIC 5DNNA 5F99A 1W2EA 2NQBC 4G92B 3A6ND 5JRGB 1B67A 5B2IB 3KWQB 4WU8C 4KGCD 4XZQC 3REHB 4CAYA 4J8VC 5G49A 4NE5A 3AZEC 5B24B 5B2JA 5CPJD 5B31B 3MGQC 4J8UA 3AZHC 3AZFC 5B33C 3AV1B 4YM6A 4YS3D 3VH5W 3WA9B 1M18B 4Z66C 3LELA 1P34C 4WZSB 1P3BD 4H9SA 5CPIB 1WWSA 1P3IC 2NZDA 3AFAB 4H9PB 2UWXA 1P3FB 3C1BB 1AOIC 4UUZA 3UTBA 3MGPB 3REID 3LZ0A 4WU8B 3REJB 3W98C 3RELA 3WTPB 5B40A 3WTPE 5DNND 5F99D 5GT0C 1S32C 3W97C 5B2IA 3MGRA 2AROD 1KX4A 3H0LC 5B2JD 1H3OA 4J8UD 2RVQC 3UTAC 3W96A 4YM6D 3MNNA 5B32G 3EPHA 3LELD 3AZIB 1P3PC 2FJ7A 3X1TC 3W98B 3R45B 2Y2KA 1BH9B 2JSSA 5E5AA 3MVDB 5AV9C 4NE6A 5AVCB 3LZ1C 2G5IC 3P5JB 2Y2LA 4DRBA 5B0YB 1P3MB 5B0ZC 5BT1C 2NQBA 3AZLC 3LZ0D 4WU8A 4XZQA 3RELD 5B40D 4J8VA 3AZEA 1JFIB 3AN2A 3WKJB 3AZNC 3MGSC 1M1AA 1KX3C 5B1LB 1BH8B 3MGQA 3AZHA 3AZFA 1U35C 5B33A 2CWEA 5B2ID 4Z66A 3MGRD 5B1MA 1A7WA 3AZMB 1P34A 1KX4D 5B31G 1ZLAB 3W96D 3AZGB 3X1UB 1HQ3C 3MNND 3KXBC 1P3IA 2F8NH 3UT9C 3LZ1B 2J8PA 1AOIA 3EPKA 1M19B 1P3OC 2FJ7D 3O62C 1F66B 5B32C 3AZKC 3W98A 1KX5B 5CHLB 5CP6B 3NQJB 3NQUB 4LD9B 5CPID 4KUDC 5BNXB 5GSUC 5GT0A 2NQBD 1S32A 3W97A 4WU8D 4XZQD 4WU9C 4J8VD 3AZED 3AN2D 4WNNA 4ZUXB 3MGQD 3AZHD 1TZYA 3UTAA 3AZFD 5B33D 5CPJA 2HIOB 4Z66D 1P3PA 1P3OB 5BO0A 5JRGC 5AY8B 3X1TA 1P34D 5GT3A 3KWQC 3REHC 2JCHA 5GXQC 3REKC 4HGAC 5B24C 3C1CB 5B31C 1P3ID 1TAFB 5AV9A 4JJNA 1AOID 5B0ZA 1P3GB 3WA9C 2W8SA 5AVBB 1M18C 2DQNC 3AZLA 2F2AC 3W98D 3AZNA 2ZY4A 3VH6T 3MGSA 1KX3A 1PZRA 3KUYB 1ID3B 1U35A 5GT0D 3AFAC 1S32D 1P3FC 3W97D 3C1BC 5AV5B 3B0CW 1WWIA 3MGPC 3LJAB 3REJC 2ZY2A 2AROA 3WTPC 5GXQB 1TZYD 2RVQD 4HGAB 3REKB 3UTAD 3KXBA 1HQ3A 3AV2B 3UT9A 5DNMB 3B6GB 1P3PD 1P3OA 2Y2PA 3X1TD 2BYMA 4H9NB 5B32A 2BYKA 5GT3D 3O62A 3AZKA 3VH6A 4Z5TC 2YFWB 3A1IA 4J8XB 5AV8B 5BS7C 5AV9D 4KUDA 5GSUA 4JJND 5CPKB 3X1VB 3B6FB 5B0ZD 5BT1D 4H9QA 3AZLD 4NFTA 3AZIC 1P3LB 1P3AC 4WU9A 3AZND 4QLCC 3MGSD 1KX3D 2RIQA 1U35D 1EQZB 3MVDC 5AVCC 4XUJB 4KHAB 5B0YC 1P3MC 4WV4B 5JRGA 4M6BA 3KWQA 3REHA 3WKJC 3REKA 4Z5TB 5B24A 3KXBD 1HQ3D 5B1LC 5B31A 3UT9D 4CSRB 1P3KB 3TU4B 2VQRA 2JE5A 3AV1A 1P3OD 3WA9A 3O62D 5B32D 3AZKD 4Z2MG 1M18A 1P3AB 3AZMC 2Y2MA 4QLCB 4KUDD 4H9OB 5GSUD 1ZLAC 3AZGC 3X1UC 5CPIA 4X23C 2F8NK 3AFAA 4H9PA 1P3FA 3C1BA 1M19C 3V9RB 4WU9D 3MGPA 1F66C 3REJA 1KX5C 5CP6C 2ZM5A 3WTPA 3B0DC 3AYWB 4LD9C
chains in the Genus database with same CATH topology
4J8WB 2XD5A 5AV6B 5C3IB 5JRGD 2CV5B 3KWQD 2HUEB 3REHD 3REKD 5B24D 4Z5TA 3X1SB 2Y2HA 5B31D 2F8NG 5JA4B 5BS7A 4ZUXC 4AWLB 3A1KA 3AV1D 4X23B 3WA9D 1M18D 2HIOC 3AZIA 5AY8C 1T3UA 3A6NB 1F1EA 3R45A 5KDMB 4KGCB 1BH9A 2ZY3A 3B0DB 1N1JB 3C1CC 3MVDA 3AFAD 3IP4C 5AVCA 1P3FD 3C1BD 5B0YA 4DRAA 3MGPD 1P3MA 1P3GC 3H0RC 4YS3B 4NE3A 5AVBC 3REJD 2ZY5A 3WTPD 3WKJA 1JFIA 5B1LA 2IO5C 1BH8A 3KUYC 1ID3C 1P3BB 1BFMA 4YM6C 3B0BA 1ULYA 2LY8A 3FDDA 5AV5C 4UPKA 3AZMA 4EO5B 3LJAC 4Z5TD 3REIB 5JA4A 2PYOC 1ZLAA 5BNVB 3AZGA 3X1UA 4X23A 3AV2C 5DNNB 2NZDC 5F99B 5DNMC 3LZ1A 3B6GC 3AZID 1M19A 3UTBC 1F66A 2FFFB 1KX5A 5CP6A 3NQJA 3RELC 3NQUA 4LD9A 4J8XC 3MVDD 5B2JB 5AV8C 2IO5B 5BNXA 5AVCD 4J8UB 5CPKC 3X1VC 3B6FC 5B0YD 1P3MD 4YM6B 3VH5T 3LELB 1P3LC 3WKJD 1KX4C 5B1LD 4ZUXA 3EPJA 2PYOB 1EQZC 2F8NB 2NZDB 2HIOA 4XUJC 3AZJC 4UUZB 3UTBB 3AZMD 2Y2JA 5AY8A 3LZ0B 3RELB 5B40B 1ZLAD 5E5AC 3C1CA 3X1UD 3AZGD 3KFUG 4X23D 3EG5B 1TAFA 1P3KC 2L5AA 3LZ1D 3VH5A 3TU4C 1M19D 1P3GA 1F66D 1HTAA 2DF4C 3KSYA 5AVBA 1KX5D 3MGRB 1B6WA 5CP6D 1KX4B 3WAAC 3AN2C 4LD9D 3VH6W 1M1AC 1H3OB 3H0MC 4G91B 3KUYA 1ID3A 3W96B 3MNNB 4E44A 3AZJB 5AV5A 5B1MC 2FJ7B 