5B32D

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32D00
5AV8C 3NQUB 5C3IC 3AZGB 3UT9C 3AZGD 5B32D 1F66D 4H9OB 3W96A 4J8VB 5B2JA 3KWQB 4Z2MH 3W99C 3REKC 3V9RB 5F99B 3KUYC 4CSRB 3X1SB 1P34A 3KXBA 1U35D 5DNNC 3MNND 5GT0B 4EO5B 3MGRB 3UTAB 4KHAA 1P3MA 5B1MB 4XUJA 3LZ1C 5AV9B 3UTBD 2BYKA 3B0CW 5AV9D 4X23C 3O62A 3AZKA 4E45A 2FJ7C 3C1CD 4XZQC 3B0CT 4J8WB 3W99D 4J8WD 5CPIA 3AN2B 4G92C 5AY8D 3AYWC 1P3BB 5FUGB 2F8NA 1EQZB 3W98A 1P3LA 4WU8A 1P3IA 1AOIA 5B33A 3AV1B 2AROC 3X1VB 3WA9A 3X1VD 5E5AC 5AV6A 1Q9CA 1P3AA 5GT3A 1BH8B 5CPJC 3LJAC 3AZFB 3AZFD 3AFAD 3AZHB 3AZHD 1M19B 4QLCA 1M19D 3B6GC 3X1TA 4G91C 5GXQB 5BO0B 1P3PD 5GSUC 1KX3C 3AZLB 3AZLD 5B40C 5KDMA 3LJAD 5CPKC 3LZ0B 3REHA 3LZ0D 5AV5D 4Z66A 5JA4B 4ZUXA 4R8PB 1H3OA 4R8PD 1P3KB 3B6GD 1HQ3B 3WTPA 3W96C 3TU4B 1ZLAD 2NZDB 3REJB 3KSYA 5B2JC 5CP6A 3REJD 1ULYA 5B24B 4LD9A 3AZNA 2IO5B 4M6BA 1B6WA 3KXBC 1P34C 4H9PB 3AZIA 3UT9A 5B31A 4JJNB 4JJND 2L5AA 4H9QA 3AZJC 5CHLB 4XUJC 4AWLB 3W96D 3B6FB 3AZKC 3O62C 3B6FD 4J8XB 3KUYA 5CPIC 3W97D 3V9RA 3VH5W 5F99A 4CSRA 3VH5T 3W98C 3NQJB 5AVCA 4WU8C 1P3IC 1P3LC 1AOIC 4YM6A 3MVDB 5BS7A 3MVDD 3WA9C 5B2IB 3MGQB 5B2ID 5GT0A 5AV6C 3LZ1A 3LELB 5GT3C 3MGQD 3UTAA 1P3MD 1M18B 2NQBA 1M18D 5B1MA 1R4VA 4H9RB 4QLCC 4KUDD 5B0ZB 3X1TC 1P3OA 3WAAB 1KX5B 1M1AA 5FUGA 4WU8D 5B33D 4J8UA 3AV2B 1B67A 4KGCA 1P3FA 1TZYA 1P3AD 3RELB 5JRGD 3REHC 1JFIB 4HGAB 4Z66C 4ZUXC 3X1UA 3C1BB 3C1BD 5DNMA 3X1TD 3WTPC 5CP6C 2YFVB 5B1LB 5GXQA 4LD9C 5B1LD 1KX4B 5AVBB 3MGPA 5B0YB 1ID3A 5B0YD 1BH9A 3AZIC 5B32B 5B31C 4UUZB 1F66B 3AZEA 5JA4A 3WKJD 3AZMB 4J8VC 3AZMD 3VH5A 4LD9D 3KWQC 5B24A 3AZND 5AV8B 4ZBJC 1P3GA 5AV8D 5F99C 3WTPE 4H9NA 3MNNB 1U35B 3UT9D 3X1SC 5B31D 4H9PA 5AVCC 3AZJA 4YM6C 5BS7C 3UTBB 5GT0C 4EO5C 3MGRC 3UTAC 3C1CB 2NQBC 3W99B 4YS3A 5B1MC 3REKD 3B0DC 5G49B 5AY8B 2CV5D 3KUYD 1A7WA 2PYOA 3REIA 1P3OC 4WV4B 5DNND 1M1AC 1P3BC 2HIOA 1EQZC 4J8UC 4KGCC 1P3FC 1TZYC 3LZ1D 4X23D 4CAYA 3AFAB 5BNXB 2FJ7D 3LELA 4XZQD 3AYWD 3X1UC 4Z5TA 4H9RA 5DNMC 5B32G 1P3PB 1P3OD 4Z2MG 1F1EA 2AROD 5E5AB 5GXQC 1KX5A 1N1JA 5E5AD 1S32A 5BNVB 5CPJB 5CPJD 3LJAB 3MGSA 3MGPC 1TZYD 5AV5B 1ID3C 3R45B 2YFWB 3B6GB 4DRBA 4G91B 3AZEC 1ZLAB 3A6NA 5GSUB 1KX3B 5GSUD 4WU9A 1KX3D 3TU4C 2NZDC 4WNNB 5B40D 5B24C 5CPKB 5CPKD 1P3GC 3MGPD 2CV5A 1KX4A 2IO5C 2CWEA 3NQUA 3AZGA 3W96B 4H9OA 5B2JD 4J8VA 4YS3C 3W97B 3KWQA 4J8XC 1P34B 1P34D 3KXBD 2PYOC 3REIC 3X1SA 1U35A 3MNNA 3AZJD 2HIOC 4KHAB 3MGRA 1P3MB 4XUJD 2BYKB 3O62B 3AZKD 4DRAA 3O62D 3UTBA 5AV9A 3LELC 4YS3D 5CPID 4KUDB 4J8WA 3AN2A 2F8NB 4Z5TC 5AY8A 2F8ND 1WWSA 4NFTA 1P3BA 3W98B 3W98D 4WU8B 1P3IB 5B0ZC 5B33B 1P3ID 1P3LD 1AOID 1EQZA 3WA9D 2F8NH 1KX5C 5AV6D 2HIOD 5GT3B 1S32C 5GT3D 3MGSC 3AV1A 5JRGB 3X1VA 1P3AB 2RVQC 1BH8A 3B0BA 3AZFA 3AFAA 2JSSA 4QLCB 4QLCD 3AZHA 3X1TB 4HGAC 1M19A 3A6NC 4WU9C 1BFMA 5BO0A 1P3PA 3AZLA 5KDMB 3MGSD 2HUEC 3REHD 5BNVA 2CV5C 1KX4C 5AVBC 4ZUXB 4Z66D 3LZ0A 5AV5A 4ZUXD 1H3OB 3AZGC 5B32C 3WKJB 4R8PA 1F66C 3WTPD 1P3KA 1HQ3A 1ZLAA 3A6ND 5CP6D 3TU4A 2LY8A 2NZDA 4LD9B 3REJA 3AZNB 5C3IB 3UT9B 3AZID 5B31B 4H9QB 1U35C 3MNNC 4JJNA 2F8NG 3REKB 3UTBC 5AV9C 3KUYB 3B6FA 4J8VD 4J8XA 3C1CC 1KU5A 3KWQD 4J8WC 4ZBJB 3AN2C 3W97A 5AY8C 5F99D 5DNNB 3X1SD 5AVCB 5AVCD 4WZSB 2BYMB 4YM6B 4YM6D 3NQJA 3LZ1B 3MVDA 5GT0D 3UTAD 4X23B 3MGRD 3AV1C 3X1VC 5B2IA 3MGQA 2FJ7B 4XZQB 2NQBB 2NQBD 5B1MD 4G92B 3B0DB 3AZFC 3AYWB 1M18A 3AFAC 3VH6W 3AZHC 3VH6T 1P3OB 3AN2D 1M19C 4KUDA 5B0ZA 1M1AB 1M1AD 1P3BD 2AROB 3WAAA 1P3PC 4E44A 4J8UB 1EQZD 4J8UD 4KGCB 3AZLC 1TZYB 1P3FB 1P3FD 4KGCD 3AV2A 1WWIA 3AV1D 3RELA 5JRGA 1JFIA 3LZ0C 5AV5C 3X1UB 3X1UD 4R8PC 5DNMB 5DNMD 5B31G 1P3KC 3C1BA 1HQ3C 1ZLAC 1TAFB 3REJC 5GXQD 5B40B 2YFVA 5B1LA 3MGPB 4H9SA 1ID3B 1BH9B 1ID3D 5AVBA 5B0YA 5B32A 4UUZA 3AZEB 1F66A 3AZED 4JJNC 5B2JB 1P3KD 3WKJA 1HQ3D 4AWLC 3TU4D 3B6FC 2NZDD 3KXBB 3AZMA 5B24D 1P3GB 3W97C 1P3GD 4H9NB 1HTAA 4NE5A 5AV8A 3AZJB 4XUJB 3MVDC 3AZKB 5BT1C 5B2IC 3MGQC 1P3MC 3VH6A 4YS3B 5CPIB 2F8NK 3C1CA 1M18C 3W99A 3REKA 4J8XD 5G49A 2PYOB 3REIB 2PYOD 3REID 4KUDC 1P3LB 1AOIB 3WA9B 5DNNA 3WAAC 2HIOB 5AV6B 5B33C 2BYMA 3AV2C 4CAYB 5BT1D 1P3AC 4X23A 3LELD 3RELC 5JRGC 2FJ7A 5BNXA 4XZQA 4Z5TB 4Z5TD 3AYWA 4NE6A 3C1BC 5B0ZD 1N1JB 1S32B 1KX5D 3WAAD 1S32D 2AROA 3MGSB 5B1LC 5E5AA 3REHB 2RVQD 4H9SC 5CPJA 3AV2D 3LJAA 4Z66B 5B0YC 3RELD 3WTPB 3R45A 2YFWA 3B6GA 3A6NB 5CP6B 4WU9B 3WKJC 4WU9D 5GSUA 1KX3A 3AZMC 4WNNA 3AZIB 1TAFA 2HUEB 5B40A 2CV5B 1KX4D 4NE3A 3AZNC 5CPKA 5AVBD
