5B32B

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32B00
3KUYC 3AV2C 5GT3B 3AZGC 5GT3D 3REJA 4R8PA 5CP6C 1M19A 2BYKB 3B6FD 5E5AA 3X1SA 4NE3A 3AZMA 3VH5A 2RVQC 3LJAB 3LJAD 1P3OD 3MVDA 3AZEA 3B0BA 3LZ0A 3W97C 1P3AA 2F8NB 2F8ND 3MGPA 5GT0B 5GT0D 3WA9A 5AVBA 3AV1A 5B2JB 1KX5B 1KX5D 3C1BB 4J8VD 3C1BD 5B33D 3WKJB 3REIA 3W98C 3WKJD 4JJNB 5BNVB 4JJND 4ZBJC 3AV2B 3AV2D 5AVCC 5CP6B 3X1VA 5CPIC 1HQ3C 5AY8C 2AROA 3AZJC 5GXQC 1P3MA 3UTBD 1U35C 3KUYA 3AZGA 3B6GB 3B6GD 1JFIA 4KGCC 1P3IC 2BYMB 5B32B 3X1TB 5B32D 3X1TD 3WTPE 5B31A 5B1LD 3O62D 3B0DC 5DNMC 3WAAB 3WAAD 2YFVB 4G92B 3W97A 4J8XC 5C3IC 3W98B 3W98D 3KSYA 1M18C 5JRGB 5JRGD 3NQUB 3LELC 4ZBJB 4AWLC 1BH8B 5AV6C 3UTAC 4J8UA 4YM6A 5AVCB 3AYWC 1ID3C 5B24A 3MNNC 5CPIB 5CPID 4LD9B 1HQ3B 4UUZB 1HQ3D 5AY8B 3AZJB 2PYOC 5GXQB 4LD9D 5GXQD 1N1JA 5AV9C 4WNNB 3AZFC 1P3IB 3W99B 3W99D 4H9QA 5AV5D 3X1UC 3VH6A 1EQZC 4EO5C 5B0ZC 5BNXB 1F66D 1U35A 5B31G 5CPJA 1KX3B 4R8PC 1KX3D 4KGCA 4J8WC 5C3IB 2YFWB 1KX4C 4H9SC 5DNMA 3NQJB 5FUGA 3C1CC 3AYWB 3MVDC 3AZEC 1ID3B 1P3FB 4E44A 1P3FD 4YS3B 4J8XA 4YS3D 3MNNB 1ZLAB 1ZLAD 3REKB 1P34A 3REKD 1M18A 1P3AC 2PYOB 4KUDC 1P3BB 3MGPC 4H9OB 1P3BD 5BO0B 3LELA 5AV6A 3WA9C 3UTAA 4H9NB 1P3GB 1P3GD 4Z5TC 3AZFB 3AZNB 3AZND 3REIC 5B40C 3B0CT 4NE5A 2HUEC 3V9RA 4EO5B 5AV9A 5BS7A 1TAFA 3REJB 4R8PB 3REJD 1M19B 1M19D 1P3PB 3REHA 1P3PD 3X1VC 5E5AB 4XZQC 5E5AD 1S32A 3X1UA 2AROC 1EQZA 1P3MC 3X1SB 3X1SD 3AZMB 3AZMD 5B0ZA 3LZ1C 4QLCA 3KWQA 3MVDB 3LZ0B 3MVDD 3LZ0D 4J8WA 5B31C 3W96A 1P3AB 1KX4A 3VH5W 3MGPB 1AOIA 3WA9B 4H9SA 1WWSA 5AVBB 3C1CA 5AVBD 3AV1B 3AV1D 3AN2A 3REIB 5CHLB 4KUDA 4Z66A 3AZKA 3WTPA 4H9PA 3MGRA 4J8UC 5GSUA 4YM6C 4Z5TA 5B2JD 5B24C 5KDMA 3X1VB 5B40A 1TZYA 3R45A 1M1AA 2AROB 1P3MB 3KUYB 3KUYD 3AZGB 3AZGD 1JFIB 1ULYA 1B6WA 5CP6D 2HIOA 3MGSA 2FJ7C 4WU9C 3B6FA 3UT9C 4XZQA 5B31B 2RVQD 3LZ1A 5CPJC 1P3OA 3AFAA 3W97B 3W97D 3MGQC 2CV5A 4J8UB 4J8UD 4YM6B 4J8VA 5B24B 5B33A 3A6NC 1P34C 1R4VA 2IO5C 2F8NH 4E45A 5AV8A 5JA4A 1N1JB 4WU8C 1KU5A 4Z2MH 5AVCD 5B1MC 4H9QB 5AY8D 3AZJD 4NFTA 3UTBA 1U35B 1U35D 5BS7C 5CPJB 5CPJD 3REHC 4KGCB 5F99A 2FJ7A 4H9RA 3KXBA 1P3ID 4KGCD 4WU9A 3VH6W 3UT9A 1S32C 4ZUXC 2L5AA 5B1LA 3O62A 3B0DB 3RELC 1H3OA 5DNMB 5DNNC 5DNMD 4QLCC 2F8NG 5FUGB 3KWQC 5BT1C 4J8XB 4J8XD 5B0YC 3AZLC 3MGQA 2NQBA 4Z2MG 1P34B 1M18B 3W96C 5JRGA 1M18D 4CSRA 1AOIC 1KX5C 3LELB 3LELD 4AWLB 5AV6B 5AV6D 3UTAB 3UTAD 4HGAC 3AYWD 3AZHA 1ID3D 3AN2C 3A6NA 3MNND 4X23A 2PYOD 4Z66C 3V9RB 3AZKC 2JSSA 4WU8A 3WTPC 3TU4C 5AV9B 5AV9D 1P3KC 3MGRC 1TAFB 5GSUC 3AZIC 3REHB 3REHD 3AZFD 5B1MA 5B2IC 5AV5A 1S32B 1TZYC 4KHAA 1M1AC 3X1UB 2NZDC 3X1UD 1EQZB 1EQZD 1BH9A 1F66A 5B32G 5B0ZB 5B0ZD 5GT3C 4QLCB 3KWQB 3KWQD 4R8PD 3MGSC 2HIOC 4J8WB 4J8WD 3B6FC 4NE6A 3W96B 5G49A 1KX4B 4ZUXA 1KX4D 1AOIB 1Q9CA 3RELA 5DNNA 3LJAC 4XUJA 1P3OC 3C1CB 3AFAC 3C1CD 3AZEB 3AZED 3AN2B 3AZLA 5B0YA 2CV5C 4CAYA 1P3AD 4KUDB 4KUDD 4DRAA 4Z66B 3MGPD 5GT0C 3AZKB 3WTPB 3AZKD 4H9PB 3MGRB 3WA9D 5GSUB 5GSUD 4Z5TB 4Z5TD 4J8VC 5B33C 1P3LA 5KDMB 3REID 4JJNC 5B40B 5B40D 1TZYB 3R45B 1M1AB 5AV8C 2HUEB 3TU4A 1P3KA 3MGSB 2HIOB 3MGSD 2HIOD 3AZIA 1P3PA 5CPKA 5B2IA 2CWEA 3B6FB 4XZQB 3X1VD 4XZQD 2NZDA 1B67A 2AROD 1P3MD 3UTBC 5GT3A 3LZ1B 1P3OB 3LZ1D 3B6GC 3AFAB 5F99C 3AFAD 2BYKA 3KXBC 5B32C 3X1TC 2CV5B 5B31D 5B1LC 3O62C 2CV5D 3WAAC 3LJAA 4G92C 4J8VB 5B33B 4WZSB 2NQBC 5JRGC 2F8NA 5AV8B 5JA4B 5AV8D 5GT0A 4YM6D 3AZHC 5B2JA 1KX5A 3C1BA 5B24D 3WKJA 4JJNA 5BNVA 4LD9C 4X23C 3UTBB 3AV2A 5CP6A 5F99B 2FJ7B 4H9RB 5F99D 3KXBB 3KXBD 2FJ7D 3W99C 5AV5C 4WU9D 3UT9B 4WU9B 3UT9D 3B0CW 1WWIA 5B1LB 3VH5T 3O62B 1F66C 1H3OB 3B6GA 1KX3C 1A7WA 3MGQB 2NQBB 2BYMA 3MGQD 2NQBD 5B32A 3X1TA 4CSRB 4XUJC 3WAAA 3AZHB 2YFVA 3AZHD 1P3FC 4YS3C 3W98A 3A6NB 3A6ND 1ZLAC 3REKC 4G91C 1F1EA 2IO5B 4X23D 4X23B 3NQUA 4WV4B 1P34D 1P3BC 4WU8B 4WU8D 1BH8A 1P3GC 5AVCA 4DRBA 3AZNC 5B1MB 1P3LC 5B1MD 5AV5B 4KHAB 5CPIA 4LD9A 1HQ3A 4UUZA 5AY8A 3AZJA 2LY8A 5GXQA 1BH9B 1F66B 4WNNA 3REJC 1M19C 1P3PC 1P3IA 5CPKC 1HTAA 5E5AC 3W99A 1S32D 5G49B 4ZUXB 3X1SC 4ZUXD 3AZMC 5BNXA 3RELB 3RELD 5DNNB 5DNND 4XUJB 4XUJD 4QLCD 1KX3A 3LZ0C 5BT1D 2F8NK 3AZLB 5B0YB 3AZLD 5B0YD 2YFWA 4G91B 4CAYB 3W96D 1AOID 3NQJA 4HGAB 5AVBC 3AYWA 3AV1C 1ID3A 1P3FA 3AN2D 4YS3A 1P3LB 1P3LD 1BFMA 3MNNA 1ZLAA 3REKA 2PYOA 1P3BA 4H9OA 4Z66D 5BO0A 3WTPD 3TU4B 3TU4D 1P3KB 1P3KD 4H9NA 3MGRD 1P3GA 5B2JC 3AZIB 3AZID 3AZNA 3C1BC 3AZFA 5CPKB 5B2IB 5CPKD 5B2ID 3WKJC 3VH6T 2NZDB 1TZYD 4M6BA 1M1AD 2NZDD