2BG1A 4ZBJC 3LJAA 4ZUXD 5GXQA 2PYOA 4R8PC 5E5AB 3AYWC 3AV2A 2F8NA 2HIOD 5DNMA 3B6GA 3W99C 3AL0C 4J8WC 5AV6C 2NQBB 5AY8D 5C3IC 4H9NA 2CV5C 2HUEC 4XZQB 3F6TA 4J8VB 3AZEB 3WAAB 3C1CD 3AN2B 3X1SC 2YFWA 4J8XA 1M1AB 5AV8A 4E45A 3MGQB 4AWLC 3AZHB 5CPKA 3AZFB 3X1VA 3B6FA 3EPLA 5B33B 1P3GD 5AVBD 4Z66B 1P3LA 2YFVB 5B1MB 4ZBJB 3A6NC 1P34B 4KGCC 3KUYD 1TZYC 1KU5A 4R8PB 1ID3D 1EQZA 5CPJC 1P3IB 4XUJA 3W99B 5AV5D 1R4VA 4KHAA 3AZJA 1AOIB 1Z2CB 4YS3C 3LJAD 5GT3C 4Z2MH 5GXQD 2PYOD 3AV2D 1P3KA 4CSRA 2F8ND 2NZDD 5DNMD 3B6GD 1P3BC 4JJNC 3TU4A 5GT0B 3UTBD 1S32B 3W97B 1P3AA 4EO5C 3WAAA 4QLCA 4J8XD 3REIC 4WNNB 5AV8D 2XD1A 4H9OA 1TZYB 3UTAB 3X1VD 5CPKD 3B6FD 4WJ3C 5CPJB 5DNNC 5F99C 1P3LD 1P3PB 2YFVA 3V9RA 5BO0B 3X1TB 1Q9CA 2Y2GA 5GT3B 2AROC 4R8PA 3AYWA 1EQZD 5B2JC 5AV9B 4XUJD 2Y2NA 4J8UC 4DQYB 3AZJD 4JJNB 3W99A 4J8WA 5AV6A 5FUGB 5B0ZB 4H9RB 2CV5A 2Y2QA 3LELC 3AZLB 5E5AD 3AZNB 3X1SA 3MGSB 1KX3B 1P3KD 4H9SC 3TU4D 1U35B 2Y2OA 1P3AD 3B0CT 3A6NA 4QLCD 3WAAD 3LZ0C 1M1AD 5KDMA 4KGCA 2AROB 4CAYB 1N1JA 5G49B 5B40C 3KXBB 1HQ3B 3UT9B 5B1MD 4G92C 4YS3A 2BYMB 3O62B 5B32B 2BYKB 5B2IC 3AZKB 3MGRC 4R8PD 3AYWD 4G91C 2Y2IA 4KUDB 5GSUB 3W99D 1P3BA 3W96C 4J8WD 5AV6D 3MNNC 3AV1C 4H9QB 5FUGA 2CV5D 4H9RA 2FJ7C 4WU9B 3X1SD 3REIA 2G5HC 5BNVA 5CPIC 5DNNA 5F99A 1W2EA 2NQBC 4G92B 3A6ND 5JRGB 1B67A 5B2IB 3KWQB 4WU8C 4KGCD 4XZQC 3REHB 4CAYA 4J8VC 5G49A 4NE5A 3AZEC 5B24B 5B2JA 5CPJD 5B31B 3MGQC 4J8UA 3AZHC 3AZFC 5B33C 3AV1B 4YM6A 4YS3D 3VH5W 3WA9B 1M18B 4Z66C 3LELA 1P34C 4WZSB 1P3BD 4H9SA 5CPIB 1WWSA 1P3IC 2NZDA 3AFAB 4H9PB 2UWXA 1P3FB 3C1BB 1AOIC 4UUZA 3UTBA 3MGPB 3REID 3LZ0A 4WU8B 3REJB 3W98C 3RELA 3WTPB 5B40A 3WTPE 5DNND 5F99D 5GT0C 1S32C 3W97C 5B2IA 3MGRA 2AROD 1KX4A 3H0LC 5B2JD 1H3OA 4J8UD 2RVQC 3UTAC 3W96A 4YM6D 3MNNA 5B32G 3EPHA 3LELD 3AZIB 1P3PC 2FJ7A 3X1TC 3W98B 3R45B 2Y2KA 1BH9B 2JSSA 5E5AA 3MVDB 5AV9C 4NE6A 5AVCB 3LZ1C 2G5IC 3P5JB 2Y2LA 4DRBA 5B0YB 1P3MB 5B0ZC 5BT1C 2NQBA 3AZLC 3LZ0D 4WU8A 4XZQA 3RELD 5B40D 4J8VA 3AZEA 1JFIB 3AN2A 3WKJB 3AZNC 3MGSC 1M1AA 1KX3C 5B1LB 1BH8B 3MGQA 3AZHA 3AZFA 1U35C 5B33A 2CWEA 5B2ID 4Z66A 3MGRD 5B1MA 1A7WA 3AZMB 1P34A 1KX4D 5B31G 1ZLAB 3W96D 3AZGB 3X1UB 1HQ3C 3MNND 3KXBC 1P3IA 2F8NH 3UT9C 3LZ1B 2J8PA 1AOIA 3EPKA 1M19B 1P3OC 2FJ7D 3O62C 1F66B 5B32C 3AZKC 3W98A 1KX5B 5CHLB 5CP6B 3NQJB 3NQUB 4LD9B 5CPID 4KUDC 5BNXB 5GSUC 5GT0A 2NQBD 1S32A 3W97A 4WU8D 4XZQD 4WU9C 4J8VD 3AZED 3AN2D 4WNNA 4ZUXB 3MGQD 3AZHD 1TZYA 3UTAA 3AZFD 5B33D 5CPJA 2HIOB 4Z66D 1P3PA 1P3OB 5BO0A 5JRGC 5AY8B 3X1TA 1P34D 5GT3A 3KWQC 3REHC 2JCHA 5GXQC 3REKC 4HGAC 5B24C 3C1CB 5B31C 1P3ID 1TAFB 5AV9A 4JJNA 1AOID 5B0ZA 1P3GB 3WA9C 2W8SA 5AVBB 1M18C 2DQNC 3AZLA 2F2AC 3W98D 3AZNA 2ZY4A 3VH6T 3MGSA 1KX3A 1PZRA 3KUYB 1ID3B 1U35A 5GT0D 3AFAC 1S32D 1P3FC 3W97D 3C1BC 5AV5B 3B0CW 1WWIA 3MGPC 3LJAB 3REJC 2ZY2A 2AROA 3WTPC 5GXQB 1TZYD 2RVQD 4HGAB 3REKB 3UTAD 3KXBA 1HQ3A 3AV2B 3UT9A 5DNMB 3B6GB 1P3PD 1P3OA 2Y2PA 3X1TD 2BYMA 4H9NB 5B32A 2BYKA 5GT3D 3O62A 3AZKA 3VH6A 4Z5TC 2YFWB 3A1IA 4J8XB 5AV8B 5BS7C 5AV9D 4KUDA 5GSUA 4JJND 5CPKB 3X1VB 3B6FB 5B0ZD 5BT1D 4H9QA 3AZLD 4NFTA 3AZIC 1P3LB 1P3AC 4WU9A 3AZND 4QLCC 3MGSD 1KX3D 2RIQA 1U35D 1EQZB 3MVDC 5AVCC 4XUJB 4KHAB 5B0YC 1P3MC 4WV4B 5JRGA 4M6BA 3KWQA 3REHA 3WKJC 3REKA 4Z5TB 5B24A 3KXBD 1HQ3D 5B1LC 5B31A 3UT9D 4CSRB 1P3KB 3TU4B 2VQRA 2JE5A 3AV1A 1P3OD 3WA9A 3O62D 5B32D 3AZKD 4Z2MG 1M18A 1P3AB 3AZMC 2Y2MA 4QLCB 4KUDD 4H9OB 5GSUD 1ZLAC 3AZGC 3X1UC 5CPIA 4X23C 2F8NK 3AFAA 4H9PA 1P3FA 3C1BA 1M19C 3V9RB 