5B33C

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33C00
4H9PA 3VH6A 3C1CB 3MGSC 3MGPD 5B0ZC 3MNNC 1TAFB 3O62C 4NE6A 4J8UB 1KX5C 3WTPA 3A6NA 3AZGB 2NQBC 1HQ3B 4J8WB 1P3BB 1P3KD 3B0DB 1TZYD 2YFVA 5DNND 4YS3B 3AZJC 3MVDD 5F99D 4Z5TD 4X23D 1P3IA 5AVBB 3AZLD 5CPJD 2CV5A 5B1MD 1S32C 3V9RB 5B2ID 5GT3A 3MGPC 1BH9A 4WU8C 3REJC 3RELD 3B6FB 4QLCA 4KGCB 5BNXA 5AV6D 1M1AA 5AVCD 1AOID 3AZFA 5DNMA 3AYWD 4ZBJC 4WZSB 3WKJA 1TZYC 2F8NB 3WTPE 3UTAA 3X1TB 2HIOB 2AROB 3MVDC 4H9QB 5CPKB 5B24B 5CPJC 2BYKB 3AV1A 4ZUXB 3AZHA 3W97C 1P3MB 5B1MC 3X1SA 1KX3C 5B33B 3WTPD 5GSUC 3VH5T 3LZ0B 3UT9C 3MGSA 2HUEC 5B0ZA 3MNNA 3LZ1B 4G92B 2NZDB 4KHAA 3AZED 1P3ID 3O62A 5GXQC 3LELC 4UUZB 3AZIB 5B31B 5BNVA 4XZQB 3NQJA 1KX5A 5GT3D 2NQBA 5BT1C 1F66B 5AY8D 4J8XC 1U35B 1WWSA 4H9OA 3AZJA 3W98B 4J8VD 5AV5B 5CP6B 1A7WA 3AZFD 3KUYD 3REHB 3WKJD 1S32A 3REIC 3MGPA 5KDMA 4YM6B 3AZEC 4WU8A 3KXBB 3REJA 4CSRB 1HTAA 3AZMD 3AZKC 3AV1D 3MGRD 2L5AA 2FJ7C 3AN2B 1M18B 5AV8C 3W96C 3C1CC 5G49A 1P3AB 5AY8C 5B2JB 3AV2B 3R45A 5B0ZD 3MNND 3MVDA 3WAAB 5E5AA 4J8VC 3O62D 5FUGB 5CPJA 4J8UC 3WA9B 3AZGC 3KUYC 3B0CW 3W97A 1HQ3C 4J8WC 5B1MA 1KX3A 4JJNB 4WU9B 1KX5D 1P3BC 4LD9B 2BYMA 5GSUA 3B0DC 2NQBD 3UT9A 3AZMC 4H9PB 3MGRC 3NQUA 1KX4B 1BH8B 5GXQA 4E44A 3LELA 3AFAD 3VH5A 3X1UA 1S32D 3B6FC 5CPID 3WTPB 3A6NB 4WU8D 3REJD 1BFMA 1P3GD 4J8XA 3LJAA 1P3LD 1KU5A 5GT0B 1P3OB 2PYOB 3X1TC 4H9RB 3REKD 4WNNB 3W99B 3TU4B 3REIA 5CPKC 2CV5B 5B24C 2F8NK 3AZEA 4ZUXC 5E5AD 4H9SC 1P3MC 1P3FB 3AFAC 5B32C 3AZKA 5B33C 4QLCB 4AWLC 2FJ7A 5B1LD 3W97D 1ID3B 1KX3D 1EQZC 5BNXB 5CPIC 5GSUD 3W96A 5AV8A 3C1CA 1M1AB 3LZ1C 5DNMB 2NZDC 3UT9D 1P3GC 1H3OB 5AY8A 5JRGD 1P3LC 3UTAB 5B31C 4J8VA 5GXQD 3LELD 1M19B 4HGAB 5B40B 4J8UA 3AZGA 3KUYA 3X1UD 4KUDB 1HQ3A 4J8WA 4H9NA 3REKC 4EO5B 1P3PD 3AZHB 1P3BA 3MGQD 1F66C 3X1SB 2IO5B 5AV9B 5E5AC 5BT1D 3C1BB 3AZMA 3AZNC 4J8XD 3KWQB 3MGRA 3LJAD 5CP6C 4XUJB 5B1LC 5B0YB 3MGSB 1JFIB 3V9RA 4YM6C 3KXBC 4R8PB 5JRGC 3REID 3X1VB 4Z66D 3B6FA 3AN2C 3AZKD 1P34B 3X1UC 3UTBB 2FJ7D 4H9OB 3AZJB 1P3PC 3B6GC 3MGQC 1P3AC 5B2JC 2F8NA 3X1TA 5AV8D 3C1CD 2HIOA 1ZLAB 3W96D 4H9QA 5CPKA 3LJAC 5B24A 2BYKA 4ZUXA 3MGPB 5KDMB 4H9SA 1P3MA 3AFAA 5B32A 1B67A 4JJNC 4WU9C 5B33A 4J8UD 4LD9C 4DRBA 3AZGD 2LY8A 1N1JA 1HQ3D 4J8WD 1WWIA 1EQZA 4Z66C 1P3BD 4NFTA 5CPIA 4YS3D 3LZ1A 2NZDA 1P3GA 4ZBJB 1KX4C 1P3KB 5AVBD 2YFWB 1TZYB 1P3LA 4UUZA 5DNNB 5B31A 3R45B 3MVDB 5F99B 4Z5TB 4X23B 3AZLB 5CPJB 3REKA 1F66A 5B1MB 3B6FD 1KX3B 5B2IB 3AZNA 5GT0C 3RELB 1P3OC 3VH5W 5CP6A 5B1LA 4CAYA 5AV6B 4NE5A 3W99C 3TU4C 2F8ND 5GXQB 5AVCB 3X1TD 2HIOD 4YS3C 1AOIB 3AYWB 2AROD 4YM6A 5CHLB 3KXBA 2RVQC 4CSRA 5JRGA 5AVBC 5CPKD 1P3FC 5B24D 4ZUXD 1P3MD 1ID3C 3AN2A 5B32D 5B33D 4G91B 4J8XB 1P3PA 3LZ0D 3B6GA 3MGQA 1EQZD 1P3AA 5B2JA 5BO0A 3AV2A 4KGCC 3LZ1D 2NZDD 5BS7C 3B0BA 4HGAC 5FUGA 2YFVB 5B40C 3AZID 5B31D 4KUDC 1ULYA 1R4VA 4XZQD 3AZEB 1P3IB 5JA4A 4JJNA 4WU9A 2HIOC 5C3IB 4LD9A 2AROC 3AZKB 2IO5C 5AV9C 2FJ7B 4Z66A 1F66D 3C1BC 1U35D 3KWQC 5GT3B 3W98D 4XUJC 5AV8B 3W96B 1BH9B 5B0YC 3AZND 1KX4A 1BH8A 5AV5D 5AY8B 