5B33C

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
b'AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33C00
1F66B 1BH8A 4JJNB 2YFWB 3B0DC 3W96A 3C1BA 2FJ7D 2AROC 5AVBD 3W96B 3AV1A 1KX4C 3AZKA 4LD9D 3AZFD 5B40D 3UT9A 4ZUXB 2FJ7C 1P3AA 4XUJD 5B2JA 1KX5A 5GT3A 2PYOB 5B32G 1P3AB 3MGRD 3LELA 5B2JB 3WAAD 3A6NC 5B33D 1P3FD 4G91C 3X1SD 3LELB 5B1MA 5CP6C 4XUJC 3REID 2IO5B 2YFVB 2CV5D 1EQZA 3X1TA 1P3PD 1P3LA 5B0ZD 3MGRC 3NQUA 1EQZB 3WAAC 4WU8C 1P3LB 5BT1D 3NQUB 3X1SC 4CSRB 4Z5TB 4X23D 5AY8A 3C1CB 3MGSB 3AZEC 3REIC 3W97D 2L5AA 3LZ0D 5B31A 4KGCB 4G92C 3WA9D 3WKJC 5JRGD 4J8VC 3KWQD 4XZQB 5AV6A 5B32A 1P3MD 3NQJB 5GXQB 1M1AB 1WWSA 3UTBC 5BO0B 4UUZA 5F99D 5AV6B 5B32B 5FUGB 4WU9D 1AOIA 1TAFA 5BNVA 3AYWA 1P3GD 5AV5D 4KUDA 3LZ0C 1TAFB 5B1LD 5BNVB 5AV9D 3AZND 3MGPA 5KDMA 3KWQC 5BNXB 3O62B 1P3KB 3KXBA 4J8WA 1ID3B 4H9QA 3MGPB 1P3MC 3C1BD 1P3IA 3B6FA 3AZIA 3WTPB 5F99C 3KXBB 4E45A 3REKB 4H9QB 5DNNA 4WU9C 3B6FB 3AZIB 3AV1D 3LJAA 2NZDB 3W98B 3UTAA 4Z2MG 3AZKD 4KHAB 1M19A 1U35C 4JJNC 1F66C 5AV9C 3AN2A 1P3BA 4NE3A 4ZBJB 3UT9D 3UTAB 5CPIB 4Z66B 4H9RA 3W96C 1P3BB 3C1BC 4DRAA 3AFAA 4EO5B 4R8PB 1KX5D 5GT3D 5CPJA 1ZLAD 5CPKD 3AV1C 5DNMD 1KX3D 5JA4A 5C3IC 3AZKC 3TU4C 5CPJB 5B24A 5AV8A 3AZLD 4QLCB 3X1VB 4YS3B 2BYMA 3UT9C 5B24B 5B1MD 1HQ3A 1BH9B 5AVCD 3MNNA 2BYMB 3AZJA 1HQ3B 3MNNB 1KX5C 5GT3C 5B2IA 5DNMC 4YM6D 3LELC 2NQBB 1Q9CA 1P3FB 5B0YA 1TZYA 5B1MC 2IO5C 5AY8D 4J8UA 1TZYB 2CV5B 2AROD 1EQZC 3X1TC 5GT0A 1P3LC 2RVQC 1N1JA 5B31D 1S32A 1P34A 2YFWA 5GT0B 4AWLB 3X1UA 5AY8C 4NE6A 4HGAB 1AOID 3X1UB 2F8NG 3AYWD 4KUDD 1P3OB 5B31C 3A6ND 3VH6T 4ZUXA 5AV6C 5B32C 4J8WD 5E5AD 3LZ1B 1P3ID 5CP6D 3MGQB 2PYOA 3MVDA 4E44A 1P3GB 5AV5B 1AOIC 3AYWC 5GSUA 3AV2B 1M19D 5B1LB 3MVDB 4J8XA 4KUDC 3REHA 5GSUB 3AN2D 4WU8D 4J8XB 5BS7A 3REHB 4J8WC 3B6FC 2YFVA 5E5AC 1P3IC 3AFAD 3AZIC 3AZGB 3AZED 5DNNC 3LJAC 3KUYA 3B6GA 4ZBJC 3UTAC 1M19C 1BFMA 5AV8D 4CSRA 4Z5TA 3AN2C 3KUYB 1P3BC 3B6GB 3WKJD 4J8VD 1KU5A 3C1CA 3MGSA 3W99A 2LY8A 2F8NB 3AZJD 3AFAC 3UTBD 3AZHB 3W99B 5CPJC 4KGCA 5B2ID 4XZQA 5AV8C 5B24C 3NQJA 5B0YD 5GXQA 3RELB 1M1AA 2HIOD 5BO0A 1HQ3C 3VH5A 1M18A 3MNNC 5FUGA 3V9RB 4J8UD 3AZJC 3AZMA 1M18B 5G49B 3AZMB 5B2IC 3REJB 1S32D 1P34D 1F66D 1U35D 4H9PB 5BNXA 3O62A 4JJND 3TU4B 1P3KA 4H9SA 3B0DB 1ID3A 5B0YC 1TZYC 2HIOC 3WTPA 3REKA 3W96D 2AROB 4J8UC 2NZDA 1B67A 3W98A 4KHAA 1KX4B 5GT0C 1S32C 1P34C 3B0CT 5CPIA 4Z66A 4ZUXD 5AVBA 3X1UC 4R8PA 2FJ7B 2PYOD 5AVBB 4LD9A 1P3AD 2BYKB 5B2JD 3AZFA 1R4VA 5B40A 3X1VA 4QLCA 4LD9B 4YS3A 3LELD 3AZFB 4G91B 5B40B 1BH9A 4ZUXC 2CWEA 4CAYB 1B6WA 4XUJB 4DRBA 2PYOC 3MVDC 1P3AC 5B33A 5B2JC 1EQZD 3X1TD 2NQBA 5GSUC 1P3FA 4WV4B 3MGRB 2RVQD 1P3LD 3WAAB 4J8XC 5B33B 3X1SB 5BS7C 3C1CD 3MGSD 2CV5A 1P3PA 3AZEB 5B0ZA 3REIB 2JSSA 1P3PB 4KGCD 5B0ZB 3KUYC 3VH6W 4XZQD 4X23A 4J8VB 4Z5TC 5GXQD 1M1AD 1F1EA 3C1CC 5AV6D 5B32D 4X23B 3W99C 3MGSC 3UTBB 1H3OA 3W97A 3WA9A 1P3OA 5JRGA 4KGCC 1H3OB 3W97B 3LZ0B 3WA9B 3O62D 4XZQC 5JRGB 1P3KD 3KWQB 1ID3D 3MGPD 5GXQC 1M1AC 3LZ1A 1HTAA 1P3MB 3MGQA 3WTPD 3KXBD 3REKD 1M18C 1P3GA 5AV5A 3B6FD 5F99B 1JFIB 3AZID 3AZMC 2NZDD 4WU9B 3W98D 3AV2A 5B1LA 5DNND 3AZNA 3LJAD 1U35B 3UTAD 5AV9B 3AZNB 3O62C 5CPID 4Z66D 1P3KC 1BH8B 4H9SC 1ID3C 3MGPC 1P3BD 3AZGA 3WTPC 3C1BB 3KXBC 4R8PD 3REKC 3VH5T 2NZDC 3W98C 5CPJD 3AV1B 5C3IB 3AZKB 3X1VD 4QLCD 4YS3D 5B24D 5CPIC 4Z66C 5B31G 3UT9B 1ULYA 2F8NA 5AVBC 1ZLAA 1HQ3D 4EO5C 3AZHA 5CPKA 4R8PC 3MNND 5DNMA 1KX3A 1KX5B 5GT3B 1ZLAB 4LD9C 1WWIA 5CPKB 2NQBD 3AZLA 5DNMB 4M6BA 3AZFC 1KX3B 4NE5A 5B40C 3X1VC 4QLCC 2HUEB 4YS3C 3RELA 3AZLB 5AVCA 3R45A 5CHLB 3KSYA 3V9RA 5B1MB 1TZYD 5AVCB 3R45B 3VH6A 5G49A 4YM6A 3X1TB 3REJA 5B33C 2NQBC 3B0CW 4H9PA 5GT0D 4WNNA 3TU4A 4YM6B 1P3FC 4WNNB 2AROA 2CV5C 5AY8B 1P3PC 3X1UD 4H9OA 1KX4A 5B0ZC 4Z2MH 1P3OD 4H9OB 5BT1C 5B31B 4AWLC 4X23C 3LZ1D 2FJ7A 3MGQD 4HGAC 2BYKA 4UUZB 1AOIB 3W97C 3AV2D 3MVDD 3AYWB 3A6NA 3WA9C 1P3OC 5JRGC 4KUDB 5GSUD 4J8XD 3A6NB 5E5AA 3REHD 5KDMB 5CP6A 4CAYA 3LZ1C 4J8WB 3AZGD 4XUJA 3MGQC 5E5AB 1P3IB 4H9NA 5CP6B 1P3GC 5AV5C 5DNNB 2F8NK 3MGRA 3AV2C 4H9NB 5B1LC 3WAAA 3LJAB 4WU8A 3AZNC 1M19B 3KUYD 3B6GD 3X1SA 4WU8B 3AN2B 3REHC 4Z5TD 2F8ND 4H9RB 3AZEA 3AZGC 3REIA 3AZHD 3W99D 3AFAB 4NFTA 3WKJA 5JA4B 4J8VA 5AV8B 3RELD 3B6GC 4G92B 3WKJB 3UTBA 3WTPE 1ZLAC 2F8NH 1M18D 3AZHC 3AZJB 5CPKC 1KX3C 3AZMD 3LZ0A 3REJD 2HUEC 5B2IB 3TU4D 3AZLC 3KWQA 2HIOA 3RELC 3B0BA 5AVCC 1P3MA 5B0YB 4WZSB 2HIOB 1A7WA 5F99A 1JFIA 3VH5W 4WU9A 4J8UB 1KX4D 4YM6C 1F66A 1U35A 4JJNA 3REJC 5AV9A 1N1JB 1S32B 1P34B