chains in the Genus database with same CATH superfamily
1W2EA 3KUYC 3AV2C 5GT3B 3AZGC 5GT3D 3REJA 4R8PA 5CP6C 1M19A 2BYKB 3B6FD 5E5AA 3X1SA 4NE3A 3AZMA 3VH5A 2RVQC 3LJAB 3LJAD 1P3OD 3MVDA 3AZEA 3B0BA 3LZ0A 3W97C 1P3AA 2F8NB 2F8ND 3MGPA 5GT0B 5GT0D 3WA9A 5AVBA 3AV1A 5B2JB 1KX5B 1KX5D 3C1BB 4J8VD 3C1BD 5B33D 3WKJB 3REIA 3W98C 3WKJD 3EG5B 4JJNB 5BNVB 4JJND 4ZBJC 3AV2B 3AV2D 5AVCC 5CP6B 3X1VA 5CPIC 1HQ3C 2Y2LA 2BG1A 2AROA 5AY8C 3AZJC 3H0LC 5GXQC 1P3MA 3UTBD 1U35C 3KUYA 3AZGA 3B6GB 3B6GD 1JFIA 4KGCC 1P3IC 2BYMB 5B32B 3X1TB 5B32D 2DQNC 3X1TD 3WTPE 5B31A 5B1LD 3O62D 3B0DC 5DNMC 3WAAB 3WAAD 2YFVB 4G92B 3W97A 4J8XC 5C3IC 3W98B 3W98D 3KSYA 2G5HC 1M18C 5JRGB 5JRGD 3NQUB 3AL0C 3LELC 4ZBJB 4AWLC 1BH8B 5AV6C 3UTAC 4J8UA 4YM6A 2Y2QA 5AVCB 3AYWC 1ID3C 5B24A 3MNNC 5CPIB 2Y2OA 5CPID 1HQ3B 4UUZB 1HQ3D 5AY8B 3AZJB 2PYOC 5GXQB 4LD9B 2ZY4A 5GXQD 1N1JA 5AV9C 4WNNB 4DQYB 3AZFC 1P3IB 3W99B 3W99D 4H9QA 5AV5D 3X1UC 3VH6A 1EQZC 2Y2HA 4EO5C 5B0ZC 5BNXB 1F66D 1U35A 5B31G 5CPJA 1KX3B 4R8PC 1KX3D 4KGCA 4J8WC 5C3IB 3EPLA 2YFWB 1KX4C 4H9SC 5DNMA 3NQJB 5FUGA 3C1CC 3AYWB 3MVDC 3AZEC 1ID3B 1P3FB 4E44A 1P3FD 4YS3B 4J8XA 4YS3D 3MNNB 1ZLAB 1ZLAD 3REKB 1P34A 3REKD 1M18A 1P3AC 2PYOB 4KUDC 1P3BB 3MGPC 4H9OB 1P3BD 5BO0B 3LELA 5AV6A 3WA9C 3UTAA 4H9NB 1P3GB 1P3GD 4Z5TC 3AZFB 3AZNB 3AZND 3REIC 5B40C 3B0CT 4NE5A 2HUEC 3V9RA 4EO5B 5AV9A 5BS7A 1TAFA 3REJB 4R8PB 3REJD 1M19B 3KFUG 1M19D 1P3PB 3REHA 1P3PD 3X1VC 5E5AB 4XZQC 5E5AD 1S32A 3X1UA 2AROC 1EQZA 1P3MC 3X1SB 3X1SD 3AZMB 3AZMD 5B0ZA 3LZ1C 4QLCA 3KWQA 3MVDB 3LZ0B 1PZRA 3LZ0D 3MVDD 4J8WA 2F2AC 5B31C 3W96A 3H0MC 1P3AB 1KX4A 3VH5W 3MGPB 1AOIA 3WA9B 4H9SA 1WWSA 5AVBB 3C1CA 5AVBD 3AV1B 3AV1D 3AN2A 3REIB 5CHLB 4KUDA 2VQRA 4Z66A 3AZKA 3WTPA 4H9PA 3MGRA 4J8UC 5GSUA 4YM6C 4Z5TA 5B2JD 5B24C 5KDMA 3X1VB 5B40A 1TZYA 3R45A 1M1AA 2AROB 1P3MB 3KUYB 3KUYD 3AZGB 3AZGD 1JFIB 1ULYA 1B6WA 5CP6D 2HIOA 3MGSA 2FJ7C 4WU9C 3B6FA 3UT9C 4XZQA 5B31B 2ZY3A 2RVQD 3LZ1A 5CPJC 1P3OA 2J8PA 3AFAA 3W97B 3W97D 3MGQC 2Y2NA 3EPJA 2CV5A 2JCHA 4J8UB 4J8UD 4YM6B 4J8VA 5B24B 5B33A 3A6NC 1P34C 1R4VA 2IO5C 2F8NH 4E45A 5AV8A 5JA4A 1N1JB 4WU8C 1KU5A 4Z2MH 5AVCD 5B1MC 4H9QB 5AY8D 3AZJD 4NFTA 1Z2CB 3UTBA 1U35B 1U35D 5BS7C 5CPJB 5CPJD 3REHC 4KGCB 5F99A 2FJ7A 4H9RA 3KXBA 1P3ID 4KGCD 4WU9A 3VH6W 3UT9A 1S32C 2JE5A 2W8SA 4ZUXC 2L5AA 5B1LA 3O62A 2Y2GA 3B0DB 3RELC 1H3OA 5DNMB 5DNNC 5DNMD 4QLCC 3EPHA 2F8NG 5FUGB 3KWQC 4WJ3C 5BT1C 4J8XB 4J8XD 5B0YC 3AZLC 3MGQA 2NQBA 4Z2MG 1P34B 1M18B 3W96C 5JRGA 1M18D 4CSRA 1AOIC 1KX5C 3LELB 3A1IA 3LELD 4AWLB 5AV6B 5AV6D 3UTAB 3UTAD 4HGAC 3AYWD 3F6TA 3AZHA 1ID3D 3AN2C 3A6NA 1T3UA 3MNND 4X23A 2PYOD 4Z66C 3V9RB 3AZKC 2JSSA 4WU8A 3WTPC 3TU4C 5AV9B 5AV9D 1P3KC 3MGRC 1TAFB 5GSUC 3AZIC 3REHB 3REHD 3AZFD 5B1MA 5B2IC 5AV5A 1S32B 1TZYC 4KHAA 1M1AC 3X1UB 2NZDC 3X1UD 1EQZB 1EQZD 1BH9A 1F66A 5B32G 5B0ZB 5B0ZD 5GT3C 4QLCB 3KWQB 3KWQD 4R8PD 3MGSC 2HIOC 4J8WB 4J8WD 3B6FC 4NE6A 3W96B 5G49A 1KX4B 2XD5A 4ZUXA 1KX4D 1AOIB 1Q9CA 3RELA 5DNNA 3LJAC 4XUJA 1P3OC 3C1CB 3AFAC 2ZY2A 3C1CD 3AZEB 3AZED 3AN2B 3AZLA 5B0YA 2CV5C 4CAYA 1P3AD 4KUDB 4KUDD 4DRAA 4Z66B 3MGPD 5GT0C 3AZKB 3WTPB 3AZKD 4H9PB 3MGRB 3WA9D 5GSUB 5GSUD 4Z5TB 4Z5TD 4J8VC 5B33C 1P3LA 5KDMB 3REID 4JJNC 5B40B 5B40D 1TZYB 3R45B 1M1AB 5AV8C 2HUEB 3TU4A 1P3KA 3P5JB 2G5IC 3FDDA 3MGSB 2HIOB 3MGSD 2HIOD 3AZIA 1P3PA 5CPKA 5B2IA 2CWEA 3B6FB 4XZQB 3X1VD 4XZQD 2NZDA 1B67A 2AROD 1P3MD 3UTBC 5GT3A 3LZ1B 1P3OB 3LZ1D 3B6GC 3AFAB 5F99C 3AFAD 2BYKA 3KXBC 2UWXA 2RIQA 5B32C 3X1TC 2CV5B 5B31D 5B1LC 3O62C 2CV5D 2Y2MA 3WAAC 3LJAA 4G92C 4J8VB 5B33B 4WZSB 4LD9D 2NQBC 5JRGC 2F8NA 5AV8B 5JA4B 5AV8D 5GT0A 4YM6D 3AZHC 5B2JA 1KX5A 3C1BA 5B24D 3WKJA 4JJNA 5BNVA 4LD9C 4X23C 3UTBB 2Y2PA 3AV2A 4UPKA 5CP6A 5F99B 2FJ7B 4H9RB 5F99D 3KXBB 3KXBD 2FJ7D 3W99C 5AV5C 4WU9D 3UT9B 4WU9B 3UT9D 3B0CW 1WWIA 5B1LB 3VH5T 3O62B 1F66C 1H3OB 3B6GA 1KX3C 1A7WA 2ZY5A 3MGQB 2NQBB 2BYMA 3MGQD 2NQBD 5B32A 3X1TA 4CSRB 2ZM5A 3IP4C 4XUJC 3WAAA 3AZHB 2YFVA 3AZHD 3H0RC 1P3FC 4YS3C 3W98A 3A6NB 3A6ND 1ZLAC 3REKC 1F1EA 2IO5B 4G91C 4X23D 4X23B 3NQUA 4WV4B 1P34D 1P3BC 4WU8B 4WU8D 1BH8A 1P3GC 5AVCA 4DRBA 3AZNC 5B1MB 1P3LC 5B1MD 5AV5B 4KHAB 5CPIA 2Y2JA 4LD9A 1HQ3A 4UUZA 5AY8A 3AZJA 2LY8A 5GXQA 1BH9B 1F66B 4WNNA 3REJC 1M19C 1P3PC 1P3IA 5CPKC 1HTAA 5E5AC 3W99A 1S32D 5G49B 4ZUXB 3X1SC 4ZUXD 3AZMC 5BNXA 3RELB 3EPKA 5DNNB 3RELD 5DNND 4XUJB 2XD1A 4XUJD 4QLCD 1KX3A 3LZ0C 5BT1D 2DF4C 2F8NK 3AZLB 5B0YB 3AZLD 5B0YD 3A1KA 2YFWA 4G91B 4CAYB 3W96D 1AOID 3NQJA 4HGAB 5AVBC 3AYWA 3AV1C 1ID3A 1P3FA 3AN2D 4YS3A 1P3LB 1P3LD 1BFMA 3MNNA 1ZLAA 3REKA 2PYOA 1P3BA 4H9OA 4Z66D 5BO0A 2Y2IA 3WTPD 3TU4B 3TU4D 1P3KB 1P3KD 4H9NA 2Y2KA 3MGRD 1P3GA 2FFFB 5B2JC 3AZIB 3AZID 3AZNA 3C1BC 3AZFA 5CPKB 5B2IB 5CPKD 5B2ID 3WKJC 3VH6T 2NZDB 1TZYD 4M6BA 1M1AD 2NZDD