5CP6D 4WV4B 3LZ0C 3REHD 4J8VB 4Z2MG 4R8PC 3X1VC 3AZFB 4G92C 4YM6D 1TAFA 3KXBD 3KUYB 4Z2MH 4H9NB 3WKJB 3AZIC 1P34C 4XZQC 3UTBC 5GT0A 3AN2D 1P3OA 2PYOA 3AZMB 3AV1B 1M18D 1ZLAC 3MGRB 4H9RA 3B6GD 4WNNA 1P3AD 5B2JD 3TU4A 1U35C 4YS3A 3AV2D 3W99A 3W98C 4DRAA 3WAAD 5AV5C 5AVBA 1P3FA 3WA9D 5B0ZB 3MNNB 4NE3A 4KHAB 3REHC 1ID3A 3O62B 4JJND 4WU9D 4LD9D 5BNVB 1H3OA 3NQJB 1KX5B 3KSYA 1P3KC 4KGCA 2NQBB 5DNNC 1KX4D 5BS7A 5F99C 1M19A 4Z5TC 4X23C 1M18C 5B40A 3AZLC 4KUDA 1B6WA 3AV2C 2AROA 3AFAB 5B32B 3WAAC 5B2IC 3A6ND 5AV9A 4AWLB 1N1JB 3C1BA 1S32B 3B0CT 3RELC 3KWQA 1EQZB 3VH6T 3WA9C 5CPIB 4XUJA 4WU8B 5B0YA 3REJB 5GT0D 1P3OD 1JFIA 2PYOD 5AV6C 1P3GB 2F8NG 5AVCC 1P3LB 1AOIC 3LZ0A 3AYWC 4E45A 3W99D 4R8PA 3TU4D 3X1VA 2F8NH 4M6BA 2CV5D 2CWEA 2RVQD 5G49B 3REKB 1P3FD 5B32G 3AZIA 1P34A 4G91C 4XZQA 4QLCD 3UTBA 1ID3D 5E5AB 3AZNB 1ZLAA 3WTPC 3A6NC 1M1AD 3W97B 5B1LB 5DNMD 1U35A 4CAYB 2BYMB 5GSUB 3W98A 4KGCD 3UTAD 5B31G 2PYOC 2JSSA 5AV5A 3UT9B 1M19D 1P3IC 5JRGB 5B40D 3NQUB 5C3IC 2HUEB 4KUDD 3REHA 1Q9CA 3LELB 3AZHD 2CV5C 3X1SD 5GT3C 5AV9D 3X1UB 1P3PB 3C1BD 3B6GB 3KWQD 3MGQB 1P3KA 2YFWA 1TZYA 4QLCC 5BO0B 4XUJD 5DNNA 5B0YD 3MGSD 1F1EA 5F99A 4Z5TA 4X23A 1M18A 3AZLA 3LJAB 1M1AC 3AZFC 5DNMC 4R8PD 3X1VD 3VH6W 3WKJC 5JA4B 3UTAC 3WAAA 5B2IA 1M19C 3REIB 3RELA 3WA9A 4Z66B 1P34D 3AV1C 3UTBD 4EO5C 3AZJD 3AZHC 5AV6A 3X1SC 5AVCA 1ZLAD 1AOIA 3AYWA
chains in the Genus database with same CATH superfamily
4H9PA 3VH6A 3C1CB 3MGSC 3MGPD 5B0ZC 3MNNC 1TAFB 3O62C 4NE6A 3F6TA 2ZM5A 4J8UB 1KX5C 3WTPA 3A6NA 3AZGB 2NQBC 1HQ3B 2UWXA 4J8WB 3EPKA 1P3BB 1P3KD 3B0DB 1TZYD 2YFVA 5DNND 4YS3B 3AZJC 3H0RC 3MVDD 5F99D 4Z5TD 4X23D 2DQNC 1P3IA 5AVBB 3AZLD 5CPJD 2CV5A 5B1MD 1S32C 3V9RB 5B2ID 5GT3A 3MGPC 1BH9A 4WU8C 3REJC 3RELD 3B6FB 4QLCA 4KGCB 5BNXA 5AV6D 1M1AA 2ZY2A 5AVCD 1AOID 3AZFA 5DNMA 3AYWD 4ZBJC 4WZSB 3WKJA 1TZYC 2F8NB 3WTPE 3UTAA 3X1TB 2HIOB 2AROB 3MVDC 4H9QB 5CPKB 5B24B 5CPJC 2BYKB 3AV1A 4ZUXB 3AZHA 3W97C 3IP4C 1P3MB 5B1MC 3X1SA 1KX3C 5B33B 3WTPD 5GSUC 3VH5T 3LZ0B 2G5HC 1T3UA 3UT9C 3MGSA 2HUEC 5B0ZA 3MNNA 3LZ1B 4G92B 2NZDB 2ZY5A 4KHAA 3AZED 1P3ID 3O62A 5GXQC 3LELC 4UUZB 3AZIB 5B31B 5BNVA 2Y2HA 4XZQB 3NQJA 1KX5A 5GT3D 2NQBA 5BT1C 1F66B 5AY8D 4J8XC 1U35B 1WWSA 4H9OA 3AZJA 3W98B 4J8VD 5AV5B 5CP6B 1A7WA 3AZFD 3KUYD 1PZRA 3REHB 3WKJD 1S32A 3REIC 3MGPA 5KDMA 4YM6B 3AZEC 4WU8A 3KXBB 3REJA 4CSRB 1HTAA 3AZMD 3AZKC 3AV1D 3MGRD 2L5AA 2FJ7C 3AN2B 1M18B 5AV8C 3W96C 3C1CC 5G49A 1P3AB 5AY8C 5B2JB 3AV2B 3R45A 5B0ZD 3MNND 3MVDA 3WAAB 5E5AA 4J8VC 3O62D 5FUGB 5CPJA 4J8UC 3WA9B 3AZGC 3KUYC 3B0CW 3W97A 1HQ3C 4J8WC 5B1MA 1KX3A 3A1KA 4JJNB 4WU9B 1KX5D 1P3BC 4LD9B 2BYMA 5GSUA 3B0DC 2NQBD 3UT9A 3AZMC 4H9PB 3MGRC 3NQUA 2Y2KA 1KX4B 1BH8B 5GXQA 4E44A 3LELA 3AFAD 3VH5A 3X1UA 1S32D 3AL0C 3B6FC 5CPID 3WTPB 3A6NB 4WU8D 3REJD 1BFMA 1P3GD 4J8XA 3LJAA 1P3LD 1KU5A 5GT0B 1P3OB 2PYOB 3X1TC 3FDDA 4H9RB 3REKD 4WNNB 3W99B 3TU4B 3REIA 5CPKC 2CV5B 5B24C 2F8NK 3AZEA 4ZUXC 5E5AD 4H9SC 1P3MC 1P3FB 2Y2QA 3AFAC 5B32C 3AZKA 5B33C 4QLCB 4AWLC 2FJ7A 5B1LD 3W97D 1ID3B 1KX3D 1EQZC 