4WU9D 3MGPA 1F66C 3REJA 1KX5C 5CP6C 2ZM5A 3WTPA 3B0DC 3AYWB 4LD9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W B;  5AV6 B;  5C3I B;  5JRG D;  2CV5 B;  3KWQ D;  2HUE B;  3REH D;  3REK D;  5B24 D;  4Z5T A;  3X1S B;  2F8N G;  5B31 D;  5JA4 B;  5BS7 A;  4ZUX C;  4AWL B;  3AV1 D;  4X23 B;  3WA9 D;  1M18 D;  2HIO C;  3AZI A;  5AY8 C;  3A6N B;  1F1E A;  3R45 A;  5KDM B;  4KGC B;  1BH9 A;  3B0D B;  1N1J B;  3C1C C;  3MVD A;  3AFA D;  5AVC A;  1P3F D;  3C1B D;  5B0Y A;  4DRA A;  3MGP D;  1P3M A;  1P3G C;  4YS3 B;  4NE3 A;  5AVB C;  3REJ D;  3WTP D;  3WKJ A;  1JFI A;  5B1L A;  2IO5 C;  1BH8 A;  3KUY C;  1ID3 C;  1P3B B;  1BFM A;  4YM6 C;  3B0B A;  1ULY A;  2LY8 A;  5AV5 C;  3AZM A;  4EO5 B;  3LJA C;  4Z5T D;  3REI B;  5JA4 A;  2PYO C;  1ZLA A;  5BNV B;  3AZG A;  3X1U A;  4X23 A;  3AV2 C;  5DNN B;  2NZD C;  5F99 B;  5DNM C;  3LZ1 A;  3B6G C;  3AZI D;  1M19 A;  3UTB C;  1F66 A;  1KX5 A;  5CP6 A;  3NQJ A;  3REL C;  3NQU A;  4LD9 A;  4J8X C;  3MVD D;  5B2J B;  5AV8 C;  2IO5 B;  5BNX A;  5AVC D;  4J8U B;  5CPK C;  3X1V C;  3B6F C;  5B0Y D;  1P3M D;  4YM6 B;  3VH5 T;  3LEL B;  1P3L C;  3WKJ D;  1KX4 C;  5B1L D;  4ZUX A;  2PYO B;  1EQZ C;  2F8N B;  2NZD B;  2HIO A;  4XUJ C;  3AZJ C;  4UUZ B;  3UTB B;  3AZM D;  5AY8 A;  3LZ0 B;  3REL B;  5B40 B;  1ZLA D;  5E5A C;  3C1C A;  3X1U D;  3AZG D;  4X23 D;  1P3K C;  1TAF A;  2L5A A;  3LZ1 D;  3VH5 A;  3TU4 C;  1M19 D;  1P3G A;  1F66 D;  1HTA A;  5AVB A;  3KSY A;  1KX5 D;  3MGR B;  1B6W A;  5CP6 D;  1KX4 B;  3WAA C;  3AN2 C;  4LD9 D;  3VH6 W;  1M1A C;  1H3O B;  4G91 B;  3KUY A;  1ID3 A;  3W96 B;  3MNN B;  4E44 A;  3AZJ B;  5AV5 A;  5B1M C;  2FJ7 B;  4ZBJ C;  3LJA A;  4ZUX D;  5GXQ A;  2PYO A;  4R8P C;  5E5A B;  3AYW C;  3AV2 A;  2F8N A;  2HIO D;  5DNM A;  3B6G A;  3W99 C;  4J8W C;  5AV6 C;  2NQB B;  5AY8 D;  5C3I C;  4H9N A;  2CV5 C;  2HUE C;  4XZQ B;  4J8V B;  3AZE B;  3WAA B;  3C1C D;  3AN2 B;  3X1S C;  2YFW A;  4J8X A;  1M1A B;  5AV8 A;  4E45 A;  3MGQ B;  4AWL C;  3AZH B;  5CPK A;  3AZF B;  3X1V A;  3B6F A;  5B33 B;  1P3G D;  5AVB D;  4Z66 B;  1P3L A;  2YFV B;  5B1M B;  4ZBJ B;  3A6N C;  1P34 B;  4KGC C;  3KUY D;  1TZY C;  1KU5 A;  4R8P B;  1ID3 D;  1EQZ A;  5CPJ C;  1P3I B;  4XUJ A;  3W99 B;  5AV5 D;  1R4V A;  4KHA A;  3AZJ A;  1AOI B;  4YS3 C;  3LJA D;  5GT3 C;  4Z2M H;  5GXQ D;  2PYO D;  3AV2 D;  1P3K A;  4CSR A;  2F8N D;  2NZD D;  5DNM D;  3B6G D;  1P3B C;  4JJN C;  3TU4 A;  5GT0 B;  3UTB D;  1S32 B;  3W97 B;  1P3A A;  4EO5 C;  3WAA A;  4QLC A;  4J8X D;  3REI C;  4WNN B;  5AV8 D;  4H9O A;  1TZY B;  3UTA B;  3X1V D;  5CPK D;  3B6F D;  5CPJ B;  5DNN C;  5F99 C;  1P3L D;  1P3P B;  2YFV A;  3V9R A;  5BO0 B;  3X1T B;  1Q9C A;  5GT3 B;  2ARO C;  4R8P A;  3AYW A;  1EQZ D;  5B2J C;  5AV9 B;  4XUJ D;  4J8U C;  3AZJ D;  4JJN B;  3W99 A;  4J8W A;  5AV6 A;  5FUG B;  5B0Z B;  4H9R B;  2CV5 A;  3LEL C;  3AZL B;  5E5A D;  3AZN B;  3X1S A;  3MGS B;  1KX3 B;  1P3K D;  4H9S C;  3TU4 D;  1U35 B;  1P3A D;  3B0C T;  3A6N A;  4QLC D;  3WAA D;  3LZ0 C;  1M1A D;  5KDM A;  4KGC A;  2ARO B;  4CAY B;  1N1J A;  5G49 B;  5B40 C;  3KXB B;  1HQ3 B;  3UT9 B;  5B1M D;  4G92 C;  4YS3 A;  2BYM B;  3O62 B;  5B32 B;  2BYK B;  5B2I C;  3AZK B;  3MGR C;  4R8P D;  3AYW D;  4G91 C;  4KUD B;  5GSU B;  3W99 D;  1P3B A;  3W96 C;  4J8W D;  5AV6 D;  3MNN C;  3AV1 C;  4H9Q B;  5FUG A;  2CV5 D;  4H9R A;  2FJ7 C;  4WU9 B;  3X1S D;  3REI A;  5BNV A;  5CPI C;  5DNN A;  5F99 A;  2NQB C;  4G92 