chains in the Genus database with same CATH topology
1W2EA 3KUYC 3AV2C 5GT3B 3AZGC 5GT3D 3REJA 4R8PA 5CP6C 1M19A 2BYKB 3B6FD 5E5AA 3X1SA 4NE3A 3AZMA 3VH5A 2RVQC 3LJAB 3LJAD 1P3OD 3MVDA 3AZEA 3B0BA 3LZ0A 3W97C 1P3AA 2F8NB 2F8ND 3MGPA 5GT0B 5GT0D 3WA9A 5AVBA 3AV1A 5B2JB 1KX5B 1KX5D 3C1BB 4J8VD 3C1BD 5B33D 3WKJB 3REIA 3W98C 3WKJD 3EG5B 4JJNB 5BNVB 4JJND 4ZBJC 3AV2B 3AV2D 5AVCC 5CP6B 3X1VA 5CPIC 1HQ3C 2Y2LA 2BG1A 2AROA 5AY8C 3AZJC 3H0LC 5GXQC 1P3MA 3UTBD 1U35C 3KUYA 3AZGA 3B6GB 3B6GD 1JFIA 4KGCC 1P3IC 2BYMB 5B32B 3X1TB 5B32D 2DQNC 3X1TD 3WTPE 5B31A 5B1LD 3O62D 3B0DC 5DNMC 3WAAB 3WAAD 2YFVB 4G92B 3W97A 4J8XC 5C3IC 3W98B 3W98D 3KSYA 2G5HC 1M18C 5JRGB 5JRGD 3NQUB 3AL0C 3LELC 4ZBJB 4AWLC 1BH8B 5AV6C 3UTAC 4J8UA 4YM6A 2Y2QA 5AVCB 3AYWC 1ID3C 5B24A 3MNNC 5CPIB 2Y2OA 5CPID 1HQ3B 4UUZB 1HQ3D 5AY8B 3AZJB 2PYOC 5GXQB 4LD9B 2ZY4A 5GXQD 1N1JA 5AV9C 4WNNB 4DQYB 3AZFC 1P3IB 3W99B 3W99D 4H9QA 5AV5D 3X1UC 3VH6A 1EQZC 2Y2HA 4EO5C 5B0ZC 5BNXB 1F66D 1U35A 5B31G 5CPJA 1KX3B 4R8PC 1KX3D 4KGCA 4J8WC 5C3IB 3EPLA 2YFWB 1KX4C 4H9SC 5DNMA 3NQJB 5FUGA 3C1CC 3AYWB 3MVDC 3AZEC 1ID3B 1P3FB 4E44A 1P3FD 4YS3B 4J8XA 4YS3D 3MNNB 1ZLAB 1ZLAD 3REKB 1P34A 3REKD 1M18A 1P3AC 2PYOB 4KUDC 1P3BB 3MGPC 4H9OB 1P3BD 5BO0B 3LELA 5AV6A 3WA9C 3UTAA 4H9NB 1P3GB 1P3GD 4Z5TC 3AZFB 3AZNB 3AZND 3REIC 5B40C 3B0CT 4NE5A 2HUEC 3V9RA 4EO5B 5AV9A 5BS7A 1TAFA 3REJB 4R8PB 3REJD 1M19B 3KFUG 1M19D 1P3PB 3REHA 1P3PD 3X1VC 5E5AB 4XZQC 5E5AD 1S32A 3X1UA 2AROC 1EQZA 1P3MC 3X1SB 3X1SD 3AZMB 3AZMD 5B0ZA 3LZ1C 4QLCA 3KWQA 3MVDB 3LZ0B 1PZRA 3LZ0D 3MVDD 4J8WA 2F2AC 5B31C 3W96A 3H0MC 1P3AB 1KX4A 3VH5W 3MGPB 1AOIA 3WA9B 4H9SA 1WWSA 5AVBB 3C1CA 5AVBD 3AV1B 3AV1D 3AN2A 3REIB 5CHLB 4KUDA 2VQRA 4Z66A 3AZKA 3WTPA 4H9PA 3MGRA 4J8UC 5GSUA 4YM6C 4Z5TA 5B2JD 5B24C 5KDMA 3X1VB 5B40A 1TZYA 3R45A 1M1AA 2AROB 1P3MB 3KUYB 3KUYD 3AZGB 3AZGD 1JFIB 1ULYA 1B6WA 5CP6D 2HIOA 3MGSA 2FJ7C 4WU9C 3B6FA 3UT9C 4XZQA 5B31B 2ZY3A 2RVQD 3LZ1A 5CPJC 1P3OA 2J8PA 3AFAA 3W97B 3W97D 3MGQC 2Y2NA 3EPJA 2CV5A 2JCHA 4J8UB 4J8UD 4YM6B 4J8VA 5B24B 5B33A 3A6NC 1P34C 1R4VA 2IO5C 2F8NH 4E45A 5AV8A 5JA4A 1N1JB 4WU8C 1KU5A 4Z2MH 5AVCD 5B1MC 4H9QB 5AY8D 3AZJD 4NFTA 1Z2CB 3UTBA 1U35B 1U35D 5BS7C 5CPJB 5CPJD 3REHC 4KGCB 5F99A 2FJ7A 4H9RA 3KXBA 1P3ID 4KGCD 4WU9A 3VH6W 3UT9A 1S32C 2JE5A 2W8SA 4ZUXC 2L5AA 5B1LA 3O62A 2Y2GA 3B0DB 3RELC 1H3OA 5DNMB 5DNNC 5DNMD 4QLCC 3EPHA 2F8NG 5FUGB 3KWQC 4WJ3C 5BT1C 4J8XB 4J8XD 5B0YC 3AZLC 3MGQA 2NQBA 4Z2MG 1P34B 1M18B 3W96C 5JRGA 1M18D 4CSRA 1AOIC 1KX5C 3LELB 3A1IA 3LELD 4AWLB 5AV6B 5AV6D 3UTAB 3UTAD 4HGAC 3AYWD 3F6TA 3AZHA 1ID3D 3AN2C 3A6NA 1T3UA 3MNND 4X23A 2PYOD 4Z66C 3V9RB 3AZKC 2JSSA 4WU8A 3WTPC 3TU4C 5AV9B 5AV9D 1P3KC 3MGRC 1TAFB 5GSUC 3AZIC 3REHB 3REHD 3AZFD 5B1MA 5B2IC 5AV5A 1S32B 1TZYC 4KHAA 1M1AC 3X1UB 2NZDC 3X1UD 1EQZB 1EQZD 1BH9A 1F66A 5B32G 5B0ZB 5B0ZD 5GT3C 4QLCB 3KWQB 3KWQD 4R8PD 3MGSC 2HIOC 4J8WB 4J8WD 3B6FC 4NE6A 3W96B 5G49A 1KX4B 2XD5A 4ZUXA 1KX4D 1AOIB 1Q9CA 3RELA 5DNNA 3LJAC 4XUJA 1P3OC 3C1CB 3AFAC 2ZY2A 3C1CD 3AZEB 3AZED 3AN2B 3AZLA 5B0YA 2CV5C 4CAYA 1P3AD 4KUDB 4KUDD 4DRAA 4Z66B 3MGPD 5GT0C 3AZKB 3WTPB 3AZKD 4H9PB 3MGRB 3WA9D 5GSUB 5GSUD 4Z5TB 4Z5TD 4J8VC 5B33C 1P3LA 5KDMB 3REID 4JJNC 5B40B 5B40D 1TZYB 3R45B 1M1AB 5AV8C 2HUEB 3TU4A 1P3KA 3P5JB 2G5IC 3FDDA 3MGSB 2HIOB 3MGSD 2HIOD 3AZIA 1P3PA 5CPKA 5B2IA 2CWEA 3B6FB 4XZQB 3X1VD 4XZQD 2NZDA 1B67A 2AROD 1P3MD 3UTBC 5GT3A 3LZ1B 1P3OB 3LZ1D 3B6GC 3AFAB 5F99C 3AFAD 2BYKA 3KXBC 2UWXA 2RIQA 5B32C 3X1TC 2CV5B 5B31D 5B1LC 3O62C 2CV5D 2Y2MA 3WAAC 3LJAA 4G92C 4J8VB 5B33B 4WZSB 4LD9D 2NQBC 5JRGC 2F8NA 5AV8B 5JA4B 5AV8D 5GT0A 4YM6D 3AZHC 5B2JA 1KX5A 3C1BA 5B24D 3WKJA 4JJNA 5BNVA 4LD9C 4X23C 3UTBB 2Y2PA 3AV2A 4UPKA 5CP6A 5F99B 2FJ7B 4H9RB 5F99D 3KXBB 3KXBD 2FJ7D 3W99C 5AV5C 4WU9D 3UT9B 4WU9B 3UT9D 3B0CW 1WWIA 5B1LB 3VH5T 3O62B 1F66C 1H3OB 3B6GA 1KX3C 1A7WA 2ZY5A 3MGQB 