chains in the Genus database with same CATH superfamily
1F66B 1BH8A 4JJNB 2YFWB 3B0DC 3W96A 3C1BA 2FJ7D 2AROC 5AVBD 3W96B 2VQRA 2Y2MA 2F2AC 3AV1A 1KX4C 3AZKA 4LD9D 3AZFD 5B40D 3UT9A 4ZUXB 2FJ7C 1P3AA 4XUJD 5B2JA 1KX5A 5GT3A 2PYOB 5B32G 1P3AB 3MGRD 3LELA 5B2JB 3WAAD 3A6NC 5B33D 1P3FD 4G91C 3X1SD 3LELB 5B1MA 5CP6C 4XUJC 3REID 2IO5B 2YFVB 2CV5D 1EQZA 3X1TA 1P3PD 1P3LA 5B0ZD 3MGRC 3NQUA 1EQZB 3P5JB 3WAAC 4WU8C 1P3LB 5BT1D 3NQUB 3X1SC 4CSRB 4Z5TB 4X23D 5AY8A 3C1CB 3MGSB 3AZEC 3REIC 3W97D 2L5AA 3LZ0D 5B31A 4KGCB 4G92C 3WA9D 3WKJC 5JRGD 4J8VC 3KWQD 4XZQB 5AV6A 5B32A 1P3MD 3NQJB 5GXQB 1M1AB 1WWSA 3UTBC 5BO0B 4UUZA 5F99D 5AV6B 5B32B 5FUGB 4WU9D 1Z2CB 1AOIA 1TAFA 5BNVA 3AYWA 1P3GD 5AV5D 4KUDA 3LZ0C 1TAFB 5B1LD 5BNVB 5AV9D 3AZND 3MGPA 5KDMA 3KWQC 5BNXB 3O62B 1P3KB 3KXBA 4J8WA 1ID3B 4H9QA 3MGPB 1P3MC 3C1BD 1P3IA 3B6FA 3AZIA 3WTPB 5F99C 3KXBB 4E45A 3REKB 4H9QB 5DNNA 4WU9C 3B6FB 3AZIB 3AV1D 3LJAA 2NZDB 3W98B 3UTAA 4Z2MG 3AZKD 4KHAB 1M19A 1U35C 4JJNC 1F66C 5AV9C 3AN2A 1P3BA 4NE3A 4ZBJB 3UT9D 3UTAB 5CPIB 4Z66B 4H9RA 3W96C 1P3BB 2ZY5A 3C1BC 4DRAA 3AFAA 4EO5B 4R8PB 1KX5D 5GT3D 5CPJA 1ZLAD 2Y2PA 5CPKD 2UWXA 5DNMD 3EPJA 3AV1C 3IP4C 5JA4A 5C3IC 3AZKC 3TU4C 1KX3D 5CPJB 5B24A 5AV8A 3AZLD 4QLCB 3X1VB 4YS3B 2BYMA 3A1IA 3UT9C 5B24B 5B1MD 1HQ3A 1BH9B 5AVCD 3MNNA 2Y2HA 2BYMB 3AZJA 1HQ3B 3MNNB 1KX5C 5GT3C 2BG1A 5B2IA 5DNMC 4YM6D 3LELC 2NQBB 1Q9CA 1P3FB 5B0YA 1TZYA 5B1MC 2IO5C 5AY8D 4J8UA 1TZYB 2CV5B 2AROD 1EQZC 3X1TC 5GT0A 1P3LC 2RVQC 1N1JA 5B31D 1S32A 1P34A 2YFWA 5GT0B 4AWLB 3EPKA 2DQNC 3X1UA 5AY8C 4NE6A 2JCHA 4HGAB 1AOID 3X1UB 2F8NG 3AYWD 4KUDD 1P3OB 2ZM5A 5B31C 1T3UA 3A6ND 3VH6T 4ZUXA 2Y2NA 5AV6C 5B32C 4J8WD 5E5AD 3LZ1B 1P3ID 5CP6D 3MGQB 2PYOA 3MVDA 4E44A 1P3GB 3AL0C 5AV5B 1AOIC 3AYWC 5GSUA 3AV2B 1M19D 5B1LB 3MVDB 4J8XA 4KUDC 3REHA 5GSUB 3AN2D 4WU8D 4J8XB 5BS7A 3REHB 4J8WC 3B6FC 2YFVA 5E5AC 1P3IC 3AFAD 3AZIC 3AZGB 3AZED 2ZY4A 5DNNC 3EG5B 3LJAC 3KUYA 3B6GA 4ZBJC 3UTAC 1M19C 1BFMA 5AV8D 4CSRA 4Z5TA 3AN2C 3H0RC 3KUYB 1P3BC 3B6GB 4J8VD 3WKJD 1KU5A 3C1CA 3MGSA 3W99A 2LY8A 2F8NB 3AZJD 3AFAC 3UTBD 3AZHB 3W99B 5CPJC 3EPHA 4KGCA 5B2ID 4XZQA 5AV8C 5B24C 3NQJA 5B0YD 5GXQA 3RELB 1M1AA 2HIOD 5BO0A 1HQ3C 3VH5A 1M18A 3MNNC 5FUGA 3V9RB 4J8UD 3AZJC 2G5IC 3AZMA 2Y2GA 1M18B 5G49B 3AZMB 5B2IC 3REJB 1S32D 1P34D 1F66D 3KFUG 1U35D 4H9PB 5BNXA 3O62A 4JJND 3TU4B 1P3KA 4H9SA 3B0DB 1ID3A 5B0YC 1TZYC 2HIOC 3WTPA 3REKA 3W96D 2AROB 4J8UC 2NZDA 1B67A 3W98A 4KHAA 1KX4B 5GT0C 2FFFB 1S32C 1P34C 3B0CT 1PZRA 5CPIA 4Z66A 4ZUXD 2ZY3A 3EPLA 5AVBA 3H0LC 3X1UC 4R8PA 2FJ7B 2J8PA 2PYOD 5AVBB 4LD9A 1P3AD 3F6TA 2BYKB 5B2JD 3AZFA 1R4VA 5B40A 3X1VA 4QLCA 4LD9B 4YS3A 3LELD 3AZFB 4G91B 5B40B 1BH9A 4ZUXC 2CWEA 4CAYB 1B6WA 4XUJB 4DRBA 2PYOC 3MVDC 1P3AC 5B33A 5B2JC 1EQZD 3X1TD 2NQBA 5GSUC 1P3FA 4WV4B 3MGRB 2RVQD 1P3LD 3WAAB 4J8XC 5B33B 3X1SB 1W2EA 5BS7C 3C1CD 3MGSD 2CV5A 2JE5A 1P3PA 3AZEB 5B0ZA 3REIB 4DQYB 2JSSA 1P3PB 4KGCD 5B0ZB 3KUYC 3VH6W 4XZQD 4X23A 4J8VB 4Z5TC 5GXQD 1M1AD 1F1EA 3C1CC 5AV6D 5B32D 4X23B 3W99C 3MGSC 3UTBB 1H3OA 3W97A 3FDDA 3WA9A 1P3OA 5JRGA 4KGCC 1H3OB 3W97B 3LZ0B 3WA9B 3O62D 4XZQC 5JRGB 1P3KD 3KWQB 1ID3D 3MGPD 5GXQC 1M1AC 3LZ1A 1HTAA 1P3MB 3MGQA 3WTPD 3KXBD 3REKD 1M18C 1P3GA 5AV5A 3B6FD 5F99B 1JFIB 3AZID 3AZMC 2NZDD 4WU9B 3W98D 3AV2A 5B1LA 5DNND 3AZNA 3LJAD 1U35B 3UTAD 5AV9B 3AZNB 3O62C 5CPID 4Z66D 1P3KC 1BH8B 4H9SC 1ID3C 3MGPC 1P3BD 3AZGA 3WTPC 3C1BB 3KXBC 4R8PD 3REKC 3VH5T 2NZDC 3W98C 5CPJD 3AV1B 5C3IB 3AZKB 3X1VD 4QLCD 4YS3D 2Y2OA 5B24D 5CPIC 4Z66C 5B31G 3UT9B 1ULYA 2F8NA 5AVBC 1ZLAA 1HQ3D 4EO5C 3AZHA 5CPKA 4R8PC 3MNND 5DNMA 1KX3A 1KX5B 5GT3B 1ZLAB 4LD9C 1WWIA 5CPKB 2NQBD 3AZLA 5DNMB 4M6BA 3AZFC 1KX3B 3H0MC 4NE5A 5B40C 3X1VC 4QLCC 2HUEB 4YS3C 3RELA 3AZLB 5AVCA 3R45A 5CHLB 2Y2QA 3KSYA 3V9RA 5B1MB 1TZYD 5AVCB 3R45B 3VH6A 5G49A 4YM6A 3X1TB 2RIQA 3REJA 2XD1A 5B33C 2NQBC 3B0CW 4H9PA 5GT0D 4WNNA 3TU4A 4YM6B 1P3FC 4WNNB 2AROA 2CV5C 5AY8B 1P3PC 3X1UD 4H9OA 1KX4A 5B0ZC 4Z2MH 1P3OD 4H9OB 5BT1C 5B31B 4AWLC 2W8SA 4X23C 3LZ1D 2FJ7A 3MGQD 4HGAC 2BYKA 4UUZB 1AOIB 3W97C 3AV2D 3MVDD 3AYWB 3A6NA 3WA9C 1P3OC 5JRGC 4KUDB 5GSUD 4J8XD 3A6NB 5E5AA 3REHD 5KDMB 5CP6A 4CAYA 3LZ1C 4J8WB 3AZGD 4XUJA 3MGQC 5E5AB 1P3IB 4H9NA 5CP6B 1P3GC 5AV5C 5DNNB 2F8NK 3MGRA 3AV2C 4H9NB 5B1LC 3WAAA 3LJAB 4WU8A 2DF4C 3AZNC 4WJ3C 1M19B 3KUYD 3B6GD 3X1SA 4WU8B 3AN2B 2Y2JA 2ZY2A 1S32B 3REHC 4Z5TD 2F8ND 4H9RB 4UPKA 3AZEA 3AZGC 3REIA 3AZHD 3W99D 3AFAB 2Y2KA 4NFTA 3WKJA 5JA4B 4J8VA 5AV8B 3RELD 3B6GC 4G92B 3WKJB 3UTBA 3A1KA 3WTPE 2Y2IA 1ZLAC 2F8NH 1M18D 3AZHC 3AZJB 5CPKC 1KX3C 3AZMD 3LZ0A 3REJD 2HUEC 5B2IB 3TU4D 3AZLC 3KWQA 2HIOA 3RELC 3B0BA 5AVCC 1P3MA 5B0YB 4WZSB 2HIOB 1A7WA 5F99A 1JFIA 3VH5W 4WU9A 4J8UB 1KX4D 2Y2LA 4YM6C 1F66A 1U35A 4JJNA 3REJC 5AV9A 1N1JB 2XD5A 2G5HC 1P34B