B;  3A6N D;  5JRG B;  1B67 A;  5B2I B;  3KWQ B;  4WU8 C;  4KGC D;  4XZQ C;  3REH B;  4CAY A;  4J8V C;  5G49 A;  4NE5 A;  3AZE C;  5B24 B;  5B2J A;  5CPJ D;  5B31 B;  3MGQ C;  4J8U A;  3AZH C;  3AZF C;  5B33 C;  3AV1 B;  4YM6 A;  4YS3 D;  3VH5 W;  3WA9 B;  1M18 B;  4Z66 C;  3LEL A;  1P34 C;  4WZS B;  1P3B D;  4H9S A;  5CPI B;  1WWS A;  1P3I C;  2NZD A;  3AFA B;  4H9P B;  1P3F B;  3C1B B;  1AOI C;  4UUZ A;  3UTB A;  3MGP B;  3REI D;  3LZ0 A;  4WU8 B;  3REJ B;  3W98 C;  3REL A;  3WTP B;  5B40 A;  3WTP E;  5DNN D;  5F99 D;  5GT0 C;  1S32 C;  3W97 C;  5B2I A;  3MGR A;  2ARO D;  1KX4 A;  5B2J D;  1H3O A;  4J8U D;  2RVQ C;  3UTA C;  3W96 A;  4YM6 D;  3MNN A;  5B32 G;  3LEL D;  3AZI B;  1P3P C;  2FJ7 A;  3X1T C;  3W98 B;  3R45 B;  1BH9 B;  2JSS A;  5E5A A;  3MVD B;  5AV9 C;  4NE6 A;  5AVC B;  3LZ1 C;  4DRB A;  5B0Y B;  1P3M B;  5B0Z C;  5BT1 C;  2NQB A;  3AZL C;  3LZ0 D;  4WU8 A;  4XZQ A;  3REL D;  5B40 D;  4J8V A;  3AZE A;  1JFI B;  3AN2 A;  3WKJ B;  3AZN C;  3MGS C;  1M1A A;  1KX3 C;  5B1L B;  1BH8 B;  3MGQ A;  3AZH A;  3AZF A;  1U35 C;  5B33 A;  2CWE A;  5B2I D;  4Z66 A;  3MGR D;  5B1M A;  1A7W A;  3AZM B;  1P34 A;  1KX4 D;  5B31 G;  1ZLA B;  3W96 D;  3AZG B;  3X1U B;  1HQ3 C;  3MNN D;  3KXB C;  1P3I A;  2F8N H;  3UT9 C;  3LZ1 B;  1AOI A;  1M19 B;  2FJ7 D;  1P3O C;  3O62 C;  1F66 B;  5B32 C;  3AZK C;  3W98 A;  1KX5 B;  5CHL B;  5CP6 B;  3NQJ B;  3NQU B;  4LD9 B;  5CPI D;  4KUD C;  5BNX B;  5GSU C;  5GT0 A;  2NQB D;  1S32 A;  3W97 A;  4WU8 D;  4XZQ D;  4WU9 C;  4J8V D;  3AZE D;  3AN2 D;  4WNN A;  4ZUX B;  3MGQ D;  3AZH D;  1TZY A;  3UTA A;  3AZF D;  5B33 D;  5CPJ A;  2HIO B;  4Z66 D;  1P3P A;  1P3O B;  5BO0 A;  5JRG C;  5AY8 B;  3X1T A;  1P34 D;  5GT3 A;  3KWQ C;  3REH C;  5GXQ C;  3REK C;  4HGA C;  5B24 C;  3C1C B;  5B31 C;  1P3I D;  1TAF B;  5AV9 A;  4JJN A;  1AOI D;  5B0Z A;  1P3G B;  3WA9 C;  5AVB B;  1M18 C;  3AZL A;  3W98 D;  3AZN A;  3VH6 T;  3MGS A;  1KX3 A;  3KUY B;  1ID3 B;  1U35 A;  5GT0 D;  3AFA C;  1S32 D;  1P3F C;  3W97 D;  3C1B C;  5AV5 B;  3B0C W;  1WWI A;  3MGP C;  3LJA B;  3REJ C;  2ARO A;  3WTP C;  5GXQ B;  1TZY D;  2RVQ D;  4HGA B;  3REK B;  3UTA D;  3KXB A;  1HQ3 A;  3AV2 B;  3UT9 A;  5DNM B;  3B6G B;  1P3P D;  1P3O A;  3X1T D;  2BYM A;  4H9N B;  5B32 A;  2BYK A;  5GT3 D;  3O62 A;  3AZK A;  3VH6 A;  4Z5T C;  2YFW B;  4J8X B;  5AV8 B;  5BS7 C;  5AV9 D;  4KUD A;  5GSU A;  4JJN D;  5CPK B;  3X1V B;  3B6F B;  5B0Z D;  5BT1 D;  4H9Q A;  3AZL D;  4NFT A;  3AZI C;  1P3L B;  1P3A C;  4WU9 A;  3AZN D;  4QLC C;  3MGS D;  1KX3 D;  1U35 D;  1EQZ B;  3MVD C;  5AVC C;  4XUJ B;  4KHA B;  5B0Y C;  1P3M C;  4WV4 B;  5JRG A;  4M6B A;  3KWQ A;  3REH A;  3WKJ C;  3REK A;  4Z5T B;  5B24 A;  3KXB D;  1HQ3 D;  5B1L C;  5B31 A;  3UT9 D;  4CSR B;  1P3K B;  3TU4 B;  3AV1 A;  1P3O D;  3WA9 A;  3O62 D;  5B32 D;  3AZK D;  4Z2M G;  1M18 A;  1P3A B;  3AZM C;  4QLC B;  4KUD D;  4H9O B;  5GSU D;  1ZLA C;  3AZG C;  3X1U C;  5CPI A;  4X23 C;  2F8N K;  3AFA A;  4H9P A;  1P3F A;  3C1B A;  1M19 C;  3V9R B;  4WU9 D;  3MGP A;  1F66 C;  3REJ A;  1KX5 C;  5CP6 C;  3WTP A;  3B0D C;  3AYW B;  4LD9 C; 
#chains in the Genus database with same CATH topology