2NQBB 2BYMA 3MGQD 2NQBD 5B32A 3X1TA 4CSRB 2ZM5A 3IP4C 4XUJC 3WAAA 3AZHB 2YFVA 3AZHD 3H0RC 1P3FC 4YS3C 3W98A 3A6NB 3A6ND 1ZLAC 3REKC 1F1EA 2IO5B 4G91C 4X23D 4X23B 3NQUA 4WV4B 1P34D 1P3BC 4WU8B 4WU8D 1BH8A 1P3GC 5AVCA 4DRBA 3AZNC 5B1MB 1P3LC 5B1MD 5AV5B 4KHAB 5CPIA 2Y2JA 4LD9A 1HQ3A 4UUZA 5AY8A 3AZJA 2LY8A 5GXQA 1BH9B 1F66B 4WNNA 3REJC 1M19C 1P3PC 1P3IA 5CPKC 1HTAA 5E5AC 3W99A 1S32D 5G49B 4ZUXB 3X1SC 4ZUXD 3AZMC 5BNXA 3RELB 3EPKA 5DNNB 3RELD 5DNND 4XUJB 2XD1A 4XUJD 4QLCD 1KX3A 3LZ0C 5BT1D 2DF4C 2F8NK 3AZLB 5B0YB 3AZLD 5B0YD 3A1KA 2YFWA 4G91B 4CAYB 3W96D 1AOID 3NQJA 4HGAB 5AVBC 3AYWA 3AV1C 1ID3A 1P3FA 3AN2D 4YS3A 1P3LB 1P3LD 1BFMA 3MNNA 1ZLAA 3REKA 2PYOA 1P3BA 4H9OA 4Z66D 5BO0A 2Y2IA 3WTPD 3TU4B 3TU4D 1P3KB 1P3KD 4H9NA 2Y2KA 3MGRD 1P3GA 2FFFB 5B2JC 3AZIB 3AZID 3AZNA 3C1BC 3AZFA 5CPKB 5B2IB 5CPKD 5B2ID 3WKJC 3VH6T 2NZDB 1TZYD 4M6BA 1M1AD 2NZDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY C;  3AV2 C;  5GT3 B;  3AZG C;  5GT3 D;  3REJ A;  4R8P A;  5CP6 C;  1M19 A;  2BYK B;  3B6F D;  5E5A A;  3X1S A;  4NE3 A;  3AZM A;  3VH5 A;  2RVQ C;  3LJA B;  3LJA D;  1P3O D;  3MVD A;  3AZE A;  3B0B A;  3LZ0 A;  3W97 C;  1P3A A;  2F8N B;  2F8N D;  3MGP A;  5GT0 B;  5GT0 D;  3WA9 A;  5AVB A;  3AV1 A;  5B2J B;  1KX5 B;  1KX5 D;  3C1B B;  4J8V D;  3C1B D;  5B33 D;  3WKJ B;  3REI A;  3W98 C;  3WKJ D;  4JJN B;  5BNV B;  4JJN D;  4ZBJ C;  3AV2 B;  3AV2 D;  5AVC C;  5CP6 B;  3X1V A;  5CPI C;  1HQ3 C;  5AY8 C;  2ARO A;  3AZJ C;  5GXQ C;  1P3M A;  3UTB D;  1U35 C;  3KUY A;  3AZG A;  3B6G B;  3B6G D;  1JFI A;  4KGC C;  1P3I C;  2BYM B;  5B32 B;  3X1T B;  5B32 D;  3X1T D;  3WTP E;  5B31 A;  5B1L D;  3O62 D;  3B0D C;  5DNM C;  3WAA B;  3WAA D;  2YFV B;  4G92 B;  3W97 A;  4J8X C;  5C3I C;  3W98 B;  3W98 D;  3KSY A;  1M18 C;  5JRG B;  5JRG D;  3NQU B;  3LEL C;  4ZBJ B;  4AWL C;  1BH8 B;  5AV6 C;  3UTA C;  4J8U A;  4YM6 A;  5AVC B;  3AYW C;  1ID3 C;  5B24 A;  3MNN C;  5CPI B;  5CPI D;  4LD9 B;  1HQ3 B;  4UUZ B;  1HQ3 D;  5AY8 B;  3AZJ B;  2PYO C;  5GXQ B;  4LD9 D;  5GXQ D;  1N1J A;  5AV9 C;  4WNN B;  3AZF C;  1P3I B;  3W99 B;  3W99 D;  4H9Q A;  5AV5 D;  3X1U C;  3VH6 A;  1EQZ C;  4EO5 C;  5B0Z C;  5BNX B;  1F66 D;  1U35 A;  5B31 G;  5CPJ A;  1KX3 B;  4R8P C;  1KX3 D;  4KGC A;  4J8W C;  5C3I B;  2YFW B;  1KX4 C;  4H9S C;  5DNM A;  3NQJ B;  5FUG A;  3C1C C;  3AYW B;  3MVD C;  3AZE C;  1ID3 B;  1P3F B;  4E44 A;  1P3F D;  4YS3 B;  4J8X A;  4YS3 D;  3MNN B;  1ZLA B;  1ZLA D;  3REK B;  1P34 A;  3REK D;  1M18 A;  1P3A C;  2PYO B;  4KUD C;  1P3B B;  3MGP C;  4H9O B;  1P3B D;  5BO0 B;  3LEL A;  5AV6 A;  3WA9 C;  3UTA A;  4H9N B;  1P3G B;  1P3G D;  4Z5T C;  3AZF B;  3AZN B;  3AZN D;  3REI C;  5B40 C;  3B0C T;  4NE5 A;  2HUE C;  3V9R A;  4EO5 B;  5AV9 A;  5BS7 A;  1TAF A;  3REJ B;  4R8P B;  3REJ D;  1M19 B;  1M19 D;  1P3P B;  3REH A;  1P3P D;  3X1V C;  5E5A B;  4XZQ C;  5E5A D;  1S32 A;  3X1U A;  2ARO C;  1EQZ A;  1P3M C;  3X1S B;  3X1S D;  3AZM B;  3AZM D;  5B0Z A;  3LZ1 C;  4QLC A;  3KWQ A;  3MVD B;  3LZ0 B;  3MVD D;  3LZ0 D;  4J8W A;  5B31 C;  3W96 A;  1P3A B;  1KX4 A;  3VH5 W;  3MGP B;  1AOI A;  3WA9 B;  4H9S A;  1WWS A;  5AVB B;  3C1C A;  5AVB D;  3AV1 B;  3AV1 D;  3AN2 A;  3REI B;  5CHL B;  4KUD A;  4Z66 A;  3AZK A;  3WTP A;  4H9P A;  3MGR A;  4J8U C;  5GSU A;  4YM6 C;  4Z5T A;  5B2J D;  5B24 C;  5KDM A;  3X1V B;  5B40 A;  1TZY A;  3R45 A;  1M1A A;  2ARO B;  1P3M B;  3KUY B;  3KUY D;  3AZG B;  3AZG D;  1JFI B;  1ULY A;  1B6W A;  5CP6 D;  2HIO A;  3MGS A;  2FJ7 C;  4WU9 C;  3B6F A;  3UT9 C;  4XZQ A;  5B31 B;  2RVQ D;  3LZ1 A;  5CPJ C;  1P3O A;  3AFA A;  3W97 B;  3W97 D;  3MGQ C;  2CV5 A;  4J8U B;  4J8U D;  4YM6 B;  4J8V A;  5B24 B;  5B33 A;  3A6N C;  1P34 C;  1R4V A;  2IO5 C;  2F8N H;  4E45 A;  5AV8 A;  5JA4 A;  1N1J B;  4WU8 C;  1KU5 A;  4Z2M H;  5AVC D;  5B1M C;  4H9Q B;  5AY8 D;  3AZJ D;  4NFT A;  3UTB A;  1U35 B;  1U35 D;  5BS7 C;  5CPJ B;  5CPJ D;  3REH C;  4KGC B;  5F99 A;  2FJ7 A;  4H9R A;  3KXB A;  1P3I D;  4KGC D;  4WU9 A;  3VH6 W;  3UT9 A;  1S32 C;  4ZUX C;  2L5A A;  5B1L A;  3O62 A;  3B0D B;  3REL C;  1H3O A;  5DNM B;  5DNN C;  5DNM D;  4QLC C;  2F8N G;  5FUG B;  3KWQ C;  5BT1 C;  4J8X B;  4J8X D;  5B0Y C;  3AZL C;  3MGQ A;  2NQB A;  4Z2M G;  1P34 B;  1M18 B;  3W96 C;  5JRG A;  1M18 D;  4CSR A;  1AOI C;  1KX5 