chains in the Genus database with same CATH superfamily
5AV8C 3NQUB 2XD1A 5C3IC 3AZGB 3UT9C 3AZGD 5B32D 1F66D 4H9OB 2ZY2A 3W96A 4J8VB 5B2JA 3KWQB 4Z2MH 3W99C 3REKC 3V9RB 5F99B 3KUYC 4CSRB 3X1SB 1P34A 3KXBA 2DF4C 1U35D 5DNNC 3MNND 5GT0B 4EO5B 3MGRB 3UTAB 4KHAA 1P3MA 5B1MB 4XUJA 3LZ1C 5AV9B 3UTBD 2BYKA 3B0CW 5AV9D 4X23C 2FFFB 3O62A 3AZKA 4E45A 2FJ7C 3C1CD 4XZQC 3B0CT 4J8WB 3W99D 4J8WD 5CPIA 3AN2B 3P5JB 4G92C 5AY8D 3AYWC 1P3BB 5FUGB 2F8NA 1EQZB 3W98A 1P3LA 4WU8A 1P3IA 1AOIA 5B33A 3AV1B 2AROC 3X1VB 3WA9A 3X1VD 5E5AC 5AV6A 1Q9CA 1P3AA 5GT3A 1BH8B 5CPJC 3LJAC 3AZFB 3AZFD 3AFAD 3AZHB 3AZHD 1M19B 4QLCA 1M19D 3B6GC 3X1TA 4G91C 5GXQB 5BO0B 1P3PD 5GSUC 1KX3C 3AZLB 3AZLD 5B40C 2J8PA 5KDMA 3LJAD 5CPKC 3LZ0B 3REHA 3LZ0D 5AV5D 2BG1A 4Z66A 5JA4B 3IP4C 4ZUXA 4R8PB 1H3OA 4R8PD 1P3KB 3B6GD 1HQ3B 3WTPA 3W96C 3TU4B 1ZLAD 2NZDB 3F6TA 3REJB 3KSYA 5B2JC 5CP6A 3REJD 1ULYA 5B24B 4LD9A 3AZNA 2IO5B 4M6BA 1B6WA 3KXBC 1P34C 4H9PB 3AZIA 3UT9A 5B31A 4WJ3C 2Y2GA 4JJNB 4JJND 2DQNC 2L5AA 4H9QA 3AZJC 5CHLB 4XUJC 4AWLB 3W96D 3B6FB 3AZKC 3O62C 3B6FD 4J8XB 3KUYA 5CPIC 3W97D 1PZRA 3V9RA 3VH5W 5F99A 4CSRA 3VH5T 3W98C 3NQJB 5AVCA 4WU8C 1P3IC 1P3LC 1AOIC 4YM6A 3MVDB 5BS7A 3MVDD 3WA9C 5B2IB 3MGQB 5B2ID 5GT0A 5AV6C 3LZ1A 3LELB 5GT3C 3MGQD 3UTAA 1P3MD 1M18B 2NQBA 1M18D 5B1MA 1R4VA 4H9RB 4QLCC 4KUDD 5B0ZB 3X1TC 1P3OA 2F2AC 3WAAB 1KX5B 1M1AA 5FUGA 4WU8D 5B33D 4J8UA 3AV2B 1B67A 4KGCA 2XD5A 1TZYA 1P3FA 1P3AD 3RELB 5JRGD 3REHC 1JFIB 4HGAB 4Z66C 4ZUXC 2G5IC 3X1UA 2ZY4A 3C1BB 3C1BD 5DNMA 3X1TD 3WTPC 3A1IA 5CP6C 2YFVB 5B1LB 5GXQA 4LD9C 2Y2QA 5B1LD 1KX4B 2Y2PA 2Y2HA 5AVBB 3MGPA 5B0YB 1ID3A 5B0YD 1BH9A 3AZIC 5B32B 5B31C 4UUZB 1F66B 3AZEA 5JA4A 3WKJD 2JCHA 3AZMB 4J8VC 3AZMD 3FDDA 3VH5A 4LD9D 2ZM5A 3KWQC 5B24A 3AZND 5AV8B 4ZBJC 1P3GA 5AV8D 5F99C 3WTPE 4H9NA 3MNNB 1U35B 1Z2CB 3UT9D 3X1SC 5B31D 4H9PA 5AVCC 3AZJA 4YM6C 5BS7C 3UTBB 5GT0C 4EO5C 3MGRC 3UTAC 3C1CB 2NQBC 3W99B 4YS3A 5B1MC 1W2EA 3REKD 3B0DC 5G49B 5AY8B 2CV5D 3KUYD 1A7WA 2RIQA 2PYOA 3REIA 1P3OC 3KFUG 4WV4B 5DNND 1M1AC 1P3BC 2HIOA 1EQZC 4J8UC 4KGCC 1P3FC 1TZYC 3A1KA 3LZ1D 4X23D 4CAYA 3AFAB 1T3UA 5BNXB 2FJ7D 3LELA 4XZQD 3AYWD 3X1UC 4Z5TA 4H9RA 5DNMC 5B32G 1P3PB 1P3OD 4Z2MG 1F1EA 2AROD 5E5AB 5GXQC 1KX5A 1N1JA 5E5AD 1S32A 5BNVB 5CPJB 5CPJD 3LJAB 2Y2LA 3MGSA 3EG5B 3MGPC 1TZYD 5AV5B 1ID3C 3R45B 2YFWB 3B6GB 4DRBA 4G91B 3AZEC 1ZLAB 3EPHA 3A6NA 5GSUB 1KX3B 5GSUD 4WU9A 1KX3D 2JE5A 3TU4C 2NZDC 4WNNB 5B40D 5B24C 5CPKB 5CPKD 1P3GC 3MGPD 2CV5A 1KX4A 2IO5C 2CWEA 3NQUA 3AZGA 3H0MC 3W96B 4H9OA 5B2JD 4J8VA 4YS3C 3W97B 3KWQA 2UWXA 4J8XC 1P34B 1P34D 3KXBD 2PYOC 3REIC 3X1SA 2VQRA 1U35A 3MNNA 3AZJD 2HIOC 4KHAB 3MGRA 1P3MB 4XUJD 3H0RC 2BYKB 3O62B 3AZKD 4DRAA 3O62D 3UTBA 5AV9A 3LELC 4YS3D 5CPID 4KUDB 2G5HC 4J8WA 3AN2A 2F8NB 4Z5TC 5AY8A 2F8ND 1WWSA 4NFTA 1P3BA 3W98B 3W98D 4WU8B 1P3IB 5B0ZC 5B33B 1P3ID 1P3LD 1AOID 1EQZA 3WA9D 2F8NH 1KX5C 5AV6D 2HIOD 5GT3B 1S32C 5GT3D 3MGSC 3AV1A 5JRGB 3X1VA 1P3AB 2RVQC 1BH8A 3B0BA 3AZFA 3AFAA 2JSSA 4QLCB 4QLCD 3AZHA 3X1TB 4HGAC 1M19A 3A6NC 4WU9C 1BFMA 5BO0A 1P3PA 3AZLA 5KDMB 3MGSD 2HUEC 3REHD 5BNVA 2CV5C 1KX4C 5AVBC 4ZUXB 4Z66D 3LZ0A 5AV5A 4ZUXD 1H3OB 3AZGC 3H0LC 5B32C 3WKJB 4R8PA 1F66C 3WTPD 1P3KA 1HQ3A 1ZLAA 3A6ND 5CP6D 3TU4A 2LY8A 2NZDA 4LD9B 3REJA 3AZNB 5C3IB 3UT9B 3AZID 5B31B 4H9QB 1U35C 3MNNC 4JJNA 2F8NG 2Y2IA 3EPJA 3REKB 3UTBC 5AV9C 3KUYB 3B6FA 4J8VD 4J8XA 3C1CC 1KU5A 3KWQD 4J8WC 4ZBJB 3AN2C 3W97A 5AY8C 5F99D 5DNNB 3X1SD 5AVCB 5AVCD 4WZSB 2BYMB 4YM6B 4YM6D 2Y2NA 3NQJA 3LZ1B 3MVDA 5GT0D 3UTAD 4X23B 3MGRD 3AV1C 3X1VC 5B2IA 3MGQA 2FJ7B 4XZQB 2NQBB 2NQBD 5B1MD 4G92B 3B0DB 3AZFC 3AYWB 1M18A 3AFAC 3VH6W 3AZHC 2Y2MA 3VH6T 1P3OB 3AN2D 1M19C 4KUDA 5B0ZA 1M1AB 1M1AD 1P3BD 2AROB 3WAAA 1P3PC 4E44A 2ZY5A 4J8UB 1EQZD 4J8UD 4KGCB 3AZLC 1TZYB 2W8SA 1P3FB 1P3FD 4KGCD 3AV2A 1WWIA 3AV1D 2ZY3A 3RELA 5JRGA 1JFIA 3LZ0C 5AV5C 3X1UB 3X1UD 4R8PC 5DNMB 5DNMD 5B31G 1P3KC 3C1BA 1HQ3C 4DQYB 1ZLAC 1TAFB 3REJC 5GXQD 5B40B 2YFVA 5B1LA 3MGPB 4H9SA 1ID3B 1BH9B 1ID3D 5AVBA 5B0YA 5B32A 4UUZA 3AZEB 1F66A 3AZED 4JJNC 5B2JB 1P3KD 3WKJA 1HQ3D 4AWLC 3TU4D 4UPKA 3B6FC 2NZDD 3KXBB 3AZMA 5B24D 1P3GB 3W97C 1P3GD 4H9NB 1HTAA 4NE5A 5AV8A 3AZJB 4XUJB 3MVDC 3AZKB 3EPLA 5BT1C 5B2IC 3MGQC 1P3MC 3VH6A 4YS3B 5CPIB 3AL0C 2F8NK 3C1CA 1M18C 3W99A 3REKA 4J8XD 5G49A 2PYOB 3REIB 2PYOD 3REID 4KUDC 1P3LB 1AOIB 2Y2JA 3WA9B 5DNNA 3WAAC 2HIOB 5AV6B 5B33C 2BYMA 3EPKA 3AV2C 4CAYB 5BT1D 1P3AC 4X23A 3LELD 3RELC 5JRGC 2FJ7A 5BNXA 4XZQA 4Z5TB 4Z5TD 3AYWA 4NE6A 3C1BC 5B0ZD 1N1JB 1S32B 1KX5D 3WAAD 1S32D 2AROA 3MGSB 5B1LC 5E5AA 3REHB 2RVQD 4H9SC 5CPJA 3AV2D 3LJAA 4Z66B 5B0YC 3RELD 2Y2OA 3WTPB 3R45A 2YFWA 3B6GA 3A6NB 5CP6B 4WU9B 3WKJC 4WU9D 2Y2KA 5GSUA 1KX3A 3AZMC 4WNNA 3AZIB 1TAFA 2HUEB 5B40A 2CV5B 1KX4D 4NE3A 3AZNC 5CPKA 5AVBD