 4J8W B;  2XD5 A;  5AV6 B;  5C3I B;  5JRG D;  2CV5 B;  3KWQ D;  2HUE B;  3REH D;  3REK D;  5B24 D;  4Z5T A;  3X1S B;  2Y2H A;  5B31 D;  2F8N G;  5JA4 B;  5BS7 A;  4ZUX C;  4AWL B;  3A1K A;  3AV1 D;  4X23 B;  3WA9 D;  1M18 D;  2HIO C;  3AZI A;  5AY8 C;  1T3U A;  3A6N B;  1F1E A;  3R45 A;  5KDM B;  4KGC B;  1BH9 A;  2ZY3 A;  3B0D B;  1N1J B;  3C1C C;  3MVD A;  3AFA D;  3IP4 C;  5AVC A;  1P3F D;  3C1B D;  5B0Y A;  4DRA A;  3MGP D;  1P3M A;  1P3G C;  3H0R C;  4YS3 B;  4NE3 A;  5AVB C;  3REJ D;  2ZY5 A;  3WTP D;  3WKJ A;  1JFI A;  5B1L A;  2IO5 C;  1BH8 A;  3KUY C;  1ID3 C;  1P3B B;  1BFM A;  4YM6 C;  3B0B A;  1ULY A;  2LY8 A;  3FDD A;  5AV5 C;  4UPK A;  3AZM A;  4EO5 B;  3LJA C;  4Z5T D;  3REI B;  5JA4 A;  2PYO C;  1ZLA A;  5BNV B;  3AZG A;  3X1U A;  4X23 A;  3AV2 C;  5DNN B;  2NZD C;  5F99 B;  5DNM C;  3LZ1 A;  3B6G C;  3AZI D;  1M19 A;  3UTB C;  1F66 A;  2FFF B;  1KX5 A;  5CP6 A;  3NQJ A;  3REL C;  3NQU A;  4LD9 A;  4J8X C;  3MVD D;  5B2J B;  5AV8 C;  2IO5 B;  5BNX A;  5AVC D;  4J8U B;  5CPK C;  3X1V C;  3B6F C;  5B0Y D;  1P3M D;  4YM6 B;  3VH5 T;  3LEL B;  1P3L C;  3WKJ D;  1KX4 C;  5B1L D;  4ZUX A;  3EPJ A;  2PYO B;  1EQZ C;  2F8N B;  2NZD B;  2HIO A;  4XUJ C;  3AZJ C;  4UUZ B;  3UTB B;  3AZM D;  2Y2J A;  5AY8 A;  3LZ0 B;  3REL B;  5B40 B;  1ZLA D;  5E5A C;  3C1C A;  3X1U D;  3AZG D;  3KFU G;  4X23 D;  3EG5 B;  1TAF A;  1P3K C;  2L5A A;  3LZ1 D;  3VH5 A;  3TU4 C;  1M19 D;  1P3G A;  1F66 D;  1HTA A;  2DF4 C;  3KSY A;  5AVB A;  1KX5 D;  3MGR B;  1B6W A;  5CP6 D;  1KX4 B;  3WAA C;  3AN2 C;  4LD9 D;  3VH6 W;  1M1A C;  1H3O B;  3H0M C;  4G91 B;  3KUY A;  1ID3 A;  3W96 B;  3MNN B;  4E44 A;  3AZJ B;  5AV5 A;  5B1M C;  2FJ7 B;  2BG1 A;  4ZBJ C;  3LJA A;  4ZUX D;  5GXQ A;  2PYO A;  4R8P C;  5E5A B;  3AYW C;  3AV2 A;  2F8N A;  2HIO D;  5DNM A;  3B6G A;  3W99 C;  3AL0 C;  4J8W C;  5AV6 C;  2NQB B;  5AY8 D;  5C3I C;  4H9N A;  2CV5 C;  2HUE C;  4XZQ B;  3F6T A;  4J8V B;  3AZE B;  3WAA B;  3C1C D;  3AN2 B;  3X1S C;  2YFW A;  4J8X A;  1M1A B;  5AV8 A;  4E45 A;  3MGQ B;  4AWL C;  3AZH B;  5CPK A;  3AZF B;  3X1V A;  3B6F A;  3EPL A;  5B33 B;  1P3G D;  5AVB D;  4Z66 B;  1P3L A;  2YFV B;  5B1M B;  4ZBJ B;  3A6N C;  1P34 B;  4KGC C;  3KUY D;  1TZY C;  1KU5 A;  4R8P B;  1ID3 D;  1EQZ A;  5CPJ C;  1P3I B;  4XUJ A;  3W99 B;  5AV5 D;  1R4V A;  4KHA A;  3AZJ A;  1AOI B;  1Z2C B;  4YS3 C;  3LJA D;  5GT3 C;  4Z2M H;  5GXQ D;  2PYO D;  3AV2 D;  1P3K A;  4CSR A;  2F8N D;  2NZD D;  5DNM D;  3B6G D;  1P3B C;  4JJN C;  3TU4 A;  5GT0 B;  3UTB D;  1S32 B;  3W97 B;  1P3A A;  4EO5 C;  3WAA A;  4QLC A;  4J8X D;  3REI C;  4WNN B;  5AV8 D;  2XD1 A;  4H9O A;  1TZY B;  3UTA B;  3X1V D;  5CPK D;  3B6F D;  4WJ3 C;  5CPJ B;  5DNN C;  5F99 C;  1P3L D;  1P3P B;  2YFV A;  3V9R A;  5BO0 B;  3X1T B;  1Q9C A;  2Y2G A;  5GT3 B;  2ARO C;  4R8P A;  3AYW A;  1EQZ D;  5B2J C;  5AV9 B;  4XUJ D;  2Y2N A;  4J8U C;  4DQY B;  3AZJ D;  4JJN B;  3W99 A;  4J8W A;  5AV6 A;  5FUG B;  5B0Z B;  4H9R B;  2CV5 A;  2Y2Q A;  3LEL C;  3AZL B;  5E5A D;  3AZN B;  3X1S A;  3MGS B;  1KX3 B;  1P3K D;  4H9S C;  3TU4 D;  1U35 B;  2Y2O A;  1P3A D;  3B0C T;  3A6N A;  4QLC D;  3WAA D;  3LZ0 C;  1M1A D;  5KDM A;  4KGC A;  2ARO B;  4CAY B;  1N1J A;  5G49 B;  5B40 C;  3KXB B;  1HQ3 B;  3UT9 B;  5B1M D;  4G92 C;  4YS3 A;  2BYM B;  3O62 B;  5B32 B;  2BYK B;  5B2I C;  3AZK B;  3MGR C;  4R8P D;  3AYW D;  4G91 C;  2Y2I A;  4KUD B;  5GSU B;  3W99 D;  1P3B A;  3W96 C;  4J8W D;  5AV6 D;  3MNN C;  3AV1 C;  4H9Q B;  5FUG A;  2CV5 D;  4H9R A;  2FJ7 C;  4WU9 B;  3X1S D;  3REI A;  2G5H C;  5BNV A;  5CPI C;  5DNN A;  5F99 A;  1W2E A;  2NQB C;  4G92 B;  3A6N D;  5JRG B;  1B67 A;  5B2I B;  3KWQ B;  4WU8 C;  4KGC D;  4XZQ C;  