5BNXB 5CPIC 5GSUD 3W96A 5AV8A 3C1CA 1M1AB 3LZ1C 5DNMB 2NZDC 3UT9D 1P3GC 1H3OB 5AY8A 5JRGD 1P3LC 3UTAB 5B31C 4J8VA 5GXQD 3LELD 1M19B 4HGAB 2G5IC 5B40B 4J8UA 3AZGA 3KUYA 3X1UD 4KUDB 1HQ3A 4J8WA 4H9NA 3EPLA 3REKC 4EO5B 1P3PD 3AZHB 2JCHA 1P3BA 3MGQD 1F66C 3KFUG 3X1SB 2IO5B 5AV9B 5E5AC 5BT1D 3C1BB 3AZMA 3AZNC 4J8XD 3KWQB 3MGRA 3LJAD 5CP6C 4XUJB 5B1LC 5B0YB 3MGSB 1JFIB 2FFFB 3V9RA 2ZY3A 4YM6C 3KXBC 4R8PB 5JRGC 3REID 3X1VB 4Z66D 3B6FA 3EG5B 4UPKA 3AN2C 3AZKD 4WJ3C 1P34B 3X1UC 3UTBB 2FJ7D 4H9OB 3P5JB 3AZJB 1P3PC 2Y2PA 3MGQC 3B6GC 1P3AC 5B2JC 2F8NA 3X1TA 5AV8D 3C1CD 2HIOA 1ZLAB 3W96D 2Y2MA 4H9QA 5CPKA 3LJAC 5B24A 2BYKA 4ZUXA 3MGPB 5KDMB 4H9SA 1P3MA 3AFAA 5B32A 1B67A 4JJNC 4WU9C 5B33A 4J8UD 4LD9C 4DRBA 3AZGD 2LY8A 1N1JA 1HQ3D 4J8WD 1WWIA 1EQZA 4Z66C 1P3BD 4NFTA 5CPIA 2JE5A 4YS3D 2Y2GA 3LZ1A 2NZDA 1P3GA 4ZBJB 1KX4C 3EPHA 1P3KB 5AVBD 2YFWB 1TZYB 1P3LA 4UUZA 5DNNB 5B31A 3R45B 2ZY4A 5F99B 3MVDB 3EPJA 4Z5TB 4X23B 3AZLB 2F2AC 5CPJB 3REKA 1F66A 5B1MB 3B6FD 1KX3B 5B2IB 3AZNA 5GT0C 3RELB 1P3OC 3VH5W 5CP6A 5B1LA 2DF4C 4CAYA 5AV6B 4NE5A 3W99C 3TU4C 2F8ND 5GXQB 5AVCB 3X1TD 2HIOD 4YS3C 1AOIB 3AYWB 2AROD 4YM6A 5CHLB 3KXBA 2RVQC 4CSRA 5JRGA 5AVBC 5CPKD 1P3FC 5B24D 4ZUXD 3A1IA 1P3MD 1ID3C 3AN2A 5B32D 5B33D 4G91B 4J8XB 1P3PA 3LZ0D 3B6GA 3MGQA 1EQZD 1P3AA 2VQRA 5B2JA 5BO0A 3AV2A 4KGCC 3LZ1D 2NZDD 2XD1A 5BS7C 3B0BA 4HGAC 5FUGA 2YFVB 5B40C 3AZID 5B31D 4KUDC 1ULYA 1R4VA 4XZQD 3AZEB 1P3IB 5JA4A 4JJNA 4WU9A 2HIOC 5C3IB 4LD9A 2AROC 3AZKB 2IO5C 5AV9C 2FJ7B 4Z66A 1F66D 3C1BC 2BG1A 1U35D 3KWQC 2Y2OA 5GT3B 3W98D 4XUJC 5AV8B 3W96B 1BH9B 5B0YC 3AZND 2XD5A 1KX4A 1BH8A 5AV5D 5AY8B 5CP6D 4WV4B 3LZ0C 4DQYB 3REHD 4J8VB 4Z2MG 4R8PC 3X1VC 3AZFB 4G92C 4YM6D 1TAFA 3KXBD 3KUYB 4Z2MH 4H9NB 3WKJB 3AZIC 1P34C 4XZQC 3UTBC 5GT0A 3AN2D 1P3OA 2Y2NA 2PYOA 3AZMB 3AV1B 1Z2CB 1M18D 1ZLAC 3MGRB 4H9RA 3H0MC 3B6GD 4WNNA 1P3AD 5B2JD 3TU4A 1U35C 4YS3A 3AV2D 3W99A 3W98C 4DRAA 3WAAD 5AV5C 5AVBA 1P3FA 3WA9D 5B0ZB 3MNNB 4NE3A 4KHAB 3REHC 1ID3A 3O62B 4JJND 4WU9D 4LD9D 5BNVB 1H3OA 3NQJB 1KX5B 3KSYA 1P3KC 4KGCA 2NQBB 5DNNC 1KX4D 5BS7A 5F99C 1M19A 4Z5TC 4X23C 1M18C 5B40A 3AZLC 4KUDA 3H0LC 1B6WA 3AV2C 2AROA 3AFAB 5B32B 3WAAC 5B2IC 3A6ND 5AV9A 4AWLB 1N1JB 3C1BA 1S32B 3B0CT 3RELC 2RIQA 3KWQA 3VH6T 1EQZB 3WA9C 5CPIB 4XUJA 4WU8B 5B0YA 3REJB 5GT0D 1P3OD 1JFIA 2PYOD 5AV6C 1P3GB 2F8NG 5AVCC 1P3LB 1AOIC 3LZ0A 3AYWC 4E45A 3W99D 4R8PA 3TU4D 3X1VA 2F8NH 4M6BA 2CV5D 2Y2LA 2CWEA 2RVQD 5G49B 3REKB 1P3FD 5B32G 3AZIA 1W2EA 1P34A 4G91C 4XZQA 4QLCD 3UTBA 1ID3D 5E5AB 3AZNB 1ZLAA 3WTPC 3A6NC 1M1AD 3W97B 5B1LB 5DNMD 1U35A 4CAYB 2BYMB 5GSUB 3W98A 4KGCD 3UTAD 5B31G 2PYOC 2JSSA 5AV5A 3UT9B 1M19D 1P3IC 5JRGB 5B40D 3NQUB 5C3IC 2HUEB 4KUDD 3REHA 1Q9CA 3LELB 3AZHD 2CV5C 3X1SD 5GT3C 5AV9D 3X1UB 2Y2JA 1P3PB 3C1BD 3B6GB 3KWQD 3MGQB 1P3KA 2YFWA 1TZYA 4QLCC 5BO0B 4XUJD 5DNNA 5B0YD 3MGSD 1F1EA 5F99A 2Y2IA 2J8PA 4Z5TA 4X23A 1M18A 3AZLA 3LJAB 1M1AC 3AZFC 5DNMC 4R8PD 3X1VD 3VH6W 3WKJC 5JA4B 3UTAC 3WAAA 5B2IA 1M19C 3REIB 3RELA 3WA9A 4Z66B 1P34D 3AV1C 2W8SA 3UTBD 4EO5C 3AZJD 3AZHC 5AV6A 3X1SC 5AVCA 1ZLAD 1AOIA 3AYWA