chains in the Genus database with same CATH topology
5AV8C 3NQUB 2XD1A 5C3IC 3AZGB 3UT9C 3AZGD 5B32D 1F66D 4H9OB 2ZY2A 3W96A 4J8VB 5B2JA 3KWQB 4Z2MH 3W99C 3REKC 3V9RB 5F99B 3KUYC 4CSRB 3X1SB 1P34A 3KXBA 2DF4C 1U35D 5DNNC 3MNND 5GT0B 4EO5B 3MGRB 3UTAB 4KHAA 1P3MA 5B1MB 4XUJA 3LZ1C 5AV9B 3UTBD 2BYKA 3B0CW 5AV9D 4X23C 2FFFB 3O62A 3AZKA 4E45A 2FJ7C 3C1CD 4XZQC 3B0CT 4J8WB 3W99D 4J8WD 5CPIA 3AN2B 3P5JB 4G92C 5AY8D 3AYWC 1P3BB 5FUGB 2F8NA 1EQZB 3W98A 1P3LA 4WU8A 1P3IA 1AOIA 5B33A 3AV1B 2AROC 3X1VB 3WA9A 3X1VD 5E5AC 5AV6A 1Q9CA 1P3AA 5GT3A 1BH8B 5CPJC 3LJAC 3AZFB 3AZFD 3AFAD 3AZHB 3AZHD 1M19B 4QLCA 1M19D 3B6GC 3X1TA 4G91C 5GXQB 5BO0B 1P3PD 5GSUC 1KX3C 3AZLB 3AZLD 5B40C 2J8PA 5KDMA 3LJAD 5CPKC 3LZ0B 3REHA 3LZ0D 5AV5D 2BG1A 4Z66A 5JA4B 3IP4C 4ZUXA 4R8PB 1H3OA 4R8PD 1P3KB 3B6GD 1HQ3B 3WTPA 3W96C 3TU4B 1ZLAD 2NZDB 3F6TA 3REJB 3KSYA 5B2JC 5CP6A 3REJD 1ULYA 5B24B 4LD9A 3AZNA 2IO5B 4M6BA 1B6WA 3KXBC 1P34C 4H9PB 3AZIA 3UT9A 5B31A 4WJ3C 2Y2GA 4JJNB 4JJND 2DQNC 2L5AA 4H9QA 3AZJC 5CHLB 4XUJC 4AWLB 3W96D 3B6FB 3AZKC 3O62C 3B6FD 4J8XB 3KUYA 5CPIC 3W97D 1PZRA 3V9RA 3VH5W 5F99A 4CSRA 3VH5T 3W98C 3NQJB 5AVCA 4WU8C 1P3IC 1P3LC 1AOIC 4YM6A 3MVDB 5BS7A 3MVDD 3WA9C 5B2IB 3MGQB 5B2ID 5GT0A 5AV6C 3LZ1A 3LELB 5GT3C 3MGQD 3UTAA 1P3MD 1M18B 2NQBA 1M18D 5B1MA 1R4VA 4H9RB 4QLCC 4KUDD 5B0ZB 3X1TC 1P3OA 2F2AC 3WAAB 1KX5B 1M1AA 5FUGA 4WU8D 5B33D 4J8UA 3AV2B 1B67A 4KGCA 2XD5A 1TZYA 1P3FA 1P3AD 3RELB 5JRGD 3REHC 1JFIB 4HGAB 4Z66C 4ZUXC 2G5IC 3X1UA 2ZY4A 3C1BB 3C1BD 5DNMA 3X1TD 3WTPC 3A1IA 5CP6C 2YFVB 5B1LB 5GXQA 4LD9C 2Y2QA 5B1LD 1KX4B 2Y2PA 2Y2HA 5AVBB 3MGPA 5B0YB 1ID3A 5B0YD 1BH9A 3AZIC 5B32B 5B31C 4UUZB 1F66B 3AZEA 5JA4A 3WKJD 2JCHA 3AZMB 4J8VC 3AZMD 3FDDA 3VH5A 4LD9D 2ZM5A 3KWQC 5B24A 3AZND 5AV8B 4ZBJC 1P3GA 5AV8D 5F99C 3WTPE 4H9NA 3MNNB 1U35B 1Z2CB 3UT9D 3X1SC 5B31D 4H9PA 5AVCC 3AZJA 4YM6C 5BS7C 3UTBB 5GT0C 4EO5C 3MGRC 3UTAC 3C1CB 2NQBC 3W99B 4YS3A 5B1MC 1W2EA 3REKD 3B0DC 5G49B 5AY8B 2CV5D 3KUYD 1A7WA 2RIQA 2PYOA 3REIA 1P3OC 3KFUG 4WV4B 5DNND 1M1AC 1P3BC 2HIOA 1EQZC 4J8UC 4KGCC 1P3FC 1TZYC 3A1KA 3LZ1D 4X23D 4CAYA 3AFAB 1T3UA 5BNXB 2FJ7D 3LELA 4XZQD 3AYWD 3X1UC 4Z5TA 4H9RA 5DNMC 5B32G 1P3PB 1P3OD 4Z2MG 1F1EA 2AROD 5E5AB 5GXQC 1KX5A 1N1JA 5E5AD 1S32A 5BNVB 5CPJB 5CPJD 3LJAB 2Y2LA 3MGSA 3EG5B 3MGPC 1TZYD 5AV5B 1ID3C 3R45B 2YFWB 3B6GB 4DRBA 4G91B 3AZEC 1ZLAB 3EPHA 3A6NA 5GSUB 1KX3B 5GSUD 4WU9A 1KX3D 2JE5A 3TU4C 2NZDC 4WNNB 5B40D 5B24C 5CPKB 5CPKD 1P3GC 3MGPD 2CV5A 1KX4A 2IO5C 2CWEA 3NQUA 3AZGA 3H0MC 3W96B 4H9OA 5B2JD 4J8VA 4YS3C 3W97B 3KWQA 2UWXA 4J8XC 1P34B 1P34D 3KXBD 2PYOC 3REIC 3X1SA 2VQRA 1U35A 3MNNA 3AZJD 2HIOC 4KHAB 3MGRA 1P3MB 4XUJD 3H0RC 2BYKB 3O62B 3AZKD 4DRAA 3O62D 3UTBA 5AV9A 3LELC 4YS3D 5CPID 4KUDB 2G5HC 4J8WA 3AN2A 2F8NB 4Z5TC 5AY8A 2F8ND 1WWSA 4NFTA 1P3BA 3W98B 3W98D 4WU8B 1P3IB 5B0ZC 5B33B 1P3ID 1P3LD 1AOID 1EQZA 3WA9D 2F8NH 1KX5C 5AV6D 2HIOD 5GT3B 1S32C 5GT3D 3MGSC 3AV1A 5JRGB 3X1VA 1P3AB 2RVQC 1BH8A 3B0BA 3AZFA 3AFAA 2JSSA 4QLCB 4QLCD 3AZHA 3X1TB 4HGAC 1M19A 3A6NC 4WU9C 1BFMA 5BO0A 1P3PA 3AZLA 5KDMB 3MGSD 2HUEC 3REHD 5BNVA 2CV5C 1KX4C 5AVBC 4ZUXB 4Z66D 3LZ0A 5AV5A 4ZUXD 1H3OB 3AZGC 3H0LC 5B32C 3WKJB 4R8PA 1F66C 3WTPD 1P3KA 1HQ3A 1ZLAA 3A6ND 5CP6D 3TU4A 2LY8A 2NZDA 4LD9B 3REJA 3AZNB 5C3IB 3UT9B 3AZID 5B31B 4H9QB 1U35C 3MNNC 4JJNA 2F8NG 2Y2IA 3EPJA 3REKB 3UTBC 5AV9C 3KUYB 3B6FA 4J8VD 4J8XA 3C1CC 1KU5A 3KWQD 4J8WC 4ZBJB 3AN2C 3W97A 5AY8C 5F99D 5DNNB 3X1SD 5AVCB 5AVCD 4WZSB 2BYMB 4YM6B 4YM6D 2Y2NA 3NQJA 3LZ1B 3MVDA 5GT0D 3UTAD 4X23B 3MGRD 3AV1C 3X1VC 5B2IA 3MGQA 2FJ7B 4XZQB 2NQBB 2NQBD 5B1MD 4G92B 3B0DB 3AZFC 3AYWB 1M18A 3AFAC 3VH6W 3AZHC 2Y2MA 3VH6T 1P3OB 3AN2D 1M19C 4KUDA 5B0ZA 1M1AB 1M1AD 1P3BD 2AROB 3WAAA 1P3PC 4E44A 2ZY5A 4J8UB 1EQZD 4J8UD 4KGCB 3AZLC 1TZYB 2W8SA 1P3FB 1P3FD 4KGCD 3AV2A 1WWIA 3AV1D 2ZY3A 3RELA 5JRGA 1JFIA 3LZ0C 5AV5C 3X1UB 3X1UD 4R8PC 