3REH B;  4CAY A;  4J8V C;  5G49 A;  4NE5 A;  3AZE C;  5B24 B;  5B2J A;  5CPJ D;  5B31 B;  3MGQ C;  4J8U A;  3AZH C;  3AZF C;  5B33 C;  3AV1 B;  4YM6 A;  4YS3 D;  3VH5 W;  3WA9 B;  1M18 B;  4Z66 C;  3LEL A;  1P34 C;  4WZS B;  1P3B D;  4H9S A;  5CPI B;  1WWS A;  1P3I C;  2NZD A;  3AFA B;  4H9P B;  2UWX A;  1P3F B;  3C1B B;  1AOI C;  4UUZ A;  3UTB A;  3MGP B;  3REI D;  3LZ0 A;  4WU8 B;  3REJ B;  3W98 C;  3REL A;  3WTP B;  5B40 A;  3WTP E;  5DNN D;  5F99 D;  5GT0 C;  1S32 C;  3W97 C;  5B2I A;  3MGR A;  2ARO D;  1KX4 A;  3H0L C;  5B2J D;  1H3O A;  4J8U D;  2RVQ C;  3UTA C;  3W96 A;  4YM6 D;  3MNN A;  5B32 G;  3EPH A;  3LEL D;  3AZI B;  1P3P C;  2FJ7 A;  3X1T C;  3W98 B;  3R45 B;  2Y2K A;  1BH9 B;  2JSS A;  5E5A A;  3MVD B;  5AV9 C;  4NE6 A;  5AVC B;  3LZ1 C;  2G5I C;  3P5J B;  2Y2L A;  4DRB A;  5B0Y B;  1P3M B;  5B0Z C;  5BT1 C;  2NQB A;  3AZL C;  3LZ0 D;  4WU8 A;  4XZQ A;  3REL D;  5B40 D;  4J8V A;  3AZE A;  1JFI B;  3AN2 A;  3WKJ B;  3AZN C;  3MGS C;  1M1A A;  1KX3 C;  5B1L B;  1BH8 B;  3MGQ A;  3AZH A;  3AZF A;  1U35 C;  5B33 A;  2CWE A;  5B2I D;  4Z66 A;  3MGR D;  5B1M A;  1A7W A;  3AZM B;  1P34 A;  1KX4 D;  5B31 G;  1ZLA B;  3W96 D;  3AZG B;  3X1U B;  1HQ3 C;  3MNN D;  3KXB C;  1P3I A;  2F8N H;  3UT9 C;  3LZ1 B;  2J8P A;  1AOI A;  3EPK A;  1M19 B;  1P3O C;  2FJ7 D;  3O62 C;  1F66 B;  5B32 C;  3AZK C;  3W98 A;  1KX5 B;  5CHL B;  5CP6 B;  3NQJ B;  3NQU B;  4LD9 B;  5CPI D;  4KUD C;  5BNX B;  5GSU C;  5GT0 A;  2NQB D;  1S32 A;  3W97 A;  4WU8 D;  4XZQ D;  4WU9 C;  4J8V D;  3AZE D;  3AN2 D;  4WNN A;  4ZUX B;  3MGQ D;  3AZH D;  1TZY A;  3UTA A;  3AZF D;  5B33 D;  5CPJ A;  2HIO B;  4Z66 D;  1P3P A;  1P3O B;  5BO0 A;  5JRG C;  5AY8 B;  3X1T A;  1P34 D;  5GT3 A;  3KWQ C;  3REH C;  2JCH A;  5GXQ C;  3REK C;  4HGA C;  5B24 C;  3C1C B;  5B31 C;  1P3I D;  1TAF B;  5AV9 A;  4JJN A;  1AOI D;  5B0Z A;  1P3G B;  3WA9 C;  2W8S A;  5AVB B;  1M18 C;  2DQN C;  3AZL A;  2F2A C;  3W98 D;  3AZN A;  2ZY4 A;  3VH6 T;  3MGS A;  1KX3 A;  1PZR A;  3KUY B;  1ID3 B;  1U35 A;  5GT0 D;  3AFA C;  1S32 D;  1P3F C;  3W97 D;  3C1B C;  5AV5 B;  3B0C W;  1WWI A;  3MGP C;  3LJA B;  3REJ C;  2ZY2 A;  2ARO A;  3WTP C;  5GXQ B;  1TZY D;  2RVQ D;  4HGA B;  3REK B;  3UTA D;  3KXB A;  1HQ3 A;  3AV2 B;  3UT9 A;  5DNM B;  3B6G B;  1P3P D;  1P3O A;  2Y2P A;  3X1T D;  2BYM A;  4H9N B;  5B32 A;  2BYK A;  5GT3 D;  3O62 A;  3AZK A;  3VH6 A;  4Z5T C;  2YFW B;  3A1I A;  4J8X B;  5AV8 B;  5BS7 C;  5AV9 D;  4KUD A;  5GSU A;  4JJN D;  5CPK B;  3X1V B;  3B6F B;  5B0Z D;  5BT1 D;  4H9Q A;  3AZL D;  4NFT A;  3AZI C;  1P3L B;  1P3A C;  4WU9 A;  3AZN D;  4QLC C;  3MGS D;  1KX3 D;  2RIQ A;  1U35 D;  1EQZ B;  3MVD C;  5AVC C;  4XUJ B;  4KHA B;  5B0Y C;  1P3M C;  4WV4 B;  5JRG A;  4M6B A;  3KWQ A;  3REH A;  3WKJ C;  3REK A;  4Z5T B;  5B24 A;  3KXB D;  1HQ3 D;  5B1L C;  5B31 A;  3UT9 D;  4CSR B;  1P3K B;  3TU4 B;  2VQR A;  2JE5 A;  3AV1 A;  1P3O D;  3WA9 A;  3O62 D;  5B32 D;  3AZK D;  4Z2M G;  1M18 A;  1P3A B;  3AZM C;  2Y2M A;  4QLC B;  4KUD D;  4H9O B;  5GSU D;  1ZLA C;  3AZG C;  3X1U C;  5CPI A;  4X23 C;  2F8N K;  3AFA A;  4H9P A;  1P3F A;  3C1B A;  1M19 C;  3V9R B;  4WU9 D;  3MGP A;  1F66 C;  3REJ A;  1KX5 C;  5CP6 C;  2ZM5 A;  3WTP A;  3B0D C;  3AYW B;  4LD9 C; 
#chains in the Genus database with same CATH homology