chains in the Genus database with same CATH topology
1F66B 1BH8A 4JJNB 2YFWB 3B0DC 3W96A 3C1BA 2FJ7D 2AROC 5AVBD 3W96B 2VQRA 2Y2MA 2F2AC 3AV1A 1KX4C 3AZKA 4LD9D 3AZFD 5B40D 3UT9A 4ZUXB 2FJ7C 1P3AA 4XUJD 5B2JA 1KX5A 5GT3A 2PYOB 5B32G 1P3AB 3MGRD 3LELA 5B2JB 3WAAD 3A6NC 5B33D 1P3FD 4G91C 3X1SD 3LELB 5B1MA 5CP6C 4XUJC 3REID 2IO5B 2YFVB 2CV5D 1EQZA 3X1TA 1P3PD 1P3LA 5B0ZD 3MGRC 3NQUA 1EQZB 3P5JB 3WAAC 4WU8C 1P3LB 5BT1D 3NQUB 3X1SC 4CSRB 4Z5TB 4X23D 5AY8A 3C1CB 3MGSB 3AZEC 3REIC 3W97D 2L5AA 3LZ0D 5B31A 4KGCB 4G92C 3WA9D 3WKJC 5JRGD 4J8VC 3KWQD 4XZQB 5AV6A 5B32A 1P3MD 3NQJB 5GXQB 1M1AB 1WWSA 3UTBC 5BO0B 4UUZA 5F99D 5AV6B 5B32B 5FUGB 4WU9D 1Z2CB 1AOIA 1TAFA 5BNVA 3AYWA 1P3GD 5AV5D 4KUDA 3LZ0C 1TAFB 5B1LD 5BNVB 5AV9D 3AZND 3MGPA 5KDMA 3KWQC 5BNXB 3O62B 1P3KB 3KXBA 4J8WA 1ID3B 4H9QA 3MGPB 1P3MC 3C1BD 1P3IA 3B6FA 3AZIA 3WTPB 5F99C 3KXBB 4E45A 3REKB 4H9QB 5DNNA 4WU9C 3B6FB 3AZIB 3AV1D 3LJAA 2NZDB 3W98B 3UTAA 4Z2MG 3AZKD 4KHAB 1M19A 1U35C 4JJNC 1F66C 5AV9C 3AN2A 1P3BA 4NE3A 4ZBJB 3UT9D 3UTAB 5CPIB 4Z66B 4H9RA 3W96C 1P3BB 2ZY5A 3C1BC 4DRAA 3AFAA 4EO5B 4R8PB 1KX5D 5GT3D 5CPJA 1ZLAD 2Y2PA 5CPKD 2UWXA 5DNMD 3EPJA 3AV1C 3IP4C 5JA4A 5C3IC 3AZKC 3TU4C 1KX3D 5CPJB 5B24A 5AV8A 3AZLD 4QLCB 3X1VB 4YS3B 2BYMA 3A1IA 3UT9C 5B24B 5B1MD 1HQ3A 1BH9B 5AVCD 3MNNA 2Y2HA 2BYMB 3AZJA 1HQ3B 3MNNB 1KX5C 5GT3C 2BG1A 5B2IA 5DNMC 4YM6D 3LELC 2NQBB 1Q9CA 1P3FB 5B0YA 1TZYA 5B1MC 2IO5C 5AY8D 4J8UA 1TZYB 2CV5B 2AROD 1EQZC 3X1TC 5GT0A 1P3LC 2RVQC 1N1JA 5B31D 1S32A 1P34A 2YFWA 5GT0B 4AWLB 3EPKA 2DQNC 3X1UA 5AY8C 4NE6A 2JCHA 4HGAB 1AOID 3X1UB 2F8NG 3AYWD 4KUDD 1P3OB 2ZM5A 5B31C 1T3UA 3A6ND 3VH6T 4ZUXA 2Y2NA 5AV6C 5B32C 4J8WD 5E5AD 3LZ1B 1P3ID 5CP6D 3MGQB 2PYOA 3MVDA 4E44A 1P3GB 3AL0C 5AV5B 1AOIC 3AYWC 5GSUA 3AV2B 1M19D 5B1LB 3MVDB 4J8XA 4KUDC 3REHA 5GSUB 3AN2D 4WU8D 4J8XB 5BS7A 3REHB 4J8WC 3B6FC 2YFVA 5E5AC 1P3IC 3AFAD 3AZIC 3AZGB 3AZED 2ZY4A 5DNNC 3EG5B 3LJAC 3KUYA 3B6GA 4ZBJC 3UTAC 1M19C 1BFMA 5AV8D 4CSRA 4Z5TA 3AN2C 3H0RC 3KUYB 1P3BC 3B6GB 4J8VD 3WKJD 1KU5A 3C1CA 3MGSA 3W99A 2LY8A 2F8NB 3AZJD 3AFAC 3UTBD 3AZHB 3W99B 5CPJC 3EPHA 4KGCA 5B2ID 4XZQA 5AV8C 5B24C 3NQJA 5B0YD 5GXQA 3RELB 1M1AA 2HIOD 5BO0A 1HQ3C 3VH5A 1M18A 3MNNC 5FUGA 3V9RB 4J8UD 3AZJC 2G5IC 3AZMA 2Y2GA 1M18B 5G49B 3AZMB 5B2IC 3REJB 1S32D 1P34D 1F66D 3KFUG 1U35D 4H9PB 5BNXA 3O62A 4JJND 3TU4B 1P3KA 4H9SA 3B0DB 1ID3A 5B0YC 1TZYC 2HIOC 3WTPA 3REKA 3W96D 2AROB 4J8UC 2NZDA 1B67A 3W98A 4KHAA 1KX4B 5GT0C 2FFFB 1S32C 1P34C 3B0CT 1PZRA 5CPIA 4Z66A 4ZUXD 2ZY3A 3EPLA 5AVBA 3H0LC 3X1UC 4R8PA 2FJ7B 2J8PA 2PYOD 5AVBB 4LD9A 1P3AD 3F6TA 2BYKB 5B2JD 3AZFA 1R4VA 5B40A 3X1VA 4QLCA 4LD9B 4YS3A 3LELD 3AZFB 4G91B 5B40B 1BH9A 4ZUXC 2CWEA 4CAYB 1B6WA 4XUJB 4DRBA 2PYOC 3MVDC 1P3AC 5B33A 5B2JC 1EQZD 3X1TD 2NQBA 5GSUC 1P3FA 4WV4B 3MGRB 2RVQD 1P3LD 3WAAB 4J8XC 5B33B 3X1SB 1W2EA 5BS7C 3C1CD 3MGSD 2CV5A 2JE5A 1P3PA 3AZEB 5B0ZA 3REIB 4DQYB 2JSSA 1P3PB 4KGCD 5B0ZB 3KUYC 3VH6W 4XZQD 4X23A 4J8VB 4Z5TC 5GXQD 1M1AD 1F1EA 3C1CC 5AV6D 5B32D 4X23B 3W99C 3MGSC 3UTBB 1H3OA 3W97A 3FDDA 3WA9A 1P3OA 5JRGA 4KGCC 1H3OB 3W97B 3LZ0B 3WA9B 3O62D 4XZQC 5JRGB 1P3KD 3KWQB 1ID3D 3MGPD 5GXQC 1M1AC 3LZ1A 1HTAA 1P3MB 3MGQA 3WTPD 3KXBD 3REKD 1M18C 1P3GA 5AV5A 3B6FD 5F99B 1JFIB 3AZID 3AZMC 2NZDD 4WU9B 3W98D 3AV2A 5B1LA 5DNND 3AZNA 3LJAD 1U35B 3UTAD 5AV9B 3AZNB 3O62C 5CPID 4Z66D 1P3KC 1BH8B 4H9SC 1ID3C 3MGPC 1P3BD 3AZGA 3WTPC 3C1BB 3KXBC 4R8PD 3REKC 3VH5T 2NZDC 3W98C 5CPJD 3AV1B 5C3IB 3AZKB 3X1VD 4QLCD 4YS3D 2Y2OA 5B24D 5CPIC 4Z66C 5B31G 3UT9B 1ULYA 2F8NA 5AVBC 1ZLAA 1HQ3D 4EO5C 3AZHA 5CPKA 4R8PC 3MNND 5DNMA 1KX3A 1KX5B 5GT3B 1ZLAB 4LD9C 1WWIA 5CPKB 2NQBD 3AZLA 5DNMB 4M6BA 3AZFC 1KX3B 3H0MC 4NE5A 5B40C 3X1VC 4QLCC 2HUEB 4YS3C 3RELA 3AZLB 5AVCA 3R45A 5CHLB 2Y2QA 3KSYA 3V9RA 5B1MB 1TZYD 5AVCB 3R45B 3VH6A 5G49A 4YM6A 3X1TB 2RIQA 3REJA 2XD1A 