5DNMB 5DNMD 5B31G 1P3KC 3C1BA 1HQ3C 4DQYB 1ZLAC 1TAFB 3REJC 5GXQD 5B40B 2YFVA 5B1LA 3MGPB 4H9SA 1ID3B 1BH9B 1ID3D 5AVBA 5B0YA 5B32A 4UUZA 3AZEB 1F66A 3AZED 4JJNC 5B2JB 1P3KD 3WKJA 1HQ3D 4AWLC 3TU4D 4UPKA 3B6FC 2NZDD 3KXBB 3AZMA 5B24D 1P3GB 3W97C 1P3GD 4H9NB 1HTAA 4NE5A 5AV8A 3AZJB 4XUJB 3MVDC 3AZKB 3EPLA 5BT1C 5B2IC 3MGQC 1P3MC 3VH6A 4YS3B 5CPIB 3AL0C 2F8NK 3C1CA 1M18C 3W99A 3REKA 4J8XD 5G49A 2PYOB 3REIB 2PYOD 3REID 4KUDC 1P3LB 1AOIB 2Y2JA 3WA9B 5DNNA 3WAAC 2HIOB 5AV6B 5B33C 2BYMA 3EPKA 3AV2C 4CAYB 5BT1D 1P3AC 4X23A 3LELD 3RELC 5JRGC 2FJ7A 5BNXA 4XZQA 4Z5TB 4Z5TD 3AYWA 4NE6A 3C1BC 5B0ZD 1N1JB 1S32B 1KX5D 3WAAD 1S32D 2AROA 3MGSB 5B1LC 5E5AA 3REHB 2RVQD 4H9SC 5CPJA 3AV2D 3LJAA 4Z66B 5B0YC 3RELD 2Y2OA 3WTPB 3R45A 2YFWA 3B6GA 3A6NB 5CP6B 4WU9B 3WKJC 4WU9D 2Y2KA 5GSUA 1KX3A 3AZMC 4WNNA 3AZIB 1TAFA 2HUEB 5B40A 2CV5B 1KX4D 4NE3A 3AZNC 5CPKA 5AVBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 C;  3NQU B;  5C3I C;  3AZG B;  3UT9 C;  3AZG D;  5B32 D;  1F66 D;  4H9O B;  3W96 A;  4J8V B;  5B2J A;  3KWQ B;  4Z2M H;  3W99 C;  3REK C;  3V9R B;  5F99 B;  3KUY C;  4CSR B;  3X1S B;  1P34 A;  3KXB A;  1U35 D;  5DNN C;  3MNN D;  5GT0 B;  4EO5 B;  3MGR B;  3UTA B;  4KHA A;  1P3M A;  5B1M B;  4XUJ A;  3LZ1 C;  5AV9 B;  3UTB D;  2BYK A;  3B0C W;  5AV9 D;  4X23 C;  3O62 A;  3AZK A;  4E45 A;  2FJ7 C;  3C1C D;  4XZQ C;  3B0C T;  4J8W B;  3W99 D;  4J8W D;  5CPI A;  3AN2 B;  4G92 C;  5AY8 D;  3AYW C;  1P3B B;  5FUG B;  2F8N A;  1EQZ B;  3W98 A;  1P3L A;  4WU8 A;  1P3I A;  1AOI A;  5B33 A;  3AV1 B;  2ARO C;  3X1V B;  3WA9 A;  3X1V D;  5E5A C;  5AV6 A;  1Q9C A;  1P3A A;  5GT3 A;  1BH8 B;  5CPJ C;  3LJA C;  3AZF B;  3AZF D;  3AFA D;  3AZH B;  3AZH D;  1M19 B;  4QLC A;  1M19 D;  3B6G C;  3X1T A;  4G91 C;  5GXQ B;  5BO0 B;  1P3P D;  5GSU C;  1KX3 C;  3AZL B;  3AZL D;  5B40 C;  5KDM A;  3LJA D;  5CPK C;  3LZ0 B;  3REH A;  3LZ0 D;  5AV5 D;  4Z66 A;  5JA4 B;  4ZUX A;  4R8P B;  1H3O A;  4R8P D;  1P3K B;  3B6G D;  1HQ3 B;  3WTP A;  3W96 C;  3TU4 B;  1ZLA D;  2NZD B;  3REJ B;  3KSY A;  5B2J C;  5CP6 A;  3REJ D;  1ULY A;  5B24 B;  4LD9 A;  3AZN A;  2IO5 B;  4M6B A;  1B6W A;  3KXB C;  1P34 C;  4H9P B;  3AZI A;  3UT9 A;  5B31 A;  4JJN B;  4JJN D;  2L5A A;  4H9Q A;  3AZJ C;  5CHL B;  4XUJ C;  4AWL B;  3W96 D;  3B6F B;  3AZK C;  3O62 C;  3B6F D;  4J8X B;  3KUY A;  5CPI C;  3W97 D;  3V9R A;  3VH5 W;  5F99 A;  4CSR A;  3VH5 T;  3W98 C;  3NQJ B;  5AVC A;  4WU8 C;  1P3I C;  1P3L C;  1AOI C;  4YM6 A;  3MVD B;  5BS7 A;  3MVD D;  3WA9 C;  5B2I B;  3MGQ B;  5B2I D;  5GT0 A;  5AV6 C;  3LZ1 A;  3LEL B;  5GT3 C;  3MGQ D;  3UTA A;  1P3M D;  1M18 B;  2NQB A;  1M18 D;  5B1M A;  1R4V A;  4H9R B;  4QLC C;  4KUD D;  5B0Z B;  3X1T C;  1P3O A;  3WAA B;  1KX5 B;  1M1A A;  5FUG A;  4WU8 D;  5B33 D;  4J8U A;  3AV2 B;  1B67 A;  4KGC A;  1P3F A;  1TZY A;  1P3A D;  3REL B;  5JRG D;  3REH C;  1JFI B;  4HGA B;  4Z66 C;  4ZUX C;  3X1U A;  3C1B B;  3C1B D;  5DNM A;  3X1T D;  3WTP C;  5CP6 C;  2YFV B;  5B1L B;  5GXQ A;  4LD9 C;  5B1L D;  1KX4 B;  5AVB B;  3MGP A;  5B0Y B;  1ID3 A;  5B0Y D;  1BH9 A;  3AZI C;  5B32 B;  5B31 C;  4UUZ B;  1F66 B;  3AZE A;  5JA4 A;  3WKJ D;  3AZM B;  4J8V C;  3AZM D;  3VH5 A;  4LD9 D;  3KWQ C;  5B24 A;  3AZN D;  5AV8 B;  4ZBJ C;  1P3G A;  5AV8 D;  5F99 C;  3WTP E;  4H9N A;  3MNN B;  1U35 B;  3UT9 D;  3X1S C;  5B31 D;  4H9P A;  5AVC C;  3AZJ A;  4YM6 C;  5BS7 C;  3UTB B;  5GT0 C;  4EO5 C;  3MGR C;  3UTA C;  3C1C B;  2NQB C;  3W99 B;  4YS3 A;  5B1M C;  3REK D;  3B0D C;  5G49 B;  5AY8 B;  2CV5 D;  3KUY D;  1A7W A;  2PYO A;  3REI A;  1P3O C;  4WV4 B;  5DNN D;  1M1A C;  1P3B C;  2HIO A;  1EQZ C;  4J8U C;  4KGC C;  1P3F C;  1TZY C;  3LZ1 D;  4X23 D;  4CAY A;  3AFA B;  5BNX B;  2FJ7 D;  3LEL A;  4XZQ D;  3AYW D;  3X1U C;  4Z5T A;  4H9R A;  5DNM C;  5B32 G;  1P3P B;  1P3O D;  4Z2M G;  1F1E A;  2ARO D;  5E5A B;  5GXQ C;  1KX5 A;  1N1J A;  5E5A D;  1S32 A;  5BNV B;  5CPJ B;  5CPJ D;  3LJA B;  3MGS A;  3MGP C;  1TZY D;  5AV5 B;  1ID3 C;  3R45 B;  2YFW B;  3B6G B;  4DRB A;  4G91 B;  3AZE C;  1ZLA B;  3A6N A;  5GSU B;  1KX3 B;  5GSU D;  4WU9 A;  1KX3 D;  3TU4 C;  2NZD C;  4WNN B;  5B40 D;  5B24 C;  5CPK B;  5CPK D;  1P3G C;  3MGP D;  2CV5 A;  1KX4 A;  2IO5 C;  2CWE A;  3NQU A;  3AZG A;  3W96 B;  4H9O A;  5B2J D;  4J8V A;  4YS3 C;  3W97 