 4J8W B;  2XD5 A;  5AV6 B;  5C3I B;  5JRG D;  2CV5 B;  3KWQ D;  2HUE B;  3REH D;  3REK D;  5B24 D;  4Z5T A;  3X1S B;  2Y2H A;  5B31 D;  2F8N G;  5JA4 B;  5BS7 A;  4ZUX C;  4AWL B;  3A1K A;  3AV1 D;  4X23 B;  3WA9 D;  1M18 D;  2HIO C;  3AZI A;  5AY8 C;  1T3U A;  3A6N B;  1F1E A;  3R45 A;  5KDM B;  4KGC B;  1BH9 A;  2ZY3 A;  3B0D B;  1N1J B;  3C1C C;  3MVD A;  3AFA D;  3IP4 C;  5AVC A;  1P3F D;  3C1B D;  5B0Y A;  4DRA A;  3MGP D;  1P3M A;  1P3G C;  3H0R C;  4YS3 B;  4NE3 A;  5AVB C;  3REJ D;  2ZY5 A;  3WTP D;  3WKJ A;  1JFI A;  5B1L A;  2IO5 C;  1BH8 A;  3KUY C;  1ID3 C;  1P3B B;  1BFM A;  4YM6 C;  3B0B A;  1ULY A;  2LY8 A;  3FDD A;  5AV5 C;  4UPK A;  3AZM A;  4EO5 B;  3LJA C;  4Z5T D;  3REI B;  5JA4 A;  2PYO C;  1ZLA A;  5BNV B;  3AZG A;  3X1U A;  4X23 A;  3AV2 C;  5DNN B;  2NZD C;  5F99 B;  5DNM C;  3LZ1 A;  3B6G C;  3AZI D;  1M19 A;  3UTB C;  1F66 A;  2FFF B;  1KX5 A;  5CP6 A;  3NQJ A;  3REL C;  3NQU A;  4LD9 A;  4J8X C;  3MVD D;  5B2J B;  5AV8 C;  2IO5 B;  5BNX A;  5AVC D;  4J8U B;  5CPK C;  3X1V C;  3B6F C;  5B0Y D;  1P3M D;  4YM6 B;  3VH5 T;  3LEL B;  1P3L C;  3WKJ D;  1KX4 C;  5B1L D;  4ZUX A;  3EPJ A;  2PYO B;  1EQZ C;  2F8N B;  2NZD B;  2HIO A;  4XUJ C;  3AZJ C;  4UUZ B;  3UTB B;  3AZM D;  2Y2J A;  5AY8 A;  3LZ0 B;  3REL B;  5B40 B;  1ZLA D;  5E5A C;  3C1C A;  3X1U D;  3AZG D;  3KFU G;  4X23 D;  3EG5 B;  1TAF A;  1P3K C;  2L5A A;  3LZ1 D;  3VH5 A;  3TU4 C;  1M19 D;  1P3G A;  1F66 D;  1HTA A;  2DF4 C;  3KSY A;  5AVB A;  1KX5 D;  3MGR B;  1B6W A;  5CP6 D;  1KX4 B;  3WAA C;  3AN2 C;  4LD9 D;  3VH6 W;  1M1A C;  1H3O B;  3H0M C;  4G91 B;  3KUY A;  1ID3 A;  3W96 B;  3MNN B;  4E44 A;  3AZJ B;  5AV5 A;  5B1M C;  2FJ7 B;  2BG1 A;  4ZBJ C;  3LJA A;  4ZUX D;  5GXQ A;  2PYO A;  4R8P C;  5E5A B;  3AYW C;  3AV2 A;  2F8N A;  2HIO D;  5DNM A;  3B6G A;  3W99 C;  3AL0 C;  4J8W C;  5AV6 C;  2NQB B;  5AY8 D;  5C3I C;  4H9N A;  2CV5 C;  2HUE C;  4XZQ B;  3F6T A;  4J8V B;  3AZE B;  3WAA B;  3C1C D;  3AN2 B;  3X1S C;  2YFW A;  4J8X A;  1M1A B;  5AV8 A;  4E45 A;  3MGQ B;  4AWL C;  3AZH B;  5CPK A;  3AZF B;  3X1V A;  3B6F A;  3EPL A;  5B33 B;  1P3G D;  5AVB D;  4Z66 B;  1P3L A;  2YFV B;  5B1M B;  4ZBJ B;  3A6N C;  1P34 B;  4KGC C;  3KUY D;  1TZY C;  1KU5 A;  4R8P B;  1ID3 D;  1EQZ A;  5CPJ C;  1P3I B;  4XUJ A;  3W99 B;  5AV5 D;  1R4V A;  4KHA A;  3AZJ A;  1AOI B;  1Z2C B;  4YS3 C;  3LJA D;  5GT3 C;  4Z2M H;  5GXQ D;  2PYO D;  3AV2 D;  1P3K A;  4CSR A;  2F8N D;  2NZD D;  5DNM D;  3B6G D;  1P3B C;  4JJN C;  3TU4 A;  5GT0 B;  3UTB D;  1S32 B;  3W97 B;  1P3A A;  4EO5 C;  3WAA A;  4QLC A;  4J8X D;  3REI C;  4WNN B;  5AV8 D;  2XD1 A;  4H9O A;  1TZY B;  3UTA B;  3X1V D;  5CPK D;  3B6F D;  4WJ3 C;  5CPJ B;  5DNN C;  5F99 C;  1P3L D;  1P3P B;  2YFV A;  3V9R A;  5BO0 B;  3X1T B;  1Q9C A;  2Y2G A;  5GT3 B;  2ARO C;  4R8P A;  3AYW A;  1EQZ D;  5B2J C;  5AV9 B;  4XUJ D;  2Y2N A;  4J8U C;  4DQY B;  3AZJ D;  4JJN B;  3W99 A;  4J8W A;  5AV6 A;  5FUG B;  5B0Z B;  4H9R B;  2CV5 A;  2Y2Q A;  3LEL C;  3AZL B;  5E5A D;  3AZN B;  3X1S A;  3MGS B;  1KX3 B;  1P3K D;  4H9S C;  3TU4 D;  1U35 B;  2Y2O A;  1P3A D;  3B0C T;  3A6N A;  4QLC D;  3WAA D;  3LZ0 C;  1M1A D;  5KDM A;  4KGC A;  2ARO B;  4CAY B;  1N1J A;  5G49 B;  5B40 C;  3KXB B;  1HQ3 B;  3UT9 B;  5B1M D;  4G92 C;  4YS3 A;  2BYM B;  3O62 B;  5B32 B;  2BYK B;  5B2I C;  3AZK B;  3MGR C;  4R8P D;  3AYW D;  4G91 C;  2Y2I A;  4KUD B;  5GSU B;  3W99 D;  1P3B A;  3W96 C;  4J8W D;  5AV6 D;  3MNN C;  3AV1 C;  4H9Q B;  5FUG A;  2CV5 D;  4H9R A;  2FJ7 C;  4WU9 B;  3X1S D;  3REI A;  2G5H C;  5BNV