chains in the Genus database with same CATH topology
4H9PA 3VH6A 3C1CB 3MGSC 3MGPD 5B0ZC 3MNNC 1TAFB 3O62C 4NE6A 3F6TA 2ZM5A 4J8UB 1KX5C 3WTPA 3A6NA 3AZGB 2NQBC 1HQ3B 2UWXA 4J8WB 3EPKA 1P3BB 1P3KD 3B0DB 1TZYD 2YFVA 5DNND 4YS3B 3AZJC 3H0RC 3MVDD 5F99D 4Z5TD 4X23D 2DQNC 1P3IA 5AVBB 3AZLD 5CPJD 2CV5A 5B1MD 1S32C 3V9RB 5B2ID 5GT3A 3MGPC 1BH9A 4WU8C 3REJC 3RELD 3B6FB 4QLCA 4KGCB 5BNXA 5AV6D 1M1AA 2ZY2A 5AVCD 1AOID 3AZFA 5DNMA 3AYWD 4ZBJC 4WZSB 3WKJA 1TZYC 2F8NB 3WTPE 3UTAA 3X1TB 2HIOB 2AROB 3MVDC 4H9QB 5CPKB 5B24B 5CPJC 2BYKB 3AV1A 4ZUXB 3AZHA 3W97C 3IP4C 1P3MB 5B1MC 3X1SA 1KX3C 5B33B 3WTPD 5GSUC 3VH5T 3LZ0B 2G5HC 1T3UA 3UT9C 3MGSA 2HUEC 5B0ZA 3MNNA 3LZ1B 4G92B 2NZDB 2ZY5A 4KHAA 3AZED 1P3ID 3O62A 5GXQC 3LELC 4UUZB 3AZIB 5B31B 5BNVA 2Y2HA 4XZQB 3NQJA 1KX5A 5GT3D 2NQBA 5BT1C 1F66B 5AY8D 4J8XC 1U35B 1WWSA 4H9OA 3AZJA 3W98B 4J8VD 5AV5B 5CP6B 1A7WA 3AZFD 3KUYD 1PZRA 3REHB 3WKJD 1S32A 3REIC 3MGPA 5KDMA 4YM6B 3AZEC 4WU8A 3KXBB 3REJA 4CSRB 1HTAA 3AZMD 3AZKC 3AV1D 3MGRD 2L5AA 2FJ7C 3AN2B 1M18B 5AV8C 3W96C 3C1CC 5G49A 1P3AB 5AY8C 5B2JB 3AV2B 3R45A 5B0ZD 3MNND 3MVDA 3WAAB 5E5AA 4J8VC 3O62D 5FUGB 5CPJA 4J8UC 3WA9B 3AZGC 3KUYC 3B0CW 3W97A 1HQ3C 4J8WC 5B1MA 1KX3A 3A1KA 4JJNB 4WU9B 1KX5D 1P3BC 4LD9B 2BYMA 5GSUA 3B0DC 2NQBD 3UT9A 3AZMC 4H9PB 3MGRC 3NQUA 2Y2KA 1KX4B 1BH8B 5GXQA 4E44A 3LELA 3AFAD 3VH5A 3X1UA 1S32D 3AL0C 3B6FC 5CPID 3WTPB 3A6NB 4WU8D 3REJD 1BFMA 1P3GD 4J8XA 3LJAA 1P3LD 1KU5A 5GT0B 1P3OB 2PYOB 3X1TC 3FDDA 4H9RB 3REKD 4WNNB 3W99B 3TU4B 3REIA 5CPKC 2CV5B 5B24C 2F8NK 3AZEA 4ZUXC 5E5AD 4H9SC 1P3MC 1P3FB 2Y2QA 3AFAC 5B32C 3AZKA 5B33C 4QLCB 4AWLC 2FJ7A 5B1LD 3W97D 1ID3B 1KX3D 1EQZC 5BNXB 5CPIC 5GSUD 3W96A 5AV8A 3C1CA 1M1AB 3LZ1C 5DNMB 2NZDC 3UT9D 1P3GC 1H3OB 5AY8A 5JRGD 1P3LC 3UTAB 5B31C 4J8VA 5GXQD 3LELD 1M19B 4HGAB 2G5IC 5B40B 4J8UA 3AZGA 3KUYA 3X1UD 4KUDB 1HQ3A 4J8WA 4H9NA 3EPLA 3REKC 4EO5B 1P3PD 3AZHB 2JCHA 1P3BA 3MGQD 1F66C 3KFUG 3X1SB 2IO5B 5AV9B 5E5AC 5BT1D 3C1BB 3AZMA 3AZNC 4J8XD 3KWQB 3MGRA 3LJAD 5CP6C 4XUJB 5B1LC 5B0YB 3MGSB 1JFIB 2FFFB 3V9RA 2ZY3A 4YM6C 3KXBC 4R8PB 5JRGC 3REID 3X1VB 4Z66D 3B6FA 3EG5B 4UPKA 3AN2C 3AZKD 4WJ3C 1P34B 3X1UC 3UTBB 2FJ7D 4H9OB 3P5JB 3AZJB 1P3PC 2Y2PA 3MGQC 3B6GC 1P3AC 5B2JC 2F8NA 3X1TA 5AV8D 3C1CD 2HIOA 1ZLAB 3W96D 2Y2MA 4H9QA 5CPKA 3LJAC 5B24A 2BYKA 4ZUXA 3MGPB 5KDMB 4H9SA 1P3MA 3AFAA 5B32A 1B67A 4JJNC 4WU9C 5B33A 4J8UD 4LD9C 4DRBA 3AZGD 2LY8A 1N1JA 1HQ3D 4J8WD 1WWIA 1EQZA 4Z66C 1P3BD 4NFTA 5CPIA 2JE5A 4YS3D 2Y2GA 3LZ1A 2NZDA 1P3GA 4ZBJB 1KX4C 3EPHA 1P3KB 5AVBD 2YFWB 1TZYB 1P3LA 4UUZA 5DNNB 5B31A 3R45B 2ZY4A 5F99B 3MVDB 3EPJA 4Z5TB 4X23B 3AZLB 2F2AC 5CPJB 3REKA 1F66A 5B1MB 3B6FD 1KX3B 5B2IB 3AZNA 5GT0C 3RELB 1P3OC 3VH5W 5CP6A 5B1LA 2DF4C 4CAYA 5AV6B 4NE5A 3W99C 3TU4C 2F8ND 5GXQB 5AVCB 3X1TD 2HIOD 4YS3C 1AOIB 3AYWB 2AROD 4YM6A 5CHLB 3KXBA 2RVQC 4CSRA 5JRGA 5AVBC 5CPKD 1P3FC 5B24D 4ZUXD 3A1IA 1P3MD 1ID3C 3AN2A 5B32D 5B33D 4G91B 4J8XB 1P3PA 3LZ0D 3B6GA 3MGQA 1EQZD 1P3AA 2VQRA 5B2JA 5BO0A 3AV2A 4KGCC 