B;  3KWQ A;  4J8X C;  1P34 B;  1P34 D;  3KXB D;  2PYO C;  3REI C;  3X1S A;  1U35 A;  3MNN A;  3AZJ D;  2HIO C;  4KHA B;  3MGR A;  1P3M B;  4XUJ D;  2BYK B;  3O62 B;  3AZK D;  4DRA A;  3O62 D;  3UTB A;  5AV9 A;  3LEL C;  4YS3 D;  5CPI D;  4KUD B;  4J8W A;  3AN2 A;  2F8N B;  4Z5T C;  5AY8 A;  2F8N D;  1WWS A;  4NFT A;  1P3B A;  3W98 B;  3W98 D;  4WU8 B;  1P3I B;  5B0Z C;  5B33 B;  1P3I D;  1P3L D;  1AOI D;  1EQZ A;  3WA9 D;  2F8N H;  1KX5 C;  5AV6 D;  2HIO D;  5GT3 B;  1S32 C;  5GT3 D;  3MGS C;  3AV1 A;  5JRG B;  3X1V A;  1P3A B;  2RVQ C;  1BH8 A;  3B0B A;  3AZF A;  3AFA A;  2JSS A;  4QLC B;  4QLC D;  3AZH A;  3X1T B;  4HGA C;  1M19 A;  3A6N C;  4WU9 C;  1BFM A;  5BO0 A;  1P3P A;  3AZL A;  5KDM B;  3MGS D;  2HUE C;  3REH D;  5BNV A;  2CV5 C;  1KX4 C;  5AVB C;  4ZUX B;  4Z66 D;  3LZ0 A;  5AV5 A;  4ZUX D;  1H3O B;  3AZG C;  5B32 C;  3WKJ B;  4R8P A;  1F66 C;  3WTP D;  1P3K A;  1HQ3 A;  1ZLA A;  3A6N D;  5CP6 D;  3TU4 A;  2LY8 A;  2NZD A;  4LD9 B;  3REJ A;  3AZN B;  5C3I B;  3UT9 B;  3AZI D;  5B31 B;  4H9Q B;  1U35 C;  3MNN C;  4JJN A;  2F8N G;  3REK B;  3UTB C;  5AV9 C;  3KUY B;  3B6F A;  4J8V D;  4J8X A;  3C1C C;  1KU5 A;  3KWQ D;  4J8W C;  4ZBJ B;  3AN2 C;  3W97 A;  5AY8 C;  5F99 D;  5DNN B;  3X1S D;  5AVC B;  5AVC D;  4WZS B;  2BYM B;  4YM6 B;  4YM6 D;  3NQJ A;  3LZ1 B;  3MVD A;  5GT0 D;  3UTA D;  4X23 B;  3MGR D;  3AV1 C;  3X1V C;  5B2I A;  3MGQ A;  2FJ7 B;  4XZQ B;  2NQB B;  2NQB D;  5B1M D;  4G92 B;  3B0D B;  3AZF C;  3AYW B;  1M18 A;  3AFA C;  3VH6 W;  3AZH C;  3VH6 T;  1P3O B;  3AN2 D;  1M19 C;  4KUD A;  5B0Z A;  1M1A B;  1M1A D;  1P3B D;  2ARO B;  3WAA A;  1P3P C;  4E44 A;  4J8U B;  1EQZ D;  4J8U D;  4KGC B;  3AZL C;  1TZY B;  1P3F B;  1P3F D;  4KGC D;  3AV2 A;  1WWI A;  3AV1 D;  3REL A;  5JRG A;  1JFI A;  3LZ0 C;  5AV5 C;  3X1U B;  3X1U D;  4R8P C;  5DNM B;  5DNM D;  5B31 G;  1P3K C;  3C1B A;  1HQ3 C;  1ZLA C;  1TAF B;  3REJ C;  5GXQ D;  5B40 B;  2YFV A;  5B1L A;  3MGP B;  4H9S A;  1ID3 B;  1BH9 B;  1ID3 D;  5AVB A;  5B0Y A;  5B32 A;  4UUZ A;  3AZE B;  1F66 A;  3AZE D;  4JJN C;  5B2J B;  1P3K D;  3WKJ A;  1HQ3 D;  4AWL C;  3TU4 D;  3B6F C;  2NZD D;  3KXB B;  3AZM A;  5B24 D;  1P3G B;  3W97 C;  1P3G D;  4H9N B;  1HTA A;  4NE5 A;  5AV8 A;  3AZJ B;  4XUJ B;  3MVD C;  3AZK B;  5BT1 C;  5B2I C;  3MGQ C;  1P3M C;  3VH6 A;  4YS3 B;  5CPI B;  2F8N K;  3C1C A;  1M18 C;  3W99 A;  3REK A;  4J8X D;  5G49 A;  2PYO B;  3REI B;  2PYO D;  3REI D;  4KUD C;  1P3L B;  1AOI B;  3WA9 B;  5DNN A;  3WAA C;  2HIO B;  5AV6 B;  5B33 C;  2BYM A;  3AV2 C;  4CAY B;  5BT1 D;  1P3A C;  4X23 A;  3LEL D;  3REL C;  5JRG C;  2FJ7 A;  5BNX A;  4XZQ A;  4Z5T B;  4Z5T D;  3AYW A;  4NE6 A;  3C1B C;  5B0Z D;  1N1J B;  1S32 B;  1KX5 D;  3WAA D;  1S32 D;  2ARO A;  3MGS B;  5B1L C;  5E5A A;  3REH B;  2RVQ D;  4H9S C;  5CPJ A;  3AV2 D;  3LJA A;  4Z66 B;  5B0Y C;  3REL D;  3WTP B;  3R45 A;  2YFW A;  3B6G A;  3A6N B;  5CP6 B;  4WU9 B;  3WKJ C;  4WU9 D;  5GSU A;  1KX3 A;  3AZM C;  4WNN A;  3AZI B;  1TAF A;  2HUE B;  5B40 A;  2CV5 B;  1KX4 D;  4NE3 A;  3AZN C;  5CPK A;  5AVB D; 
#chains in the Genus database with same CATH topology
 5AV8 C;  3NQU B;  2XD1 A;  5C3I C;  3AZG B;  3UT9 C;  3AZG D;  5B32 D;  1F66 D;  4H9O B;  2ZY2 A;  3W96 A;  4J8V B;  5B2J A;  3KWQ B;  4Z2M H;  3W99 C;  3REK C;  3V9R B;  5F99 B;  3KUY C;  4CSR B;  3X1S B;  1P34 A;  3KXB A;  2DF4 C;  1U35 D;  5DNN C;  3MNN D;  5GT0 B;  4EO5 B;  3MGR B;  3UTA B;  4KHA A;  1P3M A;  5B1M B;  4XUJ A;  3LZ1 C;  5AV9 B;  3UTB D;  2BYK A;  3B0C W;  5AV9 D;  4X23 C;  2FFF B;  3O62 A;  3AZK A;  4E45 A;  2FJ7 C;  3C1C D;  4XZQ C;  3B0C T;  4J8W B;  3W99 D;  4J8W D;  5CPI A;  3AN2 B;  3P5J B;  4G92 C;  5AY8 D;  3AYW C;  1P3B B;  5FUG B;  2F8N A;  1EQZ B;  3W98 A;  1P3L A;  4WU8 A;  1P3I A;  1AOI A;  5B33 A;  3AV1 B;  2ARO C;  3X1V B;  3WA9 A;  3X1V D;  5E5A C;  5AV6 A;  1Q9C A;  1P3A A;  5GT3 A;  1BH8 B;  5CPJ C;  3LJA C;  3AZF B;  3AZF D;  3AFA D;  3AZH B;  3AZH D;  1M19 B;  4QLC A;  1M19 D;  3B6G C;  3X1T A;  4G91 C;  5GXQ B;  5BO0 B;  1P3P D;  5GSU C;  1KX3 C;  3AZL B;  3AZL D;  5B40 C;  2J8P A;  5KDM A;  3LJA D;  5CPK C;  3LZ0 B;  3REH A;  3LZ0 D;  5AV5 D;  2BG1 A;  4Z66 A;  5JA4 B;  3IP4 C;  4ZUX A;  4R8P B;  1H3O A;  4R8P D;  1P3K B;  3B6G D;  1HQ3 B;  3WTP A;  3W96 C;  