5B33C 2NQBC 3B0CW 4H9PA 5GT0D 4WNNA 3TU4A 4YM6B 1P3FC 4WNNB 2AROA 2CV5C 5AY8B 1P3PC 3X1UD 4H9OA 1KX4A 5B0ZC 4Z2MH 1P3OD 4H9OB 5BT1C 5B31B 4AWLC 2W8SA 4X23C 3LZ1D 2FJ7A 3MGQD 4HGAC 2BYKA 4UUZB 1AOIB 3W97C 3AV2D 3MVDD 3AYWB 3A6NA 3WA9C 1P3OC 5JRGC 4KUDB 5GSUD 4J8XD 3A6NB 5E5AA 3REHD 5KDMB 5CP6A 4CAYA 3LZ1C 4J8WB 3AZGD 4XUJA 3MGQC 5E5AB 1P3IB 4H9NA 5CP6B 1P3GC 5AV5C 5DNNB 2F8NK 3MGRA 3AV2C 4H9NB 5B1LC 3WAAA 3LJAB 4WU8A 2DF4C 3AZNC 4WJ3C 1M19B 3KUYD 3B6GD 3X1SA 4WU8B 3AN2B 2Y2JA 2ZY2A 1S32B 3REHC 4Z5TD 2F8ND 4H9RB 4UPKA 3AZEA 3AZGC 3REIA 3AZHD 3W99D 3AFAB 2Y2KA 4NFTA 3WKJA 5JA4B 4J8VA 5AV8B 3RELD 3B6GC 4G92B 3WKJB 3UTBA 3A1KA 3WTPE 2Y2IA 1ZLAC 2F8NH 1M18D 3AZHC 3AZJB 5CPKC 1KX3C 3AZMD 3LZ0A 3REJD 2HUEC 5B2IB 3TU4D 3AZLC 3KWQA 2HIOA 3RELC 3B0BA 5AVCC 1P3MA 5B0YB 4WZSB 2HIOB 1A7WA 5F99A 1JFIA 3VH5W 4WU9A 4J8UB 1KX4D 2Y2LA 4YM6C 1F66A 1U35A 4JJNA 3REJC 5AV9A 1N1JB 2XD5A 2G5HC 1P34B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 B;  1BH8 A;  4JJN B;  2YFW B;  3B0D C;  3W96 A;  3C1B A;  2FJ7 D;  2ARO C;  5AVB D;  3W96 B;  3AV1 A;  1KX4 C;  3AZK A;  4LD9 D;  3AZF D;  5B40 D;  3UT9 A;  4ZUX B;  2FJ7 C;  1P3A A;  4XUJ D;  5B2J A;  1KX5 A;  5GT3 A;  2PYO B;  5B32 G;  1P3A B;  3MGR D;  3LEL A;  5B2J B;  3WAA D;  3A6N C;  5B33 D;  1P3F D;  4G91 C;  3X1S D;  3LEL B;  5B1M A;  5CP6 C;  4XUJ C;  3REI D;  2IO5 B;  2YFV B;  2CV5 D;  1EQZ A;  3X1T A;  1P3P D;  1P3L A;  5B0Z D;  3MGR C;  3NQU A;  1EQZ B;  3WAA C;  4WU8 C;  1P3L B;  5BT1 D;  3NQU B;  3X1S C;  4CSR B;  4Z5T B;  4X23 D;  5AY8 A;  3C1C B;  3MGS B;  3AZE C;  3REI C;  3W97 D;  2L5A A;  3LZ0 D;  5B31 A;  4KGC B;  4G92 C;  3WA9 D;  3WKJ C;  5JRG D;  4J8V C;  3KWQ D;  4XZQ B;  5AV6 A;  5B32 A;  1P3M D;  3NQJ B;  5GXQ B;  1M1A B;  1WWS A;  3UTB C;  5BO0 B;  4UUZ A;  5F99 D;  5AV6 B;  5B32 B;  5FUG B;  4WU9 D;  1AOI A;  1TAF A;  5BNV A;  3AYW A;  1P3G D;  5AV5 D;  4KUD A;  3LZ0 C;  1TAF B;  5B1L D;  5BNV B;  5AV9 D;  3AZN D;  3MGP A;  5KDM A;  3KWQ C;  5BNX B;  3O62 B;  1P3K B;  3KXB A;  4J8W A;  1ID3 B;  4H9Q A;  3MGP B;  1P3M C;  3C1B D;  1P3I A;  3B6F A;  3AZI A;  3WTP B;  5F99 C;  3KXB B;  4E45 A;  3REK B;  4H9Q B;  5DNN A;  4WU9 C;  3B6F B;  3AZI B;  3AV1 D;  3LJA A;  2NZD B;  3W98 B;  3UTA A;  4Z2M G;  3AZK D;  4KHA B;  1M19 A;  1U35 C;  4JJN C;  1F66 C;  5AV9 C;  3AN2 A;  1P3B A;  4NE3 A;  4ZBJ B;  3UT9 D;  3UTA B;  5CPI B;  4Z66 B;  4H9R A;  3W96 C;  1P3B B;  3C1B C;  4DRA A;  3AFA A;  4EO5 B;  4R8P B;  1KX5 D;  5GT3 D;  5CPJ A;  1ZLA D;  5CPK D;  3AV1 C;  5DNM D;  1KX3 D;  5JA4 A;  5C3I C;  3AZK C;  3TU4 C;  5CPJ B;  5B24 A;  5AV8 A;  3AZL D;  4QLC B;  3X1V B;  4YS3 B;  2BYM A;  3UT9 C;  5B24 B;  5B1M D;  1HQ3 A;  1BH9 B;  5AVC D;  3MNN A;  2BYM B;  3AZJ A;  1HQ3 B;  3MNN B;  1KX5 C;  5GT3 C;  5B2I A;  5DNM C;  4YM6 D;  3LEL C;  2NQB B;  1Q9C A;  1P3F B;  5B0Y A;  1TZY A;  5B1M C;  2IO5 C;  5AY8 D;  4J8U A;  1TZY B;  2CV5 B;  2ARO D;  1EQZ C;  3X1T C;  5GT0 A;  1P3L C;  2RVQ C;  1N1J A;  5B31 D;  1S32 A;  1P34 A;  2YFW A;  5GT0 B;  4AWL B;  3X1U A;  5AY8 C;  4NE6 A;  4HGA B;  1AOI D;  3X1U B;  2F8N G;  3AYW D;  4KUD D;  1P3O B;  5B31 C;  3A6N D;  3VH6 T;  4ZUX A;  5AV6 C;  5B32 C;  4J8W D;  5E5A D;  3LZ1 B;  1P3I D;  5CP6 D;  3MGQ B;  2PYO A;  3MVD A;  4E44 A;  1P3G B;  5AV5 B;  1AOI C;  3AYW C;  5GSU A;  3AV2 B;  1M19 D;  5B1L B;  3MVD B;  4J8X A;  4KUD C;  3REH A;  5GSU B;  3AN2 D;  4WU8 D;  4J8X B;  5BS7 A;  3REH B;  4J8W C;  3B6F C;  2YFV A;  5E5A C;  1P3I C;  3AFA D;  3AZI C;  3AZG B;  3AZE D;  5DNN C;  3LJA C;  3KUY A;  3B6G A;  4ZBJ C;  3UTA C;  1M19 C;  1BFM A;  5AV8 D;  4CSR A;  4Z5T A;  3AN2 C;  3KUY B;  1P3B C;  3B6G B;  3WKJ D;  4J8V D;  1KU5 A;  3C1C A;  3MGS A;  3W99 A;  2LY8 A;  2F8N B;  3AZJ D;  3AFA C;  3UTB D;  3AZH B;  3W99 B;  5CPJ C;  4KGC A;  5B2I D;  4XZQ A;  5AV8 C;  5B24 C;  3NQJ A;  5B0Y D;  5GXQ A;  3REL B;  1M1A A;  2HIO D;  5BO0 A;  1HQ3 C;  3VH5 A;  1M18 A;  3MNN C;  5FUG A;  3V9R B;  4J8U D;  3AZJ C;  3AZM A;  1M18 B;  5G49 B;  3AZM B;  5B2I C;  3REJ B;  1S32 D;  1P34 D;  1F66 D;  1U35 D;  4H9P B;  5BNX A;  3O62 A;  4JJN D;  3TU4 B;  1P3K A;  4H9S A;  3B0D B;  1ID3 A;  5B0Y C;  1TZY C;  2HIO C;  3WTP A;  3REK A;  3W96 D;  2ARO B;  4J8U C;  2NZD A;  1B67 A;  3W98 A;  4KHA A;  1KX4 B;  5GT0 C;  1S32 C;  1P34 C;  