3LZ1D 2NZDD 2XD1A 5BS7C 3B0BA 4HGAC 5FUGA 2YFVB 5B40C 3AZID 5B31D 4KUDC 1ULYA 1R4VA 4XZQD 3AZEB 1P3IB 5JA4A 4JJNA 4WU9A 2HIOC 5C3IB 4LD9A 2AROC 3AZKB 2IO5C 5AV9C 2FJ7B 4Z66A 1F66D 3C1BC 2BG1A 1U35D 3KWQC 2Y2OA 5GT3B 3W98D 4XUJC 5AV8B 3W96B 1BH9B 5B0YC 3AZND 2XD5A 1KX4A 1BH8A 5AV5D 5AY8B 5CP6D 4WV4B 3LZ0C 4DQYB 3REHD 4J8VB 4Z2MG 4R8PC 3X1VC 3AZFB 4G92C 4YM6D 1TAFA 3KXBD 3KUYB 4Z2MH 4H9NB 3WKJB 3AZIC 1P34C 4XZQC 3UTBC 5GT0A 3AN2D 1P3OA 2Y2NA 2PYOA 3AZMB 3AV1B 1Z2CB 1M18D 1ZLAC 3MGRB 4H9RA 3H0MC 3B6GD 4WNNA 1P3AD 5B2JD 3TU4A 1U35C 4YS3A 3AV2D 3W99A 3W98C 4DRAA 3WAAD 5AV5C 5AVBA 1P3FA 3WA9D 5B0ZB 3MNNB 4NE3A 4KHAB 3REHC 1ID3A 3O62B 4JJND 4WU9D 4LD9D 5BNVB 1H3OA 3NQJB 1KX5B 3KSYA 1P3KC 4KGCA 2NQBB 5DNNC 1KX4D 5BS7A 5F99C 1M19A 4Z5TC 4X23C 1M18C 5B40A 3AZLC 4KUDA 3H0LC 1B6WA 3AV2C 2AROA 3AFAB 5B32B 3WAAC 5B2IC 3A6ND 5AV9A 4AWLB 1N1JB 3C1BA 1S32B 3B0CT 3RELC 2RIQA 3KWQA 3VH6T 1EQZB 3WA9C 5CPIB 4XUJA 4WU8B 5B0YA 3REJB 5GT0D 1P3OD 1JFIA 2PYOD 5AV6C 1P3GB 2F8NG 5AVCC 1P3LB 1AOIC 3LZ0A 3AYWC 4E45A 3W99D 4R8PA 3TU4D 3X1VA 2F8NH 4M6BA 2CV5D 2Y2LA 2CWEA 2RVQD 5G49B 3REKB 1P3FD 5B32G 3AZIA 1W2EA 1P34A 4G91C 4XZQA 4QLCD 3UTBA 1ID3D 5E5AB 3AZNB 1ZLAA 3WTPC 3A6NC 1M1AD 3W97B 5B1LB 5DNMD 1U35A 4CAYB 2BYMB 5GSUB 3W98A 4KGCD 3UTAD 5B31G 2PYOC 2JSSA 5AV5A 3UT9B 1M19D 1P3IC 5JRGB 5B40D 3NQUB 5C3IC 2HUEB 4KUDD 3REHA 1Q9CA 3LELB 3AZHD 2CV5C 3X1SD 5GT3C 5AV9D 3X1UB 2Y2JA 1P3PB 3C1BD 3B6GB 3KWQD 3MGQB 1P3KA 2YFWA 1TZYA 4QLCC 5BO0B 4XUJD 5DNNA 5B0YD 3MGSD 1F1EA 5F99A 2Y2IA 2J8PA 4Z5TA 4X23A 1M18A 3AZLA 3LJAB 1M1AC 3AZFC 5DNMC 4R8PD 3X1VD 3VH6W 3WKJC 5JA4B 3UTAC 3WAAA 5B2IA 1M19C 3REIB 3RELA 3WA9A 4Z66B 1P34D 3AV1C 2W8SA 3UTBD 4EO5C 3AZJD 3AZHC 5AV6A 3X1SC 5AVCA 1ZLAD 1AOIA 3AYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P A;  3VH6 A;  3C1C B;  3MGS C;  3MGP D;  5B0Z C;  3MNN C;  1TAF B;  3O62 C;  4NE6 A;  4J8U B;  1KX5 C;  3WTP A;  3A6N A;  3AZG B;  2NQB C;  1HQ3 B;  4J8W B;  1P3B B;  1P3K D;  3B0D B;  1TZY D;  2YFV A;  5DNN D;  4YS3 B;  3AZJ C;  3MVD D;  5F99 D;  4Z5T D;  4X23 D;  1P3I A;  5AVB B;  3AZL D;  5CPJ D;  2CV5 A;  5B1M D;  1S32 C;  3V9R B;  5B2I D;  5GT3 A;  3MGP C;  1BH9 A;  4WU8 C;  3REJ C;  3REL D;  3B6F B;  4QLC A;  4KGC B;  5BNX A;  5AV6 D;  1M1A A;  5AVC D;  1AOI D;  3AZF A;  5DNM A;  3AYW D;  4ZBJ C;  4WZS B;  3WKJ A;  1TZY C;  2F8N B;  3WTP E;  3UTA A;  3X1T B;  2HIO B;  2ARO B;  3MVD C;  4H9Q B;  5CPK B;  5B24 B;  5CPJ C;  2BYK B;  3AV1 A;  4ZUX B;  3AZH A;  3W97 C;  1P3M B;  5B1M C;  3X1S A;  1KX3 C;  5B33 B;  3WTP D;  5GSU C;  3VH5 T;  3LZ0 B;  3UT9 C;  3MGS A;  2HUE C;  5B0Z A;  3MNN A;  3LZ1 B;  4G92 B;  2NZD B;  4KHA A;  3AZE D;  1P3I D;  3O62 A;  5GXQ C;  3LEL C;  4UUZ B;  3AZI B;  5B31 B;  5BNV A;  4XZQ B;  3NQJ A;  1KX5 A;  5GT3 D;  2NQB A;  5BT1 C;  1F66 B;  5AY8 D;  4J8X C;  1U35 B;  1WWS A;  4H9O A;  3AZJ A;  3W98 B;  4J8V D;  5AV5 B;  5CP6 B;  1A7W A;  3AZF D;  3KUY D;  3REH B;  3WKJ D;  1S32 A;  3REI C;  3MGP A;  5KDM A;  4YM6 B;  3AZE C;  4WU8 A;  