A;  5CPI C;  5DNN A;  5F99 A;  1W2E A;  2NQB C;  4G92 B;  3A6N D;  5JRG B;  1B67 A;  5B2I B;  3KWQ B;  4WU8 C;  4KGC D;  4XZQ C;  3REH B;  4CAY A;  4J8V C;  5G49 A;  4NE5 A;  3AZE C;  5B24 B;  5B2J A;  5CPJ D;  5B31 B;  3MGQ C;  4J8U A;  3AZH C;  3AZF C;  5B33 C;  3AV1 B;  4YM6 A;  4YS3 D;  3VH5 W;  3WA9 B;  1M18 B;  4Z66 C;  3LEL A;  1P34 C;  4WZS B;  1P3B D;  4H9S A;  5CPI B;  1WWS A;  1P3I C;  2NZD A;  3AFA B;  4H9P B;  2UWX A;  1P3F B;  3C1B B;  1AOI C;  4UUZ A;  3UTB A;  3MGP B;  3REI D;  3LZ0 A;  4WU8 B;  3REJ B;  3W98 C;  3REL A;  3WTP B;  5B40 A;  3WTP E;  5DNN D;  5F99 D;  5GT0 C;  1S32 C;  3W97 C;  5B2I A;  3MGR A;  2ARO D;  1KX4 A;  3H0L C;  5B2J D;  1H3O A;  4J8U D;  2RVQ C;  3UTA C;  3W96 A;  4YM6 D;  3MNN A;  5B32 G;  3EPH A;  3LEL D;  3AZI B;  1P3P C;  2FJ7 A;  3X1T C;  3W98 B;  3R45 B;  2Y2K A;  1BH9 B;  2JSS A;  5E5A A;  3MVD B;  5AV9 C;  4NE6 A;  5AVC B;  3LZ1 C;  2G5I C;  3P5J B;  2Y2L A;  4DRB A;  5B0Y B;  1P3M B;  5B0Z C;  5BT1 C;  2NQB A;  3AZL C;  3LZ0 D;  4WU8 A;  4XZQ A;  3REL D;  5B40 D;  4J8V A;  3AZE A;  1JFI B;  3AN2 A;  3WKJ B;  3AZN C;  3MGS C;  1M1A A;  1KX3 C;  5B1L B;  1BH8 B;  3MGQ A;  3AZH A;  3AZF A;  1U35 C;  5B33 A;  2CWE A;  5B2I D;  4Z66 A;  3MGR D;  5B1M A;  1A7W A;  3AZM B;  1P34 A;  1KX4 D;  5B31 G;  1ZLA B;  3W96 D;  3AZG B;  3X1U B;  1HQ3 C;  3MNN D;  3KXB C;  1P3I A;  2F8N H;  3UT9 C;  3LZ1 B;  2J8P A;  1AOI A;  3EPK A;  1M19 B;  1P3O C;  2FJ7 D;  3O62 C;  1F66 B;  5B32 C;  3AZK C;  3W98 A;  1KX5 B;  5CHL B;  5CP6 B;  3NQJ B;  3NQU B;  4LD9 B;  5CPI D;  4KUD C;  5BNX B;  5GSU C;  5GT0 A;  2NQB D;  1S32 A;  3W97 A;  4WU8 D;  4XZQ D;  4WU9 C;  4J8V D;  3AZE D;  3AN2 D;  4WNN A;  4ZUX B;  3MGQ D;  3AZH D;  1TZY A;  3UTA A;  3AZF D;  5B33 D;  5CPJ A;  2HIO B;  4Z66 D;  1P3P A;  1P3O B;  5BO0 A;  5JRG C;  5AY8 B;  3X1T A;  1P34 D;  5GT3 A;  3KWQ C;  3REH C;  2JCH A;  5GXQ C;  3REK C;  4HGA C;  5B24 C;  3C1C B;  5B31 C;  1P3I D;  1TAF B;  5AV9 A;  4JJN A;  1AOI D;  5B0Z A;  1P3G B;  3WA9 C;  2W8S A;  5AVB B;  1M18 C;  2DQN C;  3AZL A;  2F2A C;  3W98 D;  3AZN A;  2ZY4 A;  3VH6 T;  3MGS A;  1KX3 A;  1PZR A;  3KUY B;  1ID3 B;  1U35 A;  5GT0 D;  3AFA C;  1S32 D;  1P3F C;  3W97 D;  3C1B C;  5AV5 B;  3B0C W;  1WWI A;  3MGP C;  3LJA B;  3REJ C;  2ZY2 A;  2ARO A;  3WTP C;  5GXQ B;  1TZY D;  2RVQ D;  4HGA B;  3REK B;  3UTA D;  3KXB A;  1HQ3 A;  3AV2 B;  3UT9 A;  5DNM B;  3B6G B;  1P3P D;  1P3O A;  2Y2P A;  3X1T D;  2BYM A;  4H9N B;  5B32 A;  2BYK A;  5GT3 D;  3O62 A;  3AZK A;  3VH6 A;  4Z5T C;  2YFW B;  3A1I A;  4J8X B;  5AV8 B;  5BS7 C;  5AV9 D;  4KUD A;  5GSU A;  4JJN D;  5CPK B;  3X1V B;  3B6F B;  5B0Z D;  5BT1 D;  4H9Q A;  3AZL D;  4NFT A;  3AZI C;  1P3L B;  1P3A C;  4WU9 A;  3AZN D;  4QLC C;  3MGS D;  1KX3 D;  2RIQ A;  1U35 D;  1EQZ B;  3MVD C;  5AVC C;  4XUJ B;  4KHA B;  5B0Y C;  1P3M C;  4WV4 B;  5JRG A;  4M6B A;  3KWQ A;  3REH A;  3WKJ C;  3REK A;  4Z5T B;  5B24 A;  3KXB D;  1HQ3 D;  5B1L C;  5B31 A;  3UT9 D;  4CSR B;  1P3K B;  3TU4 B;  2VQR A;  2JE5 A;  3AV1 A;  1P3O D;  3WA9 A;  3O62 D;  5B32 D;  3AZK D;  4Z2M G;  1M18 A;  1P3A B;  3AZM C;  2Y2M A;  4QLC B;  4KUD D;  4H9O B;  5GSU D;  1ZLA C;  3AZG C;  3X1U C;  5CPI A;  4X23 C;  2F8N K;  3AFA A;  4H9P A;  1P3F A;  3C1B A;  1M19 C;  3V9R B;  4WU9 D;  3MGP A;  1F66 C;  3REJ A;  1KX5 C;  5CP6 C;  2ZM5 A;  3WTP A;  3B0D C;  3AYW B;  4LD9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...