3B0C T;  5CPI A;  4Z66 A;  4ZUX D;  5AVB A;  3X1U C;  4R8P A;  2FJ7 B;  2PYO D;  5AVB B;  4LD9 A;  1P3A D;  2BYK B;  5B2J D;  3AZF A;  1R4V A;  5B40 A;  3X1V A;  4QLC A;  4LD9 B;  4YS3 A;  3LEL D;  3AZF B;  4G91 B;  5B40 B;  1BH9 A;  4ZUX C;  2CWE A;  4CAY B;  1B6W A;  4XUJ B;  4DRB A;  2PYO C;  3MVD C;  1P3A C;  5B33 A;  5B2J C;  1EQZ D;  3X1T D;  2NQB A;  5GSU C;  1P3F A;  4WV4 B;  3MGR B;  2RVQ D;  1P3L D;  3WAA B;  4J8X C;  5B33 B;  3X1S B;  5BS7 C;  3C1C D;  3MGS D;  2CV5 A;  1P3P A;  3AZE B;  5B0Z A;  3REI B;  2JSS A;  1P3P B;  4KGC D;  5B0Z B;  3KUY C;  3VH6 W;  4XZQ D;  4X23 A;  4J8V B;  4Z5T C;  5GXQ D;  1M1A D;  1F1E A;  3C1C C;  5AV6 D;  5B32 D;  4X23 B;  3W99 C;  3MGS C;  3UTB B;  1H3O A;  3W97 A;  3WA9 A;  1P3O A;  5JRG A;  4KGC C;  1H3O B;  3W97 B;  3LZ0 B;  3WA9 B;  3O62 D;  4XZQ C;  5JRG B;  1P3K D;  3KWQ B;  1ID3 D;  3MGP D;  5GXQ C;  1M1A C;  3LZ1 A;  1HTA A;  1P3M B;  3MGQ A;  3WTP D;  3KXB D;  3REK D;  1M18 C;  1P3G A;  5AV5 A;  3B6F D;  5F99 B;  1JFI B;  3AZI D;  3AZM C;  2NZD D;  4WU9 B;  3W98 D;  3AV2 A;  5B1L A;  5DNN D;  3AZN A;  3LJA D;  1U35 B;  3UTA D;  5AV9 B;  3AZN B;  3O62 C;  5CPI D;  4Z66 D;  1P3K C;  1BH8 B;  4H9S C;  1ID3 C;  3MGP C;  1P3B D;  3AZG A;  3WTP C;  3C1B B;  3KXB C;  4R8P D;  3REK C;  3VH5 T;  2NZD C;  3W98 C;  5CPJ D;  3AV1 B;  5C3I B;  3AZK B;  3X1V D;  4QLC D;  4YS3 D;  5B24 D;  5CPI C;  4Z66 C;  5B31 G;  3UT9 B;  1ULY A;  2F8N A;  5AVB C;  1ZLA A;  1HQ3 D;  4EO5 C;  3AZH A;  5CPK A;  4R8P C;  3MNN D;  5DNM A;  1KX3 A;  1KX5 B;  5GT3 B;  1ZLA B;  4LD9 C;  1WWI A;  5CPK B;  2NQB D;  3AZL A;  5DNM B;  4M6B A;  3AZF C;  1KX3 B;  4NE5 A;  5B40 C;  3X1V C;  4QLC C;  2HUE B;  4YS3 C;  3REL A;  3AZL B;  5AVC A;  3R45 A;  5CHL B;  3KSY A;  3V9R A;  5B1M B;  1TZY D;  5AVC B;  3R45 B;  3VH6 A;  5G49 A;  4YM6 A;  3X1T B;  3REJ A;  5B33 C;  2NQB C;  3B0C W;  4H9P A;  5GT0 D;  4WNN A;  3TU4 A;  4YM6 B;  1P3F C;  4WNN B;  2ARO A;  2CV5 C;  5AY8 B;  1P3P C;  3X1U D;  4H9O A;  1KX4 A;  5B0Z C;  4Z2M H;  1P3O D;  4H9O B;  5BT1 C;  5B31 B;  4AWL C;  4X23 C;  3LZ1 D;  2FJ7 A;  3MGQ D;  4HGA C;  2BYK A;  4UUZ B;  1AOI B;  3W97 C;  3AV2 D;  3MVD D;  3AYW B;  3A6N A;  3WA9 C;  1P3O C;  5JRG C;  4KUD B;  5GSU D;  4J8X D;  3A6N B;  5E5A A;  3REH D;  5KDM B;  5CP6 A;  4CAY A;  3LZ1 C;  4J8W B;  3AZG D;  4XUJ A;  3MGQ C;  5E5A B;  1P3I B;  4H9N A;  5CP6 B;  1P3G C;  5AV5 C;  5DNN B;  2F8N K;  3MGR A;  3AV2 C;  4H9N B;  5B1L C;  3WAA A;  3LJA B;  4WU8 A;  3AZN C;  1M19 B;  3KUY D;  3B6G D;  3X1S A;  4WU8 B;  3AN2 B;  3REH C;  4Z5T D;  2F8N D;  4H9R B;  3AZE A;  3AZG C;  3REI A;  3AZH D;  3W99 D;  3AFA B;  4NFT A;  3WKJ A;  5JA4 B;  4J8V A;  5AV8 B;  3REL D;  3B6G C;  4G92 B;  3WKJ B;  3UTB A;  3WTP E;  1ZLA C;  2F8N H;  1M18 D;  3AZH C;  3AZJ B;  5CPK C;  1KX3 C;  3AZM D;  3LZ0 A;  3REJ D;  2HUE C;  5B2I B;  3TU4 D;  3AZL C;  3KWQ A;  2HIO A;  3REL C;  3B0B A;  5AVC C;  1P3M A;  5B0Y B;  4WZS B;  2HIO B;  1A7W A;  5F99 A;  1JFI A;  3VH5 W;  4WU9 A;  4J8U B;  1KX4 D;  4YM6 C;  1F66 A;  1U35 A;  4JJN A;  3REJ C;  5AV9 A;  1N1J B;  1S32 B;  1P34 B; 
#chains in the Genus database with same CATH topology
 1F66 B;  1BH8 A;  4JJN B;  2YFW B;  3B0D C;  3W96 A;  3C1B A;  2FJ7 D;  2ARO C;  5AVB D;  3W96 B;  2VQR A;  2Y2M A;  2F2A C;  3AV1 A;  1KX4 C;  3AZK A;  4LD9 D;  3AZF D;  5B40 D;  3UT9 A;  4ZUX B;  2FJ7 C;  1P3A A;  4XUJ D;  5B2J A;  1KX5 A;  5GT3 A;  2PYO B;  5B32 G;  1P3A B;  3MGR D;  3LEL A;  5B2J B;  3WAA D;  3A6N C;  5B33 D;  1P3F D;  4G91 C;  3X1S D;  3LEL B;  5B1M A;  5CP6 C;  4XUJ C;  3REI D;  2IO5 B;  2YFV B;  2CV5 D;  1EQZ A;  3X1T A;  1P3P D;  1P3L A;  5B0Z D;  3MGR C;  3NQU A;  1EQZ B;  3P5J B;  3WAA C;  4WU8 C;  1P3L B;  5BT1 D;  3NQU B;  3X1S C;  4CSR B;  4Z5T B;  4X23 D;  5AY8 A;  3C1C B;  3MGS B;  3AZE C;  3REI C;  3W97 D;  2L5A A;  3LZ0 D;  5B31 A;  4KGC B;  4G92 C;  3WA9 D;  3WKJ C;  5JRG D;  4J8V C;  3KWQ D;  4XZQ B;  5AV6 A;  5B32 A;  1P3M D;  3NQJ B;  5GXQ B;  1M1A B;  1WWS A;  3UTB C;  5BO0 B;  4UUZ A;  5F99 D;  5AV6 B;  5B32 B;  5FUG B;  4WU9 D;  1Z2C B;  1AOI A;  1TAF A;  5BNV A;  3AYW A;  1P3G D;  5AV5 D;  4KUD A;  3LZ0 C;  1TAF B;  5B1L D;  5BNV B;  5AV9 D;  3AZN D;  3MGP A;  5KDM A;  3KWQ C;  5BNX B;  3O62 B;  1P3K B;  3KXB A;  4J8W A;  1ID3 B;  4H9Q