C;  3LEL B;  3LEL D;  4AWL B;  5AV6 B;  5AV6 D;  3UTA B;  3UTA D;  4HGA C;  3AYW D;  3AZH A;  1ID3 D;  3AN2 C;  3A6N A;  3MNN D;  4X23 A;  2PYO D;  4Z66 C;  3V9R B;  3AZK C;  2JSS A;  4WU8 A;  3WTP C;  3TU4 C;  5AV9 B;  5AV9 D;  1P3K C;  3MGR C;  1TAF B;  5GSU C;  3AZI C;  3REH B;  3REH D;  3AZF D;  5B1M A;  5B2I C;  5AV5 A;  1S32 B;  1TZY C;  4KHA A;  1M1A C;  3X1U B;  2NZD C;  3X1U D;  1EQZ B;  1EQZ D;  1BH9 A;  1F66 A;  5B32 G;  5B0Z B;  5B0Z D;  5GT3 C;  4QLC B;  3KWQ B;  3KWQ D;  4R8P D;  3MGS C;  2HIO C;  4J8W B;  4J8W D;  3B6F C;  4NE6 A;  3W96 B;  5G49 A;  1KX4 B;  4ZUX A;  1KX4 D;  1AOI B;  1Q9C A;  3REL A;  5DNN A;  3LJA C;  4XUJ A;  1P3O C;  3C1C B;  3AFA C;  3C1C D;  3AZE B;  3AZE D;  3AN2 B;  3AZL A;  5B0Y A;  2CV5 C;  4CAY A;  1P3A D;  4KUD B;  4KUD D;  4DRA A;  4Z66 B;  3MGP D;  5GT0 C;  3AZK B;  3WTP B;  3AZK D;  4H9P B;  3MGR B;  3WA9 D;  5GSU B;  5GSU D;  4Z5T B;  4Z5T D;  4J8V C;  5B33 C;  1P3L A;  5KDM B;  3REI D;  4JJN C;  5B40 B;  5B40 D;  1TZY B;  3R45 B;  1M1A B;  5AV8 C;  2HUE B;  3TU4 A;  1P3K A;  3MGS B;  2HIO B;  3MGS D;  2HIO D;  3AZI A;  1P3P A;  5CPK A;  5B2I A;  2CWE A;  3B6F B;  4XZQ B;  3X1V D;  4XZQ D;  2NZD A;  1B67 A;  2ARO D;  1P3M D;  3UTB C;  5GT3 A;  3LZ1 B;  1P3O B;  3LZ1 D;  3B6G C;  3AFA B;  5F99 C;  3AFA D;  2BYK A;  3KXB C;  5B32 C;  3X1T C;  2CV5 B;  5B31 D;  5B1L C;  3O62 C;  2CV5 D;  3WAA C;  3LJA A;  4G92 C;  4J8V B;  5B33 B;  4WZS B;  2NQB C;  5JRG C;  2F8N A;  5AV8 B;  5JA4 B;  5AV8 D;  5GT0 A;  4YM6 D;  3AZH C;  5B2J A;  1KX5 A;  3C1B A;  5B24 D;  3WKJ A;  4JJN A;  5BNV A;  4LD9 C;  4X23 C;  3UTB B;  3AV2 A;  5CP6 A;  5F99 B;  2FJ7 B;  4H9R B;  5F99 D;  3KXB B;  3KXB D;  2FJ7 D;  3W99 C;  5AV5 C;  4WU9 D;  3UT9 B;  4WU9 B;  3UT9 D;  3B0C W;  1WWI A;  5B1L B;  3VH5 T;  3O62 B;  1F66 C;  1H3O B;  3B6G A;  1KX3 C;  1A7W A;  3MGQ B;  2NQB B;  2BYM A;  3MGQ D;  2NQB D;  5B32 A;  3X1T A;  4CSR B;  4XUJ C;  3WAA A;  3AZH B;  2YFV A;  3AZH D;  1P3F C;  4YS3 C;  3W98 A;  3A6N B;  3A6N D;  1ZLA C;  3REK C;  4G91 C;  1F1E A;  2IO5 B;  4X23 D;  4X23 B;  3NQU A;  4WV4 B;  1P34 D;  1P3B C;  4WU8 B;  4WU8 D;  1BH8 A;  1P3G C;  5AVC A;  4DRB A;  3AZN C;  5B1M B;  1P3L C;  5B1M D;  5AV5 B;  4KHA B;  5CPI A;  4LD9 A;  1HQ3 A;  4UUZ A;  5AY8 A;  3AZJ A;  2LY8 A;  5GXQ A;  1BH9 B;  1F66 B;  4WNN A;  3REJ C;  1M19 C;  1P3P C;  1P3I A;  5CPK C;  1HTA A;  5E5A C;  3W99 A;  1S32 D;  5G49 B;  4ZUX B;  3X1S C;  4ZUX D;  3AZM C;  5BNX A;  3REL B;  3REL D;  5DNN B;  5DNN D;  4XUJ B;  4XUJ D;  4QLC D;  1KX3 A;  3LZ0 C;  5BT1 D;  2F8N K;  3AZL B;  5B0Y B;  3AZL D;  5B0Y D;  2YFW A;  4G91 B;  4CAY B;  3W96 D;  1AOI D;  3NQJ A;  4HGA B;  5AVB C;  3AYW A;  3AV1 C;  1ID3 A;  1P3F A;  3AN2 D;  4YS3 A;  1P3L B;  1P3L D;  1BFM A;  3MNN A;  1ZLA A;  3REK A;  2PYO A;  1P3B A;  4H9O A;  4Z66 D;  5BO0 A;  3WTP D;  3TU4 B;  3TU4 D;  1P3K B;  1P3K D;  4H9N A;  3MGR D;  1P3G A;  5B2J C;  3AZI B;  3AZI D;  3AZN A;  3C1B C;  3AZF A;  5CPK B;  5B2I B;  5CPK D;  5B2I D;  3WKJ C;  3VH6 T;  2NZD B;  1TZY D;  4M6B A;  1M1A D;  2NZD D; 
#chains in the Genus database with same CATH topology
 1W2E A;  3KUY C;  3AV2 C;  5GT3 B;  3AZG C;  5GT3 D;  3REJ A;  4R8P A;  5CP6 C;  1M19 A;  2BYK B;  3B6F D;  5E5A A;  3X1S A;  4NE3 A;  3AZM A;  3VH5 A;  2RVQ C;  3LJA B;  3LJA D;  1P3O D;  3MVD A;  3AZE A;  3B0B A;  3LZ0 A;  3W97 C;  1P3A A;  2F8N B;  2F8N D;  3MGP A;  5GT0 B;  5GT0 D;  3WA9 A;  5AVB A;  3AV1 A;  5B2J B;  1KX5 B;  1KX5 D;  3C1B B;  4J8V D;  3C1B D;  5B33 D;  3WKJ B;  3REI A;  3W98 C;  3WKJ D;  3EG5 B;  4JJN B;  5BNV B;  4JJN D;  4ZBJ C;  3AV2 B;  3AV2 D;  5AVC C;  5CP6 B;  3X1V A;  5CPI C;  1HQ3 C;  2Y2L A;  2BG1 A;  2ARO A;  5AY8 C;  3AZJ C;  3H0L C;  5GXQ C;  1P3M A;  3UTB D;  1U35 C;  3KUY A;  3AZG A;  3B6G B;  3B6G D;  1JFI A;  4KGC C;  1P3I C;  2BYM B;  5B32 B;  3X1T B;  5B32 D;  2DQN C;  3X1T D;  3WTP E;  5B31 A;  5B1L D;  3O62 D;  3B0D C;  5DNM C;  3WAA B;  3WAA D;  2YFV B;  4G92 B;  3W97 A;  4J8X C;  5C3I C;  3W98 B;  3W98 D;  3KSY A;  2G5H C;  1M18 C;  5JRG B;  5JRG D;  3NQU B;  3AL0 C;  3LEL C;  4ZBJ B;  4AWL C;  1BH8 B;  5AV6 C;  3UTA C;  4J8U A;  4YM6 A;  2Y2Q A;  5AVC B;  3AYW C;  1ID3 C;  5B24 A;  3MNN C;  5CPI B;  2Y2O A;  5CPI D;  1HQ3 B;  4UUZ B;  1HQ3 D;  5AY8 B;  