3KXB B;  3REJ A;  4CSR B;  1HTA A;  3AZM D;  3AZK C;  3AV1 D;  3MGR D;  2L5A A;  2FJ7 C;  3AN2 B;  1M18 B;  5AV8 C;  3W96 C;  3C1C C;  5G49 A;  1P3A B;  5AY8 C;  5B2J B;  3AV2 B;  3R45 A;  5B0Z D;  3MNN D;  3MVD A;  3WAA B;  5E5A A;  4J8V C;  3O62 D;  5FUG B;  5CPJ A;  4J8U C;  3WA9 B;  3AZG C;  3KUY C;  3B0C W;  3W97 A;  1HQ3 C;  4J8W C;  5B1M A;  1KX3 A;  4JJN B;  4WU9 B;  1KX5 D;  1P3B C;  4LD9 B;  2BYM A;  5GSU A;  3B0D C;  2NQB D;  3UT9 A;  3AZM C;  4H9P B;  3MGR C;  3NQU A;  1KX4 B;  1BH8 B;  5GXQ A;  4E44 A;  3LEL A;  3AFA D;  3VH5 A;  3X1U A;  1S32 D;  3B6F C;  5CPI D;  3WTP B;  3A6N B;  4WU8 D;  3REJ D;  1BFM A;  1P3G D;  4J8X A;  3LJA A;  1P3L D;  1KU5 A;  5GT0 B;  1P3O B;  2PYO B;  3X1T C;  4H9R B;  3REK D;  4WNN B;  3W99 B;  3TU4 B;  3REI A;  5CPK C;  2CV5 B;  5B24 C;  2F8N K;  3AZE A;  4ZUX C;  5E5A D;  4H9S C;  1P3M C;  1P3F B;  3AFA C;  5B32 C;  3AZK A;  5B33 C;  4QLC B;  4AWL C;  2FJ7 A;  5B1L D;  3W97 D;  1ID3 B;  1KX3 D;  1EQZ C;  5BNX B;  5CPI C;  5GSU D;  3W96 A;  5AV8 A;  3C1C A;  1M1A B;  3LZ1 C;  5DNM B;  2NZD C;  3UT9 D;  1P3G C;  1H3O B;  5AY8 A;  5JRG D;  1P3L C;  3UTA B;  5B31 C;  4J8V A;  5GXQ D;  3LEL D;  1M19 B;  4HGA B;  5B40 B;  4J8U A;  3AZG A;  3KUY A;  3X1U D;  4KUD B;  1HQ3 A;  4J8W A;  4H9N A;  3REK C;  4EO5 B;  1P3P D;  3AZH B;  1P3B A;  3MGQ D;  1F66 C;  3X1S B;  2IO5 B;  5AV9 B;  5E5A C;  5BT1 D;  3C1B B;  3AZM A;  3AZN C;  4J8X D;  3KWQ B;  3MGR A;  3LJA D;  5CP6 C;  4XUJ B;  5B1L C;  5B0Y B;  3MGS B;  1JFI B;  3V9R A;  4YM6 C;  3KXB C;  4R8P B;  5JRG C;  3REI D;  3X1V B;  4Z66 D;  3B6F A;  3AN2 C;  3AZK D;  1P34 B;  3X1U C;  3UTB B;  2FJ7 D;  4H9O B;  3AZJ B;  1P3P C;  3B6G C;  3MGQ C;  1P3A C;  5B2J C;  2F8N A;  3X1T A;  5AV8 D;  3C1C D;  2HIO A;  1ZLA B;  3W96 D;  4H9Q A;  5CPK A;  3LJA C;  5B24 A;  2BYK A;  4ZUX A;  3MGP B;  5KDM B;  4H9S A;  1P3M A;  3AFA A;  5B32 A;  1B67 A;  4JJN C;  4WU9 C;  5B33 A;  4J8U D;  4LD9 C;  4DRB A;  3AZG D;  2LY8 A;  1N1J A;  1HQ3 D;  4J8W D;  1WWI A;  1EQZ A;  4Z66 C;  1P3B D;  4NFT A;  5CPI A;  4YS3 D;  3LZ1 A;  2NZD A;  1P3G A;  4ZBJ B;  1KX4 C;  1P3K B;  5AVB D;  2YFW B;  1TZY B;  1P3L A;  4UUZ A;  5DNN B;  5B31 A;  3R45 B;  3MVD B;  5F99 B;  4Z5T B;  4X23 B;  3AZL B;  5CPJ B;  3REK A;  1F66 A;  5B1M B;  3B6F D;  1KX3 B;  5B2I B;  3AZN A;  5GT0 C;  3REL B;  1P3O C;  3VH5 W;  5CP6 A;  5B1L A;  4CAY A;  5AV6 B;  4NE5 A;  3W99 C;  3TU4 C;  2F8N D;  5GXQ B;  5AVC B;  3X1T D;  2HIO D;  4YS3 C;  1AOI B;  3AYW B;  2ARO D;  4YM6 A;  5CHL B;  3KXB A;  2RVQ C;  4CSR A;  5JRG A;  5AVB C;  5CPK D;  1P3F C;  5B24 D;  4ZUX D;  1P3M D;  1ID3 C;  3AN2 A;  5B32 D;  5B33 D;  4G91 B;  4J8X B;  1P3P A;  3LZ0 D;  3B6G A;  3MGQ A;  1EQZ D;  1P3A A;  5B2J A;  5BO0 A;  3AV2 A;  4KGC C;  3LZ1 D;  2NZD D;  5BS7 C;  3B0B A;  4HGA C;  5FUG A;  2YFV B;  5B40 C;  3AZI D;  5B31 D;  4KUD C;  1ULY A;  1R4V A;  4XZQ D;  3AZE B;  1P3I B;  5JA4 A;  4JJN A;  4WU9 A;  2HIO C;  5C3I B;  4LD9 A;  2ARO C;  3AZK B;  2IO5 C;  