3TU4 B;  1ZLA D;  2NZD B;  3F6T A;  3REJ B;  3KSY A;  5B2J C;  5CP6 A;  3REJ D;  1ULY A;  5B24 B;  4LD9 A;  3AZN A;  2IO5 B;  4M6B A;  1B6W A;  3KXB C;  1P34 C;  4H9P B;  3AZI A;  3UT9 A;  5B31 A;  4WJ3 C;  2Y2G A;  4JJN B;  4JJN D;  2DQN C;  2L5A A;  4H9Q A;  3AZJ C;  5CHL B;  4XUJ C;  4AWL B;  3W96 D;  3B6F B;  3AZK C;  3O62 C;  3B6F D;  4J8X B;  3KUY A;  5CPI C;  3W97 D;  1PZR A;  3V9R A;  3VH5 W;  5F99 A;  4CSR A;  3VH5 T;  3W98 C;  3NQJ B;  5AVC A;  4WU8 C;  1P3I C;  1P3L C;  1AOI C;  4YM6 A;  3MVD B;  5BS7 A;  3MVD D;  3WA9 C;  5B2I B;  3MGQ B;  5B2I D;  5GT0 A;  5AV6 C;  3LZ1 A;  3LEL B;  5GT3 C;  3MGQ D;  3UTA A;  1P3M D;  1M18 B;  2NQB A;  1M18 D;  5B1M A;  1R4V A;  4H9R B;  4QLC C;  4KUD D;  5B0Z B;  3X1T C;  1P3O A;  2F2A C;  3WAA B;  1KX5 B;  1M1A A;  5FUG A;  4WU8 D;  5B33 D;  4J8U A;  3AV2 B;  1B67 A;  4KGC A;  2XD5 A;  1TZY A;  1P3F A;  1P3A D;  3REL B;  5JRG D;  3REH C;  1JFI B;  4HGA B;  4Z66 C;  4ZUX C;  2G5I C;  3X1U A;  2ZY4 A;  3C1B B;  3C1B D;  5DNM A;  3X1T D;  3WTP C;  3A1I A;  5CP6 C;  2YFV B;  5B1L B;  5GXQ A;  4LD9 C;  2Y2Q A;  5B1L D;  1KX4 B;  2Y2P A;  2Y2H A;  5AVB B;  3MGP A;  5B0Y B;  1ID3 A;  5B0Y D;  1BH9 A;  3AZI C;  5B32 B;  5B31 C;  4UUZ B;  1F66 B;  3AZE A;  5JA4 A;  3WKJ D;  2JCH A;  3AZM B;  4J8V C;  3AZM D;  3FDD A;  3VH5 A;  4LD9 D;  2ZM5 A;  3KWQ C;  5B24 A;  3AZN D;  5AV8 B;  4ZBJ C;  1P3G A;  5AV8 D;  5F99 C;  3WTP E;  4H9N A;  3MNN B;  1U35 B;  1Z2C B;  3UT9 D;  3X1S C;  5B31 D;  4H9P A;  5AVC C;  3AZJ A;  4YM6 C;  5BS7 C;  3UTB B;  5GT0 C;  4EO5 C;  3MGR C;  3UTA C;  3C1C B;  2NQB C;  3W99 B;  4YS3 A;  5B1M C;  1W2E A;  3REK D;  3B0D C;  5G49 B;  5AY8 B;  2CV5 D;  3KUY D;  1A7W A;  2RIQ A;  2PYO A;  3REI A;  1P3O C;  3KFU G;  4WV4 B;  5DNN D;  1M1A C;  1P3B C;  2HIO A;  1EQZ C;  4J8U C;  4KGC C;  1P3F C;  1TZY C;  3A1K A;  3LZ1 D;  4X23 D;  4CAY A;  3AFA B;  1T3U A;  5BNX B;  2FJ7 D;  3LEL A;  4XZQ D;  3AYW D;  3X1U C;  4Z5T A;  4H9R A;  5DNM C;  5B32 G;  1P3P B;  1P3O D;  4Z2M G;  1F1E A;  2ARO D;  5E5A B;  5GXQ C;  1KX5 A;  1N1J A;  5E5A D;  1S32 A;  5BNV B;  5CPJ B;  5CPJ D;  3LJA B;  2Y2L A;  3MGS A;  3EG5 B;  3MGP C;  1TZY D;  5AV5 B;  1ID3 C;  3R45 B;  2YFW B;  3B6G B;  4DRB A;  4G91 B;  3AZE C;  1ZLA B;  3EPH A;  3A6N A;  5GSU B;  1KX3 B;  5GSU D;  4WU9 A;  1KX3 D;  2JE5 A;  3TU4 C;  2NZD C;  4WNN B;  5B40 D;  5B24 C;  5CPK B;  5CPK D;  1P3G C;  3MGP D;  2CV5 A;  1KX4 A;  2IO5 C;  2CWE A;  3NQU A;  3AZG A;  3H0M C;  3W96 B;  4H9O A;  5B2J D;  4J8V A;  4YS3 C;  3W97 B;  3KWQ A;  2UWX A;  4J8X C;  1P34 B;  1P34 D;  3KXB D;  2PYO C;  3REI C;  3X1S A;  2VQR A;  1U35 A;  3MNN A;  3AZJ D;  2HIO C;  4KHA B;  3MGR A;  1P3M B;  4XUJ D;  3H0R C;  2BYK B;  3O62 B;  3AZK D;  4DRA A;  3O62 D;  3UTB A;  5AV9 A;  3LEL C;  4YS3 D;  5CPI D;  4KUD B;  2G5H C;  4J8W A;  3AN2 A;  2F8N B;  4Z5T C;  5AY8 A;  2F8N D;  1WWS A;  4NFT A;  1P3B A;  3W98 B;  3W98 D;  4WU8 B;  1P3I B;  5B0Z C;  5B33 B;  1P3I D;  1P3L D;  1AOI D;  1EQZ A;  3WA9 D;  2F8N H;  1KX5 C;  5AV6 D;  2HIO D;  5GT3 B;  1S32 C;  5GT3 D;  3MGS C;  3AV1 A;  5JRG B;  3X1V A;  1P3A B;  2RVQ C;  1BH8 A;  3B0B A;  3AZF A;  3AFA A;  2JSS A;  4QLC B;  4QLC D;  3AZH A;  3X1T B;  4HGA C;  1M19 A;  3A6N C;  4WU9 C;  1BFM A;  5BO0 A;  1P3P A;  3AZL A;  5KDM B;  3MGS D;  2HUE C;  3REH D;  5BNV A;  2CV5 C;  1KX4 C;  5AVB C;  4ZUX B;  4Z66 D;  3LZ0 A;  5AV5 A;  4ZUX D;  1H3O B;  3AZG C;  3H0L C;  5B32 C;  3WKJ B;  4R8P A;  1F66 C;  3WTP D;  1P3K A;  1HQ3 A;  1ZLA A;  3A6N D;  5CP6 D;  3TU4 A;  2LY8 A;  2NZD A;  4LD9 B;  3REJ A;  3AZN B;  5C3I B;  3UT9 B;  3AZI D;  5B31 B;  4H9Q B;  1U35 C;  3MNN C;  4JJN A;  2F8N G;  2Y2I A;  3EPJ A;  3REK B;  3UTB C;  5AV9 C;  3KUY B;  3B6F A;  4J8V D;  4J8X A;  3C1C C;  1KU5 A;  3KWQ D;  4J8W C;  4ZBJ B;  3AN2 C;  3W97 A;  5AY8 C;  5F99 D;  5DNN B;  3X1S D;  5AVC B;  5AVC D;  4WZS B;  2BYM B;  4YM6 B;  4YM6 D;  2Y2N A;  3NQJ A;  3LZ1 B;  3MVD A;  5GT0 D;  3UTA D;  4X23 B;  3MGR D;  3AV1 C;  3X1V C;  5B2I A;  3MGQ A;  2FJ7 B;  4XZQ B;  2NQB B;  2NQB D;  5B1M D;  4G92 B;  3B0D B;  3AZF C;  3AYW B;  1M18 A;  3AFA C;  3VH6 W;  3AZH C;  2Y2M A;  3VH6 T;  1P3O B;  3AN2 D;  1M19 C;  4KUD A;  5B0Z A;  1M1A B;  1M1A D;  1P3B D;  2ARO B;  3WAA A;  1P3P C;  4E44 A;  2ZY5 A;  4J8U