A;  3MGP B;  1P3M C;  3C1B D;  1P3I A;  3B6F A;  3AZI A;  3WTP B;  5F99 C;  3KXB B;  4E45 A;  3REK B;  4H9Q B;  5DNN A;  4WU9 C;  3B6F B;  3AZI B;  3AV1 D;  3LJA A;  2NZD B;  3W98 B;  3UTA A;  4Z2M G;  3AZK D;  4KHA B;  1M19 A;  1U35 C;  4JJN C;  1F66 C;  5AV9 C;  3AN2 A;  1P3B A;  4NE3 A;  4ZBJ B;  3UT9 D;  3UTA B;  5CPI B;  4Z66 B;  4H9R A;  3W96 C;  1P3B B;  2ZY5 A;  3C1B C;  4DRA A;  3AFA A;  4EO5 B;  4R8P B;  1KX5 D;  5GT3 D;  5CPJ A;  1ZLA D;  2Y2P A;  5CPK D;  2UWX A;  5DNM D;  3EPJ A;  3AV1 C;  3IP4 C;  5JA4 A;  5C3I C;  3AZK C;  3TU4 C;  1KX3 D;  5CPJ B;  5B24 A;  5AV8 A;  3AZL D;  4QLC B;  3X1V B;  4YS3 B;  2BYM A;  3A1I A;  3UT9 C;  5B24 B;  5B1M D;  1HQ3 A;  1BH9 B;  5AVC D;  3MNN A;  2Y2H A;  2BYM B;  3AZJ A;  1HQ3 B;  3MNN B;  1KX5 C;  5GT3 C;  2BG1 A;  5B2I A;  5DNM C;  4YM6 D;  3LEL C;  2NQB B;  1Q9C A;  1P3F B;  5B0Y A;  1TZY A;  5B1M C;  2IO5 C;  5AY8 D;  4J8U A;  1TZY B;  2CV5 B;  2ARO D;  1EQZ C;  3X1T C;  5GT0 A;  1P3L C;  2RVQ C;  1N1J A;  5B31 D;  1S32 A;  1P34 A;  2YFW A;  5GT0 B;  4AWL B;  3EPK A;  2DQN C;  3X1U A;  5AY8 C;  4NE6 A;  2JCH A;  4HGA B;  1AOI D;  3X1U B;  2F8N G;  3AYW D;  4KUD D;  1P3O B;  2ZM5 A;  5B31 C;  1T3U A;  3A6N D;  3VH6 T;  4ZUX A;  2Y2N A;  5AV6 C;  5B32 C;  4J8W D;  5E5A D;  3LZ1 B;  1P3I D;  5CP6 D;  3MGQ B;  2PYO A;  3MVD A;  4E44 A;  1P3G B;  3AL0 C;  5AV5 B;  1AOI C;  3AYW C;  5GSU A;  3AV2 B;  1M19 D;  5B1L B;  3MVD B;  4J8X A;  4KUD C;  3REH A;  5GSU B;  3AN2 D;  4WU8 D;  4J8X B;  5BS7 A;  3REH B;  4J8W C;  3B6F C;  2YFV A;  5E5A C;  1P3I C;  3AFA D;  3AZI C;  3AZG B;  3AZE D;  2ZY4 A;  5DNN C;  3EG5 B;  3LJA C;  3KUY A;  3B6G A;  4ZBJ C;  3UTA C;  1M19 C;  1BFM A;  5AV8 D;  4CSR A;  4Z5T A;  3AN2 C;  3H0R C;  3KUY B;  1P3B C;  3B6G B;  4J8V D;  3WKJ D;  1KU5 A;  3C1C A;  3MGS A;  3W99 A;  2LY8 A;  2F8N B;  3AZJ D;  3AFA C;  3UTB D;  3AZH B;  3W99 B;  5CPJ C;  3EPH A;  4KGC A;  5B2I D;  4XZQ A;  5AV8 C;  5B24 C;  3NQJ A;  5B0Y D;  5GXQ A;  3REL B;  1M1A A;  2HIO D;  5BO0 A;  1HQ3 C;  3VH5 A;  1M18 A;  3MNN C;  5FUG A;  3V9R B;  4J8U D;  3AZJ C;  2G5I C;  3AZM A;  2Y2G A;  1M18 B;  5G49 B;  3AZM B;  5B2I C;  3REJ B;  1S32 D;  1P34 D;  1F66 D;  3KFU G;  1U35 D;  4H9P B;  5BNX A;  3O62 A;  4JJN D;  3TU4 B;  1P3K A;  4H9S A;  3B0D B;  1ID3 A;  5B0Y C;  1TZY C;  2HIO C;  3WTP A;  3REK A;  3W96 D;  2ARO B;  4J8U C;  2NZD A;  1B67 A;  3W98 A;  4KHA A;  1KX4 B;  5GT0 C;  2FFF B;  1S32 C;  1P34 C;  3B0C T;  1PZR A;  5CPI A;  4Z66 A;  4ZUX D;  2ZY3 A;  3EPL A;  5AVB A;  3H0L C;  3X1U C;  4R8P A;  2FJ7 B;  2J8P A;  2PYO D;  5AVB B;  4LD9 A;  1P3A D;  3F6T A;  2BYK B;  5B2J D;  3AZF A;  1R4V A;  5B40 A;  3X1V A;  4QLC A;  4LD9 B;  4YS3 A;  3LEL D;  3AZF B;  4G91 B;  5B40 B;  1BH9 A;  4ZUX C;  2CWE A;  4CAY B;  1B6W A;  4XUJ B;  4DRB A;  2PYO C;  3MVD C;  1P3A C;  5B33 A;  5B2J C;  1EQZ D;  3X1T D;  2NQB A;  5GSU C;  1P3F A;  4WV4 B;  3MGR B;  2RVQ D;  1P3L D;  3WAA B;  4J8X C;  5B33 B;  3X1S B;  1W2E A;  5BS7 C;  3C1C D;  3MGS D;  2CV5 A;  2JE5 A;  1P3P A;  3AZE B;  5B0Z A;  3REI B;  4DQY B;  2JSS A;  1P3P B;  4KGC D;  5B0Z B;  3KUY C;  3VH6 W;  4XZQ D;  4X23 A;  4J8V B;  4Z5T C;  5GXQ D;  1M1A D;  1F1E A;  3C1C C;  5AV6 D;  5B32 D;  4X23 B;  3W99 C;  3MGS C;  3UTB B;  1H3O A;  3W97 A;  3FDD A;  3WA9 A;  1P3O A;  5JRG A;  4KGC C;  1H3O B;  3W97 B;  3LZ0 B;  3WA9 B;  3O62 D;  4XZQ C;  5JRG B;  1P3K D;  3KWQ B;  1ID3 D;  3MGP D;  5GXQ C;  1M1A C;  3LZ1 A;  1HTA A;  1P3M B;  3MGQ A;  3WTP D;  3KXB D;  3REK D;  1M18 C;  1P3G A;  5AV5 A;  3B6F D;  5F99 B;  1JFI B;  3AZI D;  3AZM C;  2NZD D;  4WU9 B;  3W98 D;  3AV2 A;  5B1L A;  5DNN D;  3AZN A;  3LJA D;  1U35 B;  3UTA D;  5AV9 B;  3AZN B;  3O62 C;  5CPI D;  4Z66 D;  1P3K C;  1BH8 B;  4H9S C;  1ID3 C;  3MGP C;  1P3B D;  3AZG A;  3WTP C;  3C1B B;  3KXB C;  4R8P D;  3REK C;  3VH5 T;  2NZD C;  3W98 C;  5CPJ D;  3AV1 B;  5C3I B;  3AZK B;  3X1V D;  4QLC D;  4YS3 D;  2Y2O A;  5B24 D;  5CPI C;  4Z66 C;  5B31 G;  3UT9 B;  1ULY A;  2F8N A;  5AVB C;  1ZLA A;  1HQ3 D;  4EO5 C;  3AZH A;  5CPK A;  4R8P C;  3MNN D;  5DNM A;  1KX3 A;  1KX5 B;  5GT3 B;  1ZLA B;  4LD9 C;  1WWI A;  5CPK B;  2NQB D;  3AZL A;  5DNM B;  4M6B A;  3AZF C;  1KX3 B;  3H0M C;  4NE5 A;  5B40 C;  3X1V C;  4QLC C;  2HUE B;  4YS3 C;  3REL A;  3AZL B;  