5AV9 C;  2FJ7 B;  4Z66 A;  1F66 D;  3C1B C;  1U35 D;  3KWQ C;  5GT3 B;  3W98 D;  4XUJ C;  5AV8 B;  3W96 B;  1BH9 B;  5B0Y C;  3AZN D;  1KX4 A;  1BH8 A;  5AV5 D;  5AY8 B;  5CP6 D;  4WV4 B;  3LZ0 C;  3REH D;  4J8V B;  4Z2M G;  4R8P C;  3X1V C;  3AZF B;  4G92 C;  4YM6 D;  1TAF A;  3KXB D;  3KUY B;  4Z2M H;  4H9N B;  3WKJ B;  3AZI C;  1P34 C;  4XZQ C;  3UTB C;  5GT0 A;  3AN2 D;  1P3O A;  2PYO A;  3AZM B;  3AV1 B;  1M18 D;  1ZLA C;  3MGR B;  4H9R A;  3B6G D;  4WNN A;  1P3A D;  5B2J D;  3TU4 A;  1U35 C;  4YS3 A;  3AV2 D;  3W99 A;  3W98 C;  4DRA A;  3WAA D;  5AV5 C;  5AVB A;  1P3F A;  3WA9 D;  5B0Z B;  3MNN B;  4NE3 A;  4KHA B;  3REH C;  1ID3 A;  3O62 B;  4JJN D;  4WU9 D;  4LD9 D;  5BNV B;  1H3O A;  3NQJ B;  1KX5 B;  3KSY A;  1P3K C;  4KGC A;  2NQB B;  5DNN C;  1KX4 D;  5BS7 A;  5F99 C;  1M19 A;  4Z5T C;  4X23 C;  1M18 C;  5B40 A;  3AZL C;  4KUD A;  1B6W A;  3AV2 C;  2ARO A;  3AFA B;  5B32 B;  3WAA C;  5B2I C;  3A6N D;  5AV9 A;  4AWL B;  1N1J B;  3C1B A;  1S32 B;  3B0C T;  3REL C;  3KWQ A;  1EQZ B;  3VH6 T;  3WA9 C;  5CPI B;  4XUJ A;  4WU8 B;  5B0Y A;  3REJ B;  5GT0 D;  1P3O D;  1JFI A;  2PYO D;  5AV6 C;  1P3G B;  2F8N G;  5AVC C;  1P3L B;  1AOI C;  3LZ0 A;  3AYW C;  4E45 A;  3W99 D;  4R8P A;  3TU4 D;  3X1V A;  2F8N H;  4M6B A;  2CV5 D;  2CWE A;  2RVQ D;  5G49 B;  3REK B;  1P3F D;  5B32 G;  3AZI A;  1P34 A;  4G91 C;  4XZQ A;  4QLC D;  3UTB A;  1ID3 D;  5E5A B;  3AZN B;  1ZLA A;  3WTP C;  3A6N C;  1M1A D;  3W97 B;  5B1L B;  5DNM D;  1U35 A;  4CAY B;  2BYM B;  5GSU B;  3W98 A;  4KGC D;  3UTA D;  5B31 G;  2PYO C;  2JSS A;  5AV5 A;  3UT9 B;  1M19 D;  1P3I C;  5JRG B;  5B40 D;  3NQU B;  5C3I C;  2HUE B;  4KUD D;  3REH A;  1Q9C A;  3LEL B;  3AZH D;  2CV5 C;  3X1S D;  5GT3 C;  5AV9 D;  3X1U B;  1P3P B;  3C1B D;  3B6G B;  3KWQ D;  3MGQ B;  1P3K A;  2YFW A;  1TZY A;  4QLC C;  5BO0 B;  4XUJ D;  5DNN A;  5B0Y D;  3MGS D;  1F1E A;  5F99 A;  4Z5T A;  4X23 A;  1M18 A;  3AZL A;  3LJA B;  1M1A C;  3AZF C;  5DNM C;  4R8P D;  3X1V D;  3VH6 W;  3WKJ C;  5JA4 B;  3UTA C;  3WAA A;  5B2I A;  1M19 C;  3REI B;  3REL A;  3WA9 A;  4Z66 B;  1P34 D;  3AV1 C;  3UTB D;  4EO5 C;  3AZJ D;  3AZH C;  5AV6 A;  3X1S C;  5AVC A;  1ZLA D;  1AOI A;  3AYW A; 
#chains in the Genus database with same CATH topology
 4H9P A;  3VH6 A;  3C1C B;  3MGS C;  3MGP D;  5B0Z C;  3MNN C;  1TAF B;  3O62 C;  4NE6 A;  3F6T A;  2ZM5 A;  4J8U B;  1KX5 C;  3WTP A;  3A6N A;  3AZG B;  2NQB C;  1HQ3 B;  2UWX A;  4J8W B;  3EPK A;  1P3B B;  1P3K D;  3B0D B;  1TZY D;  2YFV A;  5DNN D;  4YS3 B;  3AZJ C;  3H0R C;  3MVD D;  5F99 D;  4Z5T D;  4X23 D;  2DQN C;  1P3I A;  5AVB B;  3AZL D;  5CPJ D;  2CV5 A;  5B1M D;  1S32 C;  3V9R B;  5B2I D;  5GT3 A;  3MGP C;  1BH9 A;  4WU8 C;  3REJ C;  3REL D;  3B6F B;  4QLC A;  4KGC B;  5BNX A;  5AV6 D;  1M1A A;  2ZY2 A;  5AVC D;  1AOI D;  3AZF A;  5DNM A;  3AYW D;  4ZBJ C;  4WZS B;  3WKJ A;  1TZY C;  2F8N B;  3WTP E;  3UTA A;  3X1T B;  2HIO B;  2ARO B;  3MVD C;  4H9Q B;  5CPK B;  5B24 B;  5CPJ C;  2BYK B;  