3AZJ B;  2PYO C;  5GXQ B;  4LD9 B;  2ZY4 A;  5GXQ D;  1N1J A;  5AV9 C;  4WNN B;  4DQY B;  3AZF C;  1P3I B;  3W99 B;  3W99 D;  4H9Q A;  5AV5 D;  3X1U C;  3VH6 A;  1EQZ C;  2Y2H A;  4EO5 C;  5B0Z C;  5BNX B;  1F66 D;  1U35 A;  5B31 G;  5CPJ A;  1KX3 B;  4R8P C;  1KX3 D;  4KGC A;  4J8W C;  5C3I B;  3EPL A;  2YFW B;  1KX4 C;  4H9S C;  5DNM A;  3NQJ B;  5FUG A;  3C1C C;  3AYW B;  3MVD C;  3AZE C;  1ID3 B;  1P3F B;  4E44 A;  1P3F D;  4YS3 B;  4J8X A;  4YS3 D;  3MNN B;  1ZLA B;  1ZLA D;  3REK B;  1P34 A;  3REK D;  1M18 A;  1P3A C;  2PYO B;  4KUD C;  1P3B B;  3MGP C;  4H9O B;  1P3B D;  5BO0 B;  3LEL A;  5AV6 A;  3WA9 C;  3UTA A;  4H9N B;  1P3G B;  1P3G D;  4Z5T C;  3AZF B;  3AZN B;  3AZN D;  3REI C;  5B40 C;  3B0C T;  4NE5 A;  2HUE C;  3V9R A;  4EO5 B;  5AV9 A;  5BS7 A;  1TAF A;  3REJ B;  4R8P B;  3REJ D;  1M19 B;  3KFU G;  1M19 D;  1P3P B;  3REH A;  1P3P D;  3X1V C;  5E5A B;  4XZQ C;  5E5A D;  1S32 A;  3X1U A;  2ARO C;  1EQZ A;  1P3M C;  3X1S B;  3X1S D;  3AZM B;  3AZM D;  5B0Z A;  3LZ1 C;  4QLC A;  3KWQ A;  3MVD B;  3LZ0 B;  1PZR A;  3LZ0 D;  3MVD D;  4J8W A;  2F2A C;  5B31 C;  3W96 A;  3H0M C;  1P3A B;  1KX4 A;  3VH5 W;  3MGP B;  1AOI A;  3WA9 B;  4H9S A;  1WWS A;  5AVB B;  3C1C A;  5AVB D;  3AV1 B;  3AV1 D;  3AN2 A;  3REI B;  5CHL B;  4KUD A;  2VQR A;  4Z66 A;  3AZK A;  3WTP A;  4H9P A;  3MGR A;  4J8U C;  5GSU A;  4YM6 C;  4Z5T A;  5B2J D;  5B24 C;  5KDM A;  3X1V B;  5B40 A;  1TZY A;  3R45 A;  1M1A A;  2ARO B;  1P3M B;  3KUY B;  3KUY D;  3AZG B;  3AZG D;  1JFI B;  1ULY A;  1B6W A;  5CP6 D;  2HIO A;  3MGS A;  2FJ7 C;  4WU9 C;  3B6F A;  3UT9 C;  4XZQ A;  5B31 B;  2ZY3 A;  2RVQ D;  3LZ1 A;  5CPJ C;  1P3O A;  2J8P A;  3AFA A;  3W97 B;  3W97 D;  3MGQ C;  2Y2N A;  3EPJ A;  2CV5 A;  2JCH A;  4J8U B;  4J8U D;  4YM6 B;  4J8V A;  5B24 B;  5B33 A;  3A6N C;  1P34 C;  1R4V A;  2IO5 C;  2F8N H;  4E45 A;  5AV8 A;  5JA4 A;  1N1J B;  4WU8 C;  1KU5 A;  4Z2M H;  5AVC D;  5B1M C;  4H9Q B;  5AY8 D;  3AZJ D;  4NFT A;  1Z2C B;  3UTB A;  1U35 B;  1U35 D;  5BS7 C;  5CPJ B;  5CPJ D;  3REH C;  4KGC B;  5F99 A;  2FJ7 A;  4H9R A;  3KXB A;  1P3I D;  4KGC D;  4WU9 A;  3VH6 W;  3UT9 A;  1S32 C;  2JE5 A;  2W8S A;  4ZUX C;  2L5A A;  5B1L A;  3O62 A;  2Y2G A;  3B0D B;  3REL C;  1H3O A;  5DNM B;  5DNN C;  5DNM D;  4QLC C;  3EPH A;  2F8N G;  5FUG B;  3KWQ C;  4WJ3 C;  5BT1 C;  4J8X B;  4J8X D;  5B0Y C;  3AZL C;  3MGQ A;  2NQB A;  4Z2M G;  1P34 B;  1M18 B;  3W96 C;  5JRG A;  1M18 D;  4CSR A;  1AOI C;  1KX5 C;  3LEL B;  3A1I A;  3LEL D;  4AWL B;  5AV6 B;  5AV6 D;  3UTA B;  3UTA D;  4HGA C;  3AYW D;  3F6T A;  3AZH A;  1ID3 D;  3AN2 C;  3A6N A;  1T3U A;  3MNN D;  4X23 A;  2PYO D;  4Z66 C;  3V9R B;  3AZK C;  2JSS A;  4WU8 A;  3WTP C;  3TU4 C;  5AV9 B;  5AV9 D;  1P3K C;  3MGR C;  1TAF B;  5GSU C;  3AZI C;  3REH B;  3REH D;  3AZF D;  5B1M A;  5B2I C;  5AV5 A;  1S32 B;  1TZY C;  4KHA A;  1M1A C;  3X1U B;  2NZD C;  3X1U D;  1EQZ B;  1EQZ D;  1BH9 A;  1F66 A;  5B32 G;  5B0Z B;  5B0Z D;  5GT3 C;  4QLC B;  3KWQ B;  3KWQ D;  4R8P D;  3MGS C;  2HIO C;  4J8W B;  4J8W D;  3B6F C;  4NE6 A;  3W96 B;  5G49 A;  1KX4 B;  2XD5 A;  4ZUX A;  1KX4 D;  1AOI B;  1Q9C A;  3REL A;  5DNN A;  3LJA C;  4XUJ A;  1P3O C;  3C1C B;  3AFA C;  2ZY2 A;  3C1C D;  3AZE B;  3AZE D;  3AN2 B;  3AZL A;  5B0Y A;  2CV5 C;  4CAY A;  1P3A D;  4KUD B;  4KUD D;  4DRA A;  4Z66 B;  3MGP D;  5GT0 C;  3AZK B;  3WTP B;  3AZK D;  4H9P B;  3MGR B;  3WA9 D;  5GSU B;  5GSU D;  4Z5T B;  4Z5T D;  4J8V C;  5B33 C;  1P3L A;  5KDM B;  3REI D;  4JJN C;  5B40 B;  5B40 D;  1TZY B;  3R45 B;  1M1A B;  5AV8 C;  2HUE B;  3TU4 A;  1P3K A;  3P5J B;  2G5I C;  3FDD A;  3MGS B;  2HIO B;  3MGS D;  2HIO D;  3AZI A;  1P3P A;  5CPK A;  5B2I A;  2CWE A;  3B6F B;  4XZQ B;  3X1V D;  4XZQ D;  2NZD A;  1B67 A;  2ARO D;  1P3M D;  3UTB C;  5GT3 A;  3LZ1 B;  1P3O B;  3LZ1 D;  3B6G C;  3AFA B;  5F99 C;  3AFA D;  2BYK A;  3KXB C;  2UWX A;  2RIQ A;  5B32 C;  3X1T C;  2CV5 B;  5B31 D;  5B1L C;  3O62 C;  2CV5 D;  2Y2M A;  3WAA C;  3LJA A;  4G92 C;  4J8V B;  5B33 B;  4WZS B;  4LD9 D;  2NQB C;  5JRG C;  2F8N A;  5AV8 B;  5JA4 B;  5AV8 D;  5GT0 A;  4YM6 D;  3AZH C;  5B2J A;  1KX5 A;  3C1B A;  5B24 D;  3WKJ A;  4JJN A;  5BNV A;  4LD9 C;  4X23 C;  3UTB B;  2Y2P A;  3AV2 A;  4UPK A;  5CP6 A;  5F99 B;  2FJ7 B;  4H9R B;  5F99 