B;  1EQZ D;  4J8U D;  4KGC B;  3AZL C;  1TZY B;  2W8S A;  1P3F B;  1P3F D;  4KGC D;  3AV2 A;  1WWI A;  3AV1 D;  2ZY3 A;  3REL A;  5JRG A;  1JFI A;  3LZ0 C;  5AV5 C;  3X1U B;  3X1U D;  4R8P C;  5DNM B;  5DNM D;  5B31 G;  1P3K C;  3C1B A;  1HQ3 C;  4DQY B;  1ZLA C;  1TAF B;  3REJ C;  5GXQ D;  5B40 B;  2YFV A;  5B1L A;  3MGP B;  4H9S A;  1ID3 B;  1BH9 B;  1ID3 D;  5AVB A;  5B0Y A;  5B32 A;  4UUZ A;  3AZE B;  1F66 A;  3AZE D;  4JJN C;  5B2J B;  1P3K D;  3WKJ A;  1HQ3 D;  4AWL C;  3TU4 D;  4UPK A;  3B6F C;  2NZD D;  3KXB B;  3AZM A;  5B24 D;  1P3G B;  3W97 C;  1P3G D;  4H9N B;  1HTA A;  4NE5 A;  5AV8 A;  3AZJ B;  4XUJ B;  3MVD C;  3AZK B;  3EPL A;  5BT1 C;  5B2I C;  3MGQ C;  1P3M C;  3VH6 A;  4YS3 B;  5CPI B;  3AL0 C;  2F8N K;  3C1C A;  1M18 C;  3W99 A;  3REK A;  4J8X D;  5G49 A;  2PYO B;  3REI B;  2PYO D;  3REI D;  4KUD C;  1P3L B;  1AOI B;  2Y2J A;  3WA9 B;  5DNN A;  3WAA C;  2HIO B;  5AV6 B;  5B33 C;  2BYM A;  3EPK A;  3AV2 C;  4CAY B;  5BT1 D;  1P3A C;  4X23 A;  3LEL D;  3REL C;  5JRG C;  2FJ7 A;  5BNX A;  4XZQ A;  4Z5T B;  4Z5T D;  3AYW A;  4NE6 A;  3C1B C;  5B0Z D;  1N1J B;  1S32 B;  1KX5 D;  3WAA D;  1S32 D;  2ARO A;  3MGS B;  5B1L C;  5E5A A;  3REH B;  2RVQ D;  4H9S C;  5CPJ A;  3AV2 D;  3LJA A;  4Z66 B;  5B0Y C;  3REL D;  2Y2O A;  3WTP B;  3R45 A;  2YFW A;  3B6G A;  3A6N B;  5CP6 B;  4WU9 B;  3WKJ C;  4WU9 D;  2Y2K A;  5GSU A;  1KX3 A;  3AZM C;  4WNN A;  3AZI B;  1TAF A;  2HUE B;  5B40 A;  2CV5 B;  1KX4 D;  4NE3 A;  3AZN C;  5CPK A;  5AVB D; 
#chains in the Genus database with same CATH homology
 5AV8 C;  3NQU B;  2XD1 A;  5C3I C;  3AZG B;  3UT9 C;  3AZG D;  5B32 D;  1F66 D;  4H9O B;  2ZY2 A;  3W96 A;  4J8V B;  5B2J A;  3KWQ B;  4Z2M H;  3W99 C;  3REK C;  3V9R B;  5F99 B;  3KUY C;  4CSR B;  3X1S B;  1P34 A;  3KXB A;  2DF4 C;  1U35 D;  5DNN C;  3MNN D;  5GT0 B;  4EO5 B;  3MGR B;  3UTA B;  4KHA A;  1P3M A;  5B1M B;  4XUJ A;  3LZ1 C;  5AV9 B;  3UTB D;  2BYK A;  3B0C W;  5AV9 D;  4X23 C;  2FFF B;  3O62 A;  3AZK A;  4E45 A;  2FJ7 C;  3C1C D;  4XZQ C;  3B0C T;  4J8W B;  3W99 D;  4J8W D;  5CPI A;  3AN2 B;  3P5J B;  4G92 C;  5AY8 D;  3AYW C;  1P3B B;  5FUG B;  2F8N A;  1EQZ B;  3W98 A;  1P3L A;  4WU8 A;  1P3I A;  1AOI A;  5B33 A;  3AV1 B;  2ARO C;  3X1V B;  3WA9 A;  3X1V D;  5E5A C;  5AV6 A;  1Q9C A;  1P3A A;  5GT3 A;  1BH8 B;  5CPJ C;  3LJA C;  3AZF B;  3AZF D;  3AFA D;  3AZH B;  3AZH D;  1M19 B;  4QLC A;  1M19 D;  3B6G C;  3X1T A;  4G91 C;  5GXQ B;  5BO0 B;  1P3P D;  5GSU C;  1KX3 C;  3AZL B;  3AZL D;  5B40 C;  2J8P A;  5KDM A;  3LJA D;  5CPK C;  3LZ0 B;  3REH A;  3LZ0 D;  5AV5 D;  2BG1 A;  4Z66 A;  5JA4 B;  3IP4 C;  4ZUX A;  4R8P B;  1H3O A;  4R8P D;  1P3K B;  3B6G D;  1HQ3 B;  3WTP A;  3W96 C;  3TU4 B;  1ZLA D;  2NZD B;  3F6T A;  3REJ B;  3KSY A;  5B2J C;  5CP6 A;  3REJ D;  1ULY A;  5B24 B;  4LD9 A;  3AZN A;  2IO5 B;  4M6B A;  1B6W A;  3KXB C;  1P34 C;  4H9P B;  3AZI A;  3UT9 A;  5B31 A;  4WJ3 C;  2Y2G A;  4JJN B;  4JJN D;  2DQN C;  2L5A A;  4H9Q A;  3AZJ C;  5CHL B;  4XUJ C;  4AWL B;  3W96 D;  3B6F B;  3AZK C;  3O62 C;  3B6F D;  4J8X B;  3KUY A;  5CPI C;  3W97 D;  1PZR A;  3V9R A;  3VH5 W;  5F99 A;  4CSR A;  3VH5 T;  3W98 C;  3NQJ B;  5AVC A;  4WU8 C;  1P3I C;  1P3L C;  1AOI C;  4YM6 A;  3MVD B;  5BS7 A;  3MVD D;  3WA9 C;  5B2I B;  3MGQ B;  5B2I D;  5GT0 A;  5AV6 C;  3LZ1 A;  3LEL B;  5GT3 C;  3MGQ D;  3UTA A;  1P3M D;  1M18 B;  2NQB A;  1M18 D;  5B1M A;  1R4V A;  4H9R B;  4QLC C;  4KUD D;  5B0Z B;  3X1T C;  1P3O A;  2F2A C;  3WAA B;  1KX5 B;  1M1A A;  5FUG A;  4WU8 D;  5B33 D;  4J8U A;  3AV2 B;  1B67 A;  4KGC A;  2XD5 A;  1TZY A;  1P3F A;  1P3A D;  3REL B;  5JRG D;  3REH C;  1JFI B;  4HGA B;  4Z66 C;  4ZUX C;  2G5I C;  3X1U A;  2ZY4 A;  3C1B B;  3C1B D;  5DNM A;  3X1T D;  3WTP C;  3A1I A;  5CP6 C;  2YFV B;  5B1L B;  5GXQ A;  4LD9 C;  2Y2Q A;  5B1L D;  1KX4 B;  2Y2P A;  2Y2H A;  5AVB B;  3MGP A;  5B0Y B;  1ID3 A;  5B0Y D;  1BH9 A;  3AZI C;  5B32 B;  5B31 C;  4UUZ B;  1F66 B;  3AZE A;  5JA4 A;  3WKJ D;  2JCH A;  3AZM B;  4J8V C;  3AZM D;  3FDD A;  3VH5 A;  4LD9 D;  2ZM5 A;  3KWQ C;  5B24 A;  3AZN D;  5AV8 B;  4ZBJ C;  1P3G A;  5AV8 D;  5F99 C;  3WTP E;  4H9N A;  3MNN B;  1U35 B;  1Z2C B;  3UT9 D;  3X1S C;  5B31 D;  4H9P A;  5AVC C;  3AZJ A;  4YM6 C;  5BS7 C;  3UTB B;  5GT0 C;  4EO5 C;  