5AVC A;  3R45 A;  5CHL B;  2Y2Q A;  3KSY A;  3V9R A;  5B1M B;  1TZY D;  5AVC B;  3R45 B;  3VH6 A;  5G49 A;  4YM6 A;  3X1T B;  2RIQ A;  3REJ A;  2XD1 A;  5B33 C;  2NQB C;  3B0C W;  4H9P A;  5GT0 D;  4WNN A;  3TU4 A;  4YM6 B;  1P3F C;  4WNN B;  2ARO A;  2CV5 C;  5AY8 B;  1P3P C;  3X1U D;  4H9O A;  1KX4 A;  5B0Z C;  4Z2M H;  1P3O D;  4H9O B;  5BT1 C;  5B31 B;  4AWL C;  2W8S A;  4X23 C;  3LZ1 D;  2FJ7 A;  3MGQ D;  4HGA C;  2BYK A;  4UUZ B;  1AOI B;  3W97 C;  3AV2 D;  3MVD D;  3AYW B;  3A6N A;  3WA9 C;  1P3O C;  5JRG C;  4KUD B;  5GSU D;  4J8X D;  3A6N B;  5E5A A;  3REH D;  5KDM B;  5CP6 A;  4CAY A;  3LZ1 C;  4J8W B;  3AZG D;  4XUJ A;  3MGQ C;  5E5A B;  1P3I B;  4H9N A;  5CP6 B;  1P3G C;  5AV5 C;  5DNN B;  2F8N K;  3MGR A;  3AV2 C;  4H9N B;  5B1L C;  3WAA A;  3LJA B;  4WU8 A;  2DF4 C;  3AZN C;  4WJ3 C;  1M19 B;  3KUY D;  3B6G D;  3X1S A;  4WU8 B;  3AN2 B;  2Y2J A;  2ZY2 A;  1S32 B;  3REH C;  4Z5T D;  2F8N D;  4H9R B;  4UPK A;  3AZE A;  3AZG C;  3REI A;  3AZH D;  3W99 D;  3AFA B;  2Y2K A;  4NFT A;  3WKJ A;  5JA4 B;  4J8V A;  5AV8 B;  3REL D;  3B6G C;  4G92 B;  3WKJ B;  3UTB A;  3A1K A;  3WTP E;  2Y2I A;  1ZLA C;  2F8N H;  1M18 D;  3AZH C;  3AZJ B;  5CPK C;  1KX3 C;  3AZM D;  3LZ0 A;  3REJ D;  2HUE C;  5B2I B;  3TU4 D;  3AZL C;  3KWQ A;  2HIO A;  3REL C;  3B0B A;  5AVC C;  1P3M A;  5B0Y B;  4WZS B;  2HIO B;  1A7W A;  5F99 A;  1JFI A;  3VH5 W;  4WU9 A;  4J8U B;  1KX4 D;  2Y2L A;  4YM6 C;  1F66 A;  1U35 A;  4JJN A;  3REJ C;  5AV9 A;  1N1J B;  2XD5 A;  2G5H C;  1P34 B; 
#chains in the Genus database with same CATH homology
 1F66 B;  1BH8 A;  4JJN B;  2YFW B;  3B0D C;  3W96 A;  3C1B A;  2FJ7 D;  2ARO C;  5AVB D;  3W96 B;  2VQR A;  2Y2M A;  2F2A C;  3AV1 A;  1KX4 C;  3AZK A;  4LD9 D;  3AZF D;  5B40 D;  3UT9 A;  4ZUX B;  2FJ7 C;  1P3A A;  4XUJ D;  5B2J A;  1KX5 A;  5GT3 A;  2PYO B;  5B32 G;  1P3A B;  3MGR D;  3LEL A;  5B2J B;  3WAA D;  3A6N C;  5B33 D;  1P3F D;  4G91 C;  3X1S D;  3LEL B;  5B1M A;  5CP6 C;  4XUJ C;  3REI D;  2IO5 B;  2YFV B;  2CV5 D;  1EQZ A;  3X1T A;  1P3P D;  1P3L A;  5B0Z D;  3MGR C;  3NQU A;  1EQZ B;  3P5J B;  3WAA C;  4WU8 C;  1P3L B;  5BT1 D;  3NQU B;  3X1S C;  4CSR B;  4Z5T B;  4X23 D;  5AY8 A;  3C1C B;  3MGS B;  3AZE C;  3REI C;  3W97 D;  2L5A A;  3LZ0 D;  5B31 A;  4KGC B;  4G92 C;  3WA9 D;  3WKJ C;  5JRG D;  4J8V C;  3KWQ D;  4XZQ B;  5AV6 A;  5B32 A;  1P3M D;  3NQJ B;  5GXQ B;  1M1A B;  1WWS A;  3UTB C;  5BO0 B;  4UUZ A;  5F99 D;  5AV6 B;  5B32 B;  5FUG B;  4WU9 D;  1Z2C B;  1AOI A;  1TAF A;  5BNV A;  3AYW A;  1P3G D;  5AV5 D;  4KUD A;  3LZ0 C;  1TAF B;  5B1L D;  5BNV B;  5AV9 D;  3AZN D;  3MGP A;  5KDM A;  3KWQ C;  5BNX B;  3O62 B;  1P3K B;  3KXB A;  4J8W A;  1ID3 B;  4H9Q A;  3MGP B;  1P3M C;  3C1B D;  1P3I A;  3B6F A;  3AZI A;  3WTP B;  5F99 C;  3KXB B;  4E45 A;  3REK B;  4H9Q B;  5DNN A;  4WU9 C;  3B6F B;  3AZI B;  3AV1 D;  3LJA A;  2NZD B;  3W98 B;  3UTA A;  4Z2M G;  3AZK D;  4KHA B;  1M19 A;  1U35 C;  4JJN C;  1F66 C;  5AV9 C;  3AN2 A;  1P3B A;  4NE3 A;  4ZBJ B;  3UT9 D;  3UTA B;  5CPI B;  4Z66 B;  4H9R A;  3W96 C;  1P3B B;  2ZY5 A;  3C1B C;  4DRA A;  3AFA A;  4EO5 B;  4R8P B;  1KX5 D;  5GT3 D;  5CPJ A;  1ZLA D;  2Y2P A;  5CPK D;  2UWX A;  5DNM D;  3EPJ A;  3AV1 C;  3IP4 C;  5JA4 A;  5C3I C;  3AZK C;  3TU4 C;  1KX3 D;  5CPJ B;  5B24 A;  5AV8 A;  3AZL D;  4QLC B;  3X1V B;  4YS3 B;  2BYM A;  3A1I A;  3UT9 C;  5B24 B;  5B1M D;  1HQ3 A;  1BH9 B;  5AVC D;  3MNN A;  2Y2H A;  2BYM B;  3AZJ A;  1HQ3 B;  3MNN B;  1KX5 C;  5GT3 C;  2BG1 A;  5B2I A;  5DNM C;  4YM6 D;  3LEL C;  2NQB B;  1Q9C A;  1P3F B;  5B0Y A;  1TZY A;  5B1M C;  2IO5 C;  5AY8 D;  4J8U A;  1TZY B;  2CV5 B;  2ARO D;  1EQZ C;  3X1T C;  5GT0 A;  1P3L C;  2RVQ C;  1N1J A;  5B31 D;  1S32 A;  1P34 A;  2YFW A;  5GT0 B;  4AWL B;  3EPK A;  2DQN C;  3X1U A;  5AY8 C;  4NE6 A;  2JCH A;  4HGA B;  1AOI D;  3X1U B;  2F8N G;  3AYW D;  4KUD D;  1P3O B;  2ZM5 A;  5B31 C;  1T3U A;  3A6N D;  3VH6 T;  4ZUX A;  2Y2N A;  5AV6 C;  5B32 C;  4J8W D;  5E5A D;  3LZ1 B;  1P3I D;  5CP6 D;  3MGQ B;  2PYO A;  3MVD A;  4E44 A;  1P3G B;  3AL0 C;  5AV5 B;  1AOI C;  3AYW C;  5GSU A;  3AV2 B;  1M19 D;  5B1L B;  3MVD B;  4J8X A;  4KUD C;  3REH A;  5GSU B;  3AN2 D;  4WU8 D;  4J8X B;  5BS7 A;  3REH B;  4J8W C;  3B6F C;  2YFV A;  5E5A C;  1P3I C;  3AFA D;  3AZI