D;  3KXB B;  3KXB D;  2FJ7 D;  3W99 C;  5AV5 C;  4WU9 D;  3UT9 B;  4WU9 B;  3UT9 D;  3B0C W;  1WWI A;  5B1L B;  3VH5 T;  3O62 B;  1F66 C;  1H3O B;  3B6G A;  1KX3 C;  1A7W A;  2ZY5 A;  3MGQ B;  2NQB B;  2BYM A;  3MGQ D;  2NQB D;  5B32 A;  3X1T A;  4CSR B;  2ZM5 A;  3IP4 C;  4XUJ C;  3WAA A;  3AZH B;  2YFV A;  3AZH D;  3H0R C;  1P3F C;  4YS3 C;  3W98 A;  3A6N B;  3A6N D;  1ZLA C;  3REK C;  1F1E A;  2IO5 B;  4G91 C;  4X23 D;  4X23 B;  3NQU A;  4WV4 B;  1P34 D;  1P3B C;  4WU8 B;  4WU8 D;  1BH8 A;  1P3G C;  5AVC A;  4DRB A;  3AZN C;  5B1M B;  1P3L C;  5B1M D;  5AV5 B;  4KHA B;  5CPI A;  2Y2J A;  4LD9 A;  1HQ3 A;  4UUZ A;  5AY8 A;  3AZJ A;  2LY8 A;  5GXQ A;  1BH9 B;  1F66 B;  4WNN A;  3REJ C;  1M19 C;  1P3P C;  1P3I A;  5CPK C;  1HTA A;  5E5A C;  3W99 A;  1S32 D;  5G49 B;  4ZUX B;  3X1S C;  4ZUX D;  3AZM C;  5BNX A;  3REL B;  3EPK A;  5DNN B;  3REL D;  5DNN D;  4XUJ B;  2XD1 A;  4XUJ D;  4QLC D;  1KX3 A;  3LZ0 C;  5BT1 D;  2DF4 C;  2F8N K;  3AZL B;  5B0Y B;  3AZL D;  5B0Y D;  3A1K A;  2YFW A;  4G91 B;  4CAY B;  3W96 D;  1AOI D;  3NQJ A;  4HGA B;  5AVB C;  3AYW A;  3AV1 C;  1ID3 A;  1P3F A;  3AN2 D;  4YS3 A;  1P3L B;  1P3L D;  1BFM A;  3MNN A;  1ZLA A;  3REK A;  2PYO A;  1P3B A;  4H9O A;  4Z66 D;  5BO0 A;  2Y2I A;  3WTP D;  3TU4 B;  3TU4 D;  1P3K B;  1P3K D;  4H9N A;  2Y2K A;  3MGR D;  1P3G A;  2FFF B;  5B2J C;  3AZI B;  3AZI D;  3AZN A;  3C1B C;  3AZF A;  5CPK B;  5B2I B;  5CPK D;  5B2I D;  3WKJ C;  3VH6 T;  2NZD B;  1TZY D;  4M6B A;  1M1A D;  2NZD D; 
#chains in the Genus database with same CATH homology
 1W2E A;  3KUY C;  3AV2 C;  5GT3 B;  3AZG C;  5GT3 D;  3REJ A;  4R8P A;  5CP6 C;  1M19 A;  2BYK B;  3B6F D;  5E5A A;  3X1S A;  4NE3 A;  3AZM A;  3VH5 A;  2RVQ C;  3LJA B;  3LJA D;  1P3O D;  3MVD A;  3AZE A;  3B0B A;  3LZ0 A;  3W97 C;  1P3A A;  2F8N B;  2F8N D;  3MGP A;  5GT0 B;  5GT0 D;  3WA9 A;  5AVB A;  3AV1 A;  5B2J B;  1KX5 B;  1KX5 D;  3C1B B;  4J8V D;  3C1B D;  5B33 D;  3WKJ B;  3REI A;  3W98 C;  3WKJ D;  3EG5 B;  4JJN B;  5BNV B;  4JJN D;  4ZBJ C;  3AV2 B;  3AV2 D;  5AVC C;  5CP6 B;  3X1V A;  5CPI C;  1HQ3 C;  2Y2L A;  2BG1 A;  2ARO A;  5AY8 C;  3AZJ C;  3H0L C;  5GXQ C;  1P3M A;  3UTB D;  1U35 C;  3KUY A;  3AZG A;  3B6G B;  3B6G D;  1JFI A;  4KGC C;  1P3I C;  2BYM B;  5B32 B;  3X1T B;  5B32 D;  2DQN C;  3X1T D;  3WTP E;  5B31 A;  5B1L D;  3O62 D;  3B0D C;  5DNM C;  3WAA B;  3WAA D;  2YFV B;  4G92 B;  3W97 A;  4J8X C;  5C3I C;  3W98 B;  3W98 D;  3KSY A;  2G5H C;  1M18 C;  5JRG B;  5JRG D;  3NQU B;  3AL0 C;  3LEL C;  4ZBJ B;  4AWL C;  1BH8 B;  5AV6 C;  3UTA C;  4J8U A;  4YM6 A;  2Y2Q A;  5AVC B;  3AYW C;  1ID3 C;  5B24 A;  3MNN C;  5CPI B;  2Y2O A;  5CPI D;  1HQ3 B;  4UUZ B;  1HQ3 D;  5AY8 B;  3AZJ B;  2PYO C;  5GXQ B;  4LD9 B;  2ZY4 A;  5GXQ D;  1N1J A;  5AV9 C;  4WNN B;  4DQY B;  3AZF C;  1P3I B;  3W99 B;  3W99 D;  4H9Q A;  5AV5 D;  3X1U C;  3VH6 A;  1EQZ C;  2Y2H A;  4EO5 C;  5B0Z C;  5BNX B;  1F66 D;  1U35 A;  5B31 G;  5CPJ A;  1KX3 B;  4R8P C;  1KX3 D;  4KGC A;  4J8W C;  5C3I B;  3EPL A;  2YFW B;  1KX4 C;  4H9S C;  5DNM A;  3NQJ B;  5FUG A;  3C1C C;  3AYW B;  3MVD C;  3AZE C;  1ID3 B;  1P3F B;  4E44 A;  1P3F D;  4YS3 B;  4J8X A;  4YS3 D;  3MNN B;  1ZLA B;  1ZLA D;  3REK B;  1P34 A;  3REK D;  1M18 A;  1P3A C;  2PYO B;  4KUD C;  1P3B B;  3MGP C;  4H9O B;  1P3B D;  5BO0 B;  3LEL A;  5AV6 A;  3WA9 C;  3UTA A;  4H9N B;  1P3G B;  1P3G D;  4Z5T C;  3AZF B;  3AZN B;  3AZN D;  3REI C;  5B40 C;  3B0C T;  4NE5 A;  2HUE C;  3V9R A;  4EO5 B;  5AV9 A;  5BS7 A;  1TAF A;  3REJ B;  4R8P B;  3REJ D;  1M19 B;  3KFU G;  1M19 D;  1P3P B;  3REH A;  1P3P D;  3X1V C;  5E5A B;  4XZQ C;  5E5A D;  1S32 A;  3X1U A;  2ARO C;  1EQZ A;  1P3M C;  3X1S B;  3X1S D;  3AZM B;  3AZM D;  5B0Z A;  3LZ1 C;  4QLC A;  3KWQ A;  3MVD B;  3LZ0 B;  1PZR A;  3LZ0 D;  3MVD D;  4J8W A;  2F2A C;  5B31 C;  3W96 A;  3H0M C;  1P3A B;  1KX4 A;  3VH5 W;  3MGP B;  1AOI A;  3WA9 B;  4H9S A;  1WWS A;  5AVB B;  3C1C A;  5AVB D;  3AV1 B;  3AV1 D;  3AN2 A;  3REI B;  5CHL B;  4KUD A;  2VQR A;  4Z66 A;  3AZK A;  3WTP A;  4H9P A;  3MGR A;  4J8U C;  5GSU A;  4YM6 C;  4Z5T A;  5B2J D;  5B24 C;  5KDM A;  3X1V B;  5B40 A;  1TZY A;  3R45 A;  1M1A A;  2ARO B;  1P3M B;  3KUY B;  3KUY D;  3AZG B;  3AZG D;  1JFI B;  1ULY A;  1B6W A;  5CP6 D;  2HIO A;  