3MGR C;  3UTA C;  3C1C B;  2NQB C;  3W99 B;  4YS3 A;  5B1M C;  1W2E A;  3REK D;  3B0D C;  5G49 B;  5AY8 B;  2CV5 D;  3KUY D;  1A7W A;  2RIQ A;  2PYO A;  3REI A;  1P3O C;  3KFU G;  4WV4 B;  5DNN D;  1M1A C;  1P3B C;  2HIO A;  1EQZ C;  4J8U C;  4KGC C;  1P3F C;  1TZY C;  3A1K A;  3LZ1 D;  4X23 D;  4CAY A;  3AFA B;  1T3U A;  5BNX B;  2FJ7 D;  3LEL A;  4XZQ D;  3AYW D;  3X1U C;  4Z5T A;  4H9R A;  5DNM C;  5B32 G;  1P3P B;  1P3O D;  4Z2M G;  1F1E A;  2ARO D;  5E5A B;  5GXQ C;  1KX5 A;  1N1J A;  5E5A D;  1S32 A;  5BNV B;  5CPJ B;  5CPJ D;  3LJA B;  2Y2L A;  3MGS A;  3EG5 B;  3MGP C;  1TZY D;  5AV5 B;  1ID3 C;  3R45 B;  2YFW B;  3B6G B;  4DRB A;  4G91 B;  3AZE C;  1ZLA B;  3EPH A;  3A6N A;  5GSU B;  1KX3 B;  5GSU D;  4WU9 A;  1KX3 D;  2JE5 A;  3TU4 C;  2NZD C;  4WNN B;  5B40 D;  5B24 C;  5CPK B;  5CPK D;  1P3G C;  3MGP D;  2CV5 A;  1KX4 A;  2IO5 C;  2CWE A;  3NQU A;  3AZG A;  3H0M C;  3W96 B;  4H9O A;  5B2J D;  4J8V A;  4YS3 C;  3W97 B;  3KWQ A;  2UWX A;  4J8X C;  1P34 B;  1P34 D;  3KXB D;  2PYO C;  3REI C;  3X1S A;  2VQR A;  1U35 A;  3MNN A;  3AZJ D;  2HIO C;  4KHA B;  3MGR A;  1P3M B;  4XUJ D;  3H0R C;  2BYK B;  3O62 B;  3AZK D;  4DRA A;  3O62 D;  3UTB A;  5AV9 A;  3LEL C;  4YS3 D;  5CPI D;  4KUD B;  2G5H C;  4J8W A;  3AN2 A;  2F8N B;  4Z5T C;  5AY8 A;  2F8N D;  1WWS A;  4NFT A;  1P3B A;  3W98 B;  3W98 D;  4WU8 B;  1P3I B;  5B0Z C;  5B33 B;  1P3I D;  1P3L D;  1AOI D;  1EQZ A;  3WA9 D;  2F8N H;  1KX5 C;  5AV6 D;  2HIO D;  5GT3 B;  1S32 C;  5GT3 D;  3MGS C;  3AV1 A;  5JRG B;  3X1V A;  1P3A B;  2RVQ C;  1BH8 A;  3B0B A;  3AZF A;  3AFA A;  2JSS A;  4QLC B;  4QLC D;  3AZH A;  3X1T B;  4HGA C;  1M19 A;  3A6N C;  4WU9 C;  1BFM A;  5BO0 A;  1P3P A;  3AZL A;  5KDM B;  3MGS D;  2HUE C;  3REH D;  5BNV A;  2CV5 C;  1KX4 C;  5AVB C;  4ZUX B;  4Z66 D;  3LZ0 A;  5AV5 A;  4ZUX D;  1H3O B;  3AZG C;  3H0L C;  5B32 C;  3WKJ B;  4R8P A;  1F66 C;  3WTP D;  1P3K A;  1HQ3 A;  1ZLA A;  3A6N D;  5CP6 D;  3TU4 A;  2LY8 A;  2NZD A;  4LD9 B;  3REJ A;  3AZN B;  5C3I B;  3UT9 B;  3AZI D;  5B31 B;  4H9Q B;  1U35 C;  3MNN C;  4JJN A;  2F8N G;  2Y2I A;  3EPJ A;  3REK B;  3UTB C;  5AV9 C;  3KUY B;  3B6F A;  4J8V D;  4J8X A;  3C1C C;  1KU5 A;  3KWQ D;  4J8W C;  4ZBJ B;  3AN2 C;  3W97 A;  5AY8 C;  5F99 D;  5DNN B;  3X1S D;  5AVC B;  5AVC D;  4WZS B;  2BYM B;  4YM6 B;  4YM6 D;  2Y2N A;  3NQJ A;  3LZ1 B;  3MVD A;  5GT0 D;  3UTA D;  4X23 B;  3MGR D;  3AV1 C;  3X1V C;  5B2I A;  3MGQ A;  2FJ7 B;  4XZQ B;  2NQB B;  2NQB D;  5B1M D;  4G92 B;  3B0D B;  3AZF C;  3AYW B;  1M18 A;  3AFA C;  3VH6 W;  3AZH C;  2Y2M A;  3VH6 T;  1P3O B;  3AN2 D;  1M19 C;  4KUD A;  5B0Z A;  1M1A B;  1M1A D;  1P3B D;  2ARO B;  3WAA A;  1P3P C;  4E44 A;  2ZY5 A;  4J8U B;  1EQZ D;  4J8U D;  4KGC B;  3AZL C;  1TZY B;  2W8S A;  1P3F B;  1P3F D;  4KGC D;  3AV2 A;  1WWI A;  3AV1 D;  2ZY3 A;  3REL A;  5JRG A;  1JFI A;  3LZ0 C;  5AV5 C;  3X1U B;  3X1U D;  4R8P C;  5DNM B;  5DNM D;  5B31 G;  1P3K C;  3C1B A;  1HQ3 C;  4DQY B;  1ZLA C;  1TAF B;  3REJ C;  5GXQ D;  5B40 B;  2YFV A;  5B1L A;  3MGP B;  4H9S A;  1ID3 B;  1BH9 B;  1ID3 D;  5AVB A;  5B0Y A;  5B32 A;  4UUZ A;  3AZE B;  1F66 A;  3AZE D;  4JJN C;  5B2J B;  1P3K D;  3WKJ A;  1HQ3 D;  4AWL C;  3TU4 D;  4UPK A;  3B6F C;  2NZD D;  3KXB B;  3AZM A;  5B24 D;  1P3G B;  3W97 C;  1P3G D;  4H9N B;  1HTA A;  4NE5 A;  5AV8 A;  3AZJ B;  4XUJ B;  3MVD C;  3AZK B;  3EPL A;  5BT1 C;  5B2I C;  3MGQ C;  1P3M C;  3VH6 A;  4YS3 B;  5CPI B;  3AL0 C;  2F8N K;  3C1C A;  1M18 C;  3W99 A;  3REK A;  4J8X D;  5G49 A;  2PYO B;  3REI B;  2PYO D;  3REI D;  4KUD C;  1P3L B;  1AOI B;  2Y2J A;  3WA9 B;  5DNN A;  3WAA C;  2HIO B;  5AV6 B;  5B33 C;  2BYM A;  3EPK A;  3AV2 C;  4CAY B;  5BT1 D;  1P3A C;  4X23 A;  3LEL D;  3REL C;  5JRG C;  2FJ7 A;  5BNX A;  4XZQ A;  4Z5T B;  4Z5T D;  3AYW A;  4NE6 A;  3C1B C;  5B0Z D;  1N1J B;  1S32 B;  1KX5 D;  3WAA D;  1S32 D;  2ARO A;  3MGS B;  5B1L C;  5E5A A;  3REH B;  2RVQ D;  4H9S C;  5CPJ A;  3AV2 D;  3LJA A;  4Z66 B;  5B0Y C;  3REL D;  2Y2O A;  3WTP B;  3R45 A;  2YFW A;  3B6G A;  3A6N B;  5CP6 B;  4WU9 B;  3WKJ C;  4WU9 D;  2Y2K A;  5GSU A;  1KX3 A;  3AZM C;  4WNN A;  3AZI B;  1TAF A;  2HUE B;  5B40 A;  2CV5 B;  1KX4 D;  4NE3 A;  3AZN C;  5CPK A;  5AVB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...