C;  3AZG B;  3AZE D;  2ZY4 A;  5DNN C;  3EG5 B;  3LJA C;  3KUY A;  3B6G A;  4ZBJ C;  3UTA C;  1M19 C;  1BFM A;  5AV8 D;  4CSR A;  4Z5T A;  3AN2 C;  3H0R C;  3KUY B;  1P3B C;  3B6G B;  4J8V D;  3WKJ D;  1KU5 A;  3C1C A;  3MGS A;  3W99 A;  2LY8 A;  2F8N B;  3AZJ D;  3AFA C;  3UTB D;  3AZH B;  3W99 B;  5CPJ C;  3EPH A;  4KGC A;  5B2I D;  4XZQ A;  5AV8 C;  5B24 C;  3NQJ A;  5B0Y D;  5GXQ A;  3REL B;  1M1A A;  2HIO D;  5BO0 A;  1HQ3 C;  3VH5 A;  1M18 A;  3MNN C;  5FUG A;  3V9R B;  4J8U D;  3AZJ C;  2G5I C;  3AZM A;  2Y2G A;  1M18 B;  5G49 B;  3AZM B;  5B2I C;  3REJ B;  1S32 D;  1P34 D;  1F66 D;  3KFU G;  1U35 D;  4H9P B;  5BNX A;  3O62 A;  4JJN D;  3TU4 B;  1P3K A;  4H9S A;  3B0D B;  1ID3 A;  5B0Y C;  1TZY C;  2HIO C;  3WTP A;  3REK A;  3W96 D;  2ARO B;  4J8U C;  2NZD A;  1B67 A;  3W98 A;  4KHA A;  1KX4 B;  5GT0 C;  2FFF B;  1S32 C;  1P34 C;  3B0C T;  1PZR A;  5CPI A;  4Z66 A;  4ZUX D;  2ZY3 A;  3EPL A;  5AVB A;  3H0L C;  3X1U C;  4R8P A;  2FJ7 B;  2J8P A;  2PYO D;  5AVB B;  4LD9 A;  1P3A D;  3F6T A;  2BYK B;  5B2J D;  3AZF A;  1R4V A;  5B40 A;  3X1V A;  4QLC A;  4LD9 B;  4YS3 A;  3LEL D;  3AZF B;  4G91 B;  5B40 B;  1BH9 A;  4ZUX C;  2CWE A;  4CAY B;  1B6W A;  4XUJ B;  4DRB A;  2PYO C;  3MVD C;  1P3A C;  5B33 A;  5B2J C;  1EQZ D;  3X1T D;  2NQB A;  5GSU C;  1P3F A;  4WV4 B;  3MGR B;  2RVQ D;  1P3L D;  3WAA B;  4J8X C;  5B33 B;  3X1S B;  1W2E A;  5BS7 C;  3C1C D;  3MGS D;  2CV5 A;  2JE5 A;  1P3P A;  3AZE B;  5B0Z A;  3REI B;  4DQY B;  2JSS A;  1P3P B;  4KGC D;  5B0Z B;  3KUY C;  3VH6 W;  4XZQ D;  4X23 A;  4J8V B;  4Z5T C;  5GXQ D;  1M1A D;  1F1E A;  3C1C C;  5AV6 D;  5B32 D;  4X23 B;  3W99 C;  3MGS C;  3UTB B;  1H3O A;  3W97 A;  3FDD A;  3WA9 A;  1P3O A;  5JRG A;  4KGC C;  1H3O B;  3W97 B;  3LZ0 B;  3WA9 B;  3O62 D;  4XZQ C;  5JRG B;  1P3K D;  3KWQ B;  1ID3 D;  3MGP D;  5GXQ C;  1M1A C;  3LZ1 A;  1HTA A;  1P3M B;  3MGQ A;  3WTP D;  3KXB D;  3REK D;  1M18 C;  1P3G A;  5AV5 A;  3B6F D;  5F99 B;  1JFI B;  3AZI D;  3AZM C;  2NZD D;  4WU9 B;  3W98 D;  3AV2 A;  5B1L A;  5DNN D;  3AZN A;  3LJA D;  1U35 B;  3UTA D;  5AV9 B;  3AZN B;  3O62 C;  5CPI D;  4Z66 D;  1P3K C;  1BH8 B;  4H9S C;  1ID3 C;  3MGP C;  1P3B D;  3AZG A;  3WTP C;  3C1B B;  3KXB C;  4R8P D;  3REK C;  3VH5 T;  2NZD C;  3W98 C;  5CPJ D;  3AV1 B;  5C3I B;  3AZK B;  3X1V D;  4QLC D;  4YS3 D;  2Y2O A;  5B24 D;  5CPI C;  4Z66 C;  5B31 G;  3UT9 B;  1ULY A;  2F8N A;  5AVB C;  1ZLA A;  1HQ3 D;  4EO5 C;  3AZH A;  5CPK A;  4R8P C;  3MNN D;  5DNM A;  1KX3 A;  1KX5 B;  5GT3 B;  1ZLA B;  4LD9 C;  1WWI A;  5CPK B;  2NQB D;  3AZL A;  5DNM B;  4M6B A;  3AZF C;  1KX3 B;  3H0M C;  4NE5 A;  5B40 C;  3X1V C;  4QLC C;  2HUE B;  4YS3 C;  3REL A;  3AZL B;  5AVC A;  3R45 A;  5CHL B;  2Y2Q A;  3KSY A;  3V9R A;  5B1M B;  1TZY D;  5AVC B;  3R45 B;  3VH6 A;  5G49 A;  4YM6 A;  3X1T B;  2RIQ A;  3REJ A;  2XD1 A;  5B33 C;  2NQB C;  3B0C W;  4H9P A;  5GT0 D;  4WNN A;  3TU4 A;  4YM6 B;  1P3F C;  4WNN B;  2ARO A;  2CV5 C;  5AY8 B;  1P3P C;  3X1U D;  4H9O A;  1KX4 A;  5B0Z C;  4Z2M H;  1P3O D;  4H9O B;  5BT1 C;  5B31 B;  4AWL C;  2W8S A;  4X23 C;  3LZ1 D;  2FJ7 A;  3MGQ D;  4HGA C;  2BYK A;  4UUZ B;  1AOI B;  3W97 C;  3AV2 D;  3MVD D;  3AYW B;  3A6N A;  3WA9 C;  1P3O C;  5JRG C;  4KUD B;  5GSU D;  4J8X D;  3A6N B;  5E5A A;  3REH D;  5KDM B;  5CP6 A;  4CAY A;  3LZ1 C;  4J8W B;  3AZG D;  4XUJ A;  3MGQ C;  5E5A B;  1P3I B;  4H9N A;  5CP6 B;  1P3G C;  5AV5 C;  5DNN B;  2F8N K;  3MGR A;  3AV2 C;  4H9N B;  5B1L C;  3WAA A;  3LJA B;  4WU8 A;  2DF4 C;  3AZN C;  4WJ3 C;  1M19 B;  3KUY D;  3B6G D;  3X1S A;  4WU8 B;  3AN2 B;  2Y2J A;  2ZY2 A;  1S32 B;  3REH C;  4Z5T D;  2F8N D;  4H9R B;  4UPK A;  3AZE A;  3AZG C;  3REI A;  3AZH D;  3W99 D;  3AFA B;  2Y2K A;  4NFT A;  3WKJ A;  5JA4 B;  4J8V A;  5AV8 B;  3REL D;  3B6G C;  4G92 B;  3WKJ B;  3UTB A;  3A1K A;  3WTP E;  2Y2I A;  1ZLA C;  2F8N H;  1M18 D;  3AZH C;  3AZJ B;  5CPK C;  1KX3 C;  3AZM D;  3LZ0 A;  3REJ D;  2HUE C;  5B2I B;  3TU4 D;  3AZL C;  3KWQ A;  2HIO A;  3REL C;  3B0B A;  5AVC C;  1P3M A;  5B0Y B;  4WZS B;  2HIO B;  1A7W A;  5F99 A;  1JFI A;  3VH5 W;  4WU9 A;  4J8U B;  1KX4 D;  2Y2L A;  4YM6 C;  1F66 A;  1U35 A;  4JJN A;  3REJ C;  5AV9 A;  1N1J B;  2XD5 A;  2G5H C;  1P34 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...