3MGS A;  2FJ7 C;  4WU9 C;  3B6F A;  3UT9 C;  4XZQ A;  5B31 B;  2ZY3 A;  2RVQ D;  3LZ1 A;  5CPJ C;  1P3O A;  2J8P A;  3AFA A;  3W97 B;  3W97 D;  3MGQ C;  2Y2N A;  3EPJ A;  2CV5 A;  2JCH A;  4J8U B;  4J8U D;  4YM6 B;  4J8V A;  5B24 B;  5B33 A;  3A6N C;  1P34 C;  1R4V A;  2IO5 C;  2F8N H;  4E45 A;  5AV8 A;  5JA4 A;  1N1J B;  4WU8 C;  1KU5 A;  4Z2M H;  5AVC D;  5B1M C;  4H9Q B;  5AY8 D;  3AZJ D;  4NFT A;  1Z2C B;  3UTB A;  1U35 B;  1U35 D;  5BS7 C;  5CPJ B;  5CPJ D;  3REH C;  4KGC B;  5F99 A;  2FJ7 A;  4H9R A;  3KXB A;  1P3I D;  4KGC D;  4WU9 A;  3VH6 W;  3UT9 A;  1S32 C;  2JE5 A;  2W8S A;  4ZUX C;  2L5A A;  5B1L A;  3O62 A;  2Y2G A;  3B0D B;  3REL C;  1H3O A;  5DNM B;  5DNN C;  5DNM D;  4QLC C;  3EPH A;  2F8N G;  5FUG B;  3KWQ C;  4WJ3 C;  5BT1 C;  4J8X B;  4J8X D;  5B0Y C;  3AZL C;  3MGQ A;  2NQB A;  4Z2M G;  1P34 B;  1M18 B;  3W96 C;  5JRG A;  1M18 D;  4CSR A;  1AOI C;  1KX5 C;  3LEL B;  3A1I A;  3LEL D;  4AWL B;  5AV6 B;  5AV6 D;  3UTA B;  3UTA D;  4HGA C;  3AYW D;  3F6T A;  3AZH A;  1ID3 D;  3AN2 C;  3A6N A;  1T3U A;  3MNN D;  4X23 A;  2PYO D;  4Z66 C;  3V9R B;  3AZK C;  2JSS A;  4WU8 A;  3WTP C;  3TU4 C;  5AV9 B;  5AV9 D;  1P3K C;  3MGR C;  1TAF B;  5GSU C;  3AZI C;  3REH B;  3REH D;  3AZF D;  5B1M A;  5B2I C;  5AV5 A;  1S32 B;  1TZY C;  4KHA A;  1M1A C;  3X1U B;  2NZD C;  3X1U D;  1EQZ B;  1EQZ D;  1BH9 A;  1F66 A;  5B32 G;  5B0Z B;  5B0Z D;  5GT3 C;  4QLC B;  3KWQ B;  3KWQ D;  4R8P D;  3MGS C;  2HIO C;  4J8W B;  4J8W D;  3B6F C;  4NE6 A;  3W96 B;  5G49 A;  1KX4 B;  2XD5 A;  4ZUX A;  1KX4 D;  1AOI B;  1Q9C A;  3REL A;  5DNN A;  3LJA C;  4XUJ A;  1P3O C;  3C1C B;  3AFA C;  2ZY2 A;  3C1C D;  3AZE B;  3AZE D;  3AN2 B;  3AZL A;  5B0Y A;  2CV5 C;  4CAY A;  1P3A D;  4KUD B;  4KUD D;  4DRA A;  4Z66 B;  3MGP D;  5GT0 C;  3AZK B;  3WTP B;  3AZK D;  4H9P B;  3MGR B;  3WA9 D;  5GSU B;  5GSU D;  4Z5T B;  4Z5T D;  4J8V C;  5B33 C;  1P3L A;  5KDM B;  3REI D;  4JJN C;  5B40 B;  5B40 D;  1TZY B;  3R45 B;  1M1A B;  5AV8 C;  2HUE B;  3TU4 A;  1P3K A;  3P5J B;  2G5I C;  3FDD A;  3MGS B;  2HIO B;  3MGS D;  2HIO D;  3AZI A;  1P3P A;  5CPK A;  5B2I A;  2CWE A;  3B6F B;  4XZQ B;  3X1V D;  4XZQ D;  2NZD A;  1B67 A;  2ARO D;  1P3M D;  3UTB C;  5GT3 A;  3LZ1 B;  1P3O B;  3LZ1 D;  3B6G C;  3AFA B;  5F99 C;  3AFA D;  2BYK A;  3KXB C;  2UWX A;  2RIQ A;  5B32 C;  3X1T C;  2CV5 B;  5B31 D;  5B1L C;  3O62 C;  2CV5 D;  2Y2M A;  3WAA C;  3LJA A;  4G92 C;  4J8V B;  5B33 B;  4WZS B;  4LD9 D;  2NQB C;  5JRG C;  2F8N A;  5AV8 B;  5JA4 B;  5AV8 D;  5GT0 A;  4YM6 D;  3AZH C;  5B2J A;  1KX5 A;  3C1B A;  5B24 D;  3WKJ A;  4JJN A;  5BNV A;  4LD9 C;  4X23 C;  3UTB B;  2Y2P A;  3AV2 A;  4UPK A;  5CP6 A;  5F99 B;  2FJ7 B;  4H9R B;  5F99 D;  3KXB B;  3KXB D;  2FJ7 D;  3W99 C;  5AV5 C;  4WU9 D;  3UT9 B;  4WU9 B;  3UT9 D;  3B0C W;  1WWI A;  5B1L B;  3VH5 T;  3O62 B;  1F66 C;  1H3O B;  3B6G A;  1KX3 C;  1A7W A;  2ZY5 A;  3MGQ B;  2NQB B;  2BYM A;  3MGQ D;  2NQB D;  5B32 A;  3X1T A;  4CSR B;  2ZM5 A;  3IP4 C;  4XUJ C;  3WAA A;  3AZH B;  2YFV A;  3AZH D;  3H0R C;  1P3F C;  4YS3 C;  3W98 A;  3A6N B;  3A6N D;  1ZLA C;  3REK C;  1F1E A;  2IO5 B;  4G91 C;  4X23 D;  4X23 B;  3NQU A;  4WV4 B;  1P34 D;  1P3B C;  4WU8 B;  4WU8 D;  1BH8 A;  1P3G C;  5AVC A;  4DRB A;  3AZN C;  5B1M B;  1P3L C;  5B1M D;  5AV5 B;  4KHA B;  5CPI A;  2Y2J A;  4LD9 A;  1HQ3 A;  4UUZ A;  5AY8 A;  3AZJ A;  2LY8 A;  5GXQ A;  1BH9 B;  1F66 B;  4WNN A;  3REJ C;  1M19 C;  1P3P C;  1P3I A;  5CPK C;  1HTA A;  5E5A C;  3W99 A;  1S32 D;  5G49 B;  4ZUX B;  3X1S C;  4ZUX D;  3AZM C;  5BNX A;  3REL B;  3EPK A;  5DNN B;  3REL D;  5DNN D;  4XUJ B;  2XD1 A;  4XUJ D;  4QLC D;  1KX3 A;  3LZ0 C;  5BT1 D;  2DF4 C;  2F8N K;  3AZL B;  5B0Y B;  3AZL D;  5B0Y D;  3A1K A;  2YFW A;  4G91 B;  4CAY B;  3W96 D;  1AOI D;  3NQJ A;  4HGA B;  5AVB C;  3AYW A;  3AV1 C;  1ID3 A;  1P3F A;  3AN2 D;  4YS3 A;  1P3L B;  1P3L D;  1BFM A;  3MNN A;  1ZLA A;  3REK A;  2PYO A;  1P3B A;  4H9O A;  4Z66 D;  5BO0 A;  2Y2I A;  3WTP D;  3TU4 B;  3TU4 D;  1P3K B;  1P3K D;  4H9N A;  2Y2K A;  3MGR D;  1P3G A;  2FFF B;  5B2J C;  3AZI B;  3AZI D;  3AZN A;  3C1B C;  3AZF A;  5CPK B;  5B2I B;  5CPK D;  5B2I D;  3WKJ C;  3VH6 T;  2NZD B;  1TZY D;  4M6B A;  1M1A D;  2NZD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...