3AV1 A;  4ZUX B;  3AZH A;  3W97 C;  3IP4 C;  1P3M B;  5B1M C;  3X1S A;  1KX3 C;  5B33 B;  3WTP D;  5GSU C;  3VH5 T;  3LZ0 B;  2G5H C;  1T3U A;  3UT9 C;  3MGS A;  2HUE C;  5B0Z A;  3MNN A;  3LZ1 B;  4G92 B;  2NZD B;  2ZY5 A;  4KHA A;  3AZE D;  1P3I D;  3O62 A;  5GXQ C;  3LEL C;  4UUZ B;  3AZI B;  5B31 B;  5BNV A;  2Y2H A;  4XZQ B;  3NQJ A;  1KX5 A;  5GT3 D;  2NQB A;  5BT1 C;  1F66 B;  5AY8 D;  4J8X C;  1U35 B;  1WWS A;  4H9O A;  3AZJ A;  3W98 B;  4J8V D;  5AV5 B;  5CP6 B;  1A7W A;  3AZF D;  3KUY D;  1PZR A;  3REH B;  3WKJ D;  1S32 A;  3REI C;  3MGP A;  5KDM A;  4YM6 B;  3AZE C;  4WU8 A;  3KXB B;  3REJ A;  4CSR B;  1HTA A;  3AZM D;  3AZK C;  3AV1 D;  3MGR D;  2L5A A;  2FJ7 C;  3AN2 B;  1M18 B;  5AV8 C;  3W96 C;  3C1C C;  5G49 A;  1P3A B;  5AY8 C;  5B2J B;  3AV2 B;  3R45 A;  5B0Z D;  3MNN D;  3MVD A;  3WAA B;  5E5A A;  4J8V C;  3O62 D;  5FUG B;  5CPJ A;  4J8U C;  3WA9 B;  3AZG C;  3KUY C;  3B0C W;  3W97 A;  1HQ3 C;  4J8W C;  5B1M A;  1KX3 A;  3A1K A;  4JJN B;  4WU9 B;  1KX5 D;  1P3B C;  4LD9 B;  2BYM A;  5GSU A;  3B0D C;  2NQB D;  3UT9 A;  3AZM C;  4H9P B;  3MGR C;  3NQU A;  2Y2K A;  1KX4 B;  1BH8 B;  5GXQ A;  4E44 A;  3LEL A;  3AFA D;  3VH5 A;  3X1U A;  1S32 D;  3AL0 C;  3B6F C;  5CPI D;  3WTP B;  3A6N B;  4WU8 D;  3REJ D;  1BFM A;  1P3G D;  4J8X A;  3LJA A;  1P3L D;  1KU5 A;  5GT0 B;  1P3O B;  2PYO B;  3X1T C;  3FDD A;  4H9R B;  3REK D;  4WNN B;  3W99 B;  3TU4 B;  3REI A;  5CPK C;  2CV5 B;  5B24 C;  2F8N K;  3AZE A;  4ZUX C;  5E5A D;  4H9S C;  1P3M C;  1P3F B;  2Y2Q A;  3AFA C;  5B32 C;  3AZK A;  5B33 C;  4QLC B;  4AWL C;  2FJ7 A;  5B1L D;  3W97 D;  1ID3 B;  1KX3 D;  1EQZ C;  5BNX B;  5CPI C;  5GSU D;  3W96 A;  5AV8 A;  3C1C A;  1M1A B;  3LZ1 C;  5DNM B;  2NZD C;  3UT9 D;  1P3G C;  1H3O B;  5AY8 A;  5JRG D;  1P3L C;  3UTA B;  5B31 C;  4J8V A;  5GXQ D;  3LEL D;  1M19 B;  4HGA B;  2G5I C;  5B40 B;  4J8U A;  3AZG A;  3KUY A;  3X1U D;  4KUD B;  1HQ3 A;  4J8W A;  4H9N A;  3EPL A;  3REK C;  4EO5 B;  1P3P D;  3AZH B;  2JCH A;  1P3B A;  3MGQ D;  1F66 C;  3KFU G;  3X1S B;  2IO5 B;  5AV9 B;  5E5A C;  5BT1 D;  3C1B B;  3AZM A;  3AZN C;  4J8X D;  3KWQ B;  3MGR A;  3LJA D;  5CP6 C;  4XUJ B;  5B1L C;  5B0Y B;  3MGS B;  1JFI B;  2FFF B;  3V9R A;  2ZY3 A;  4YM6 C;  3KXB C;  4R8P B;  5JRG C;  3REI D;  3X1V B;  4Z66 D;  3B6F A;  3EG5 B;  4UPK A;  3AN2 C;  3AZK D;  4WJ3 C;  1P34 B;  3X1U C;  3UTB B;  2FJ7 D;  4H9O B;  3P5J B;  3AZJ B;  1P3P C;  2Y2P A;  3MGQ C;  3B6G C;  1P3A C;  5B2J C;  2F8N A;  3X1T A;  5AV8 D;  3C1C D;  2HIO A;  1ZLA B;  3W96 D;  2Y2M A;  4H9Q A;  5CPK A;  3LJA C;  5B24 A;  2BYK A;  4ZUX A;  3MGP B;  5KDM B;  4H9S A;  1P3M A;  3AFA A;  5B32 A;  1B67 A;  4JJN C;  4WU9 C;  5B33 A;  4J8U D;  4LD9 C;  4DRB A;  3AZG D;  2LY8 A;  1N1J A;  1HQ3 D;  4J8W D;  1WWI A;  1EQZ A;  4Z66 C;  1P3B D;  4NFT A;  5CPI A;  2JE5 A;  4YS3 D;  2Y2G A;  3LZ1 A;  2NZD A;  1P3G A;  4ZBJ B;  1KX4 C;  3EPH A;  1P3K B;  5AVB D;  2YFW B;  1TZY B;  1P3L A;  4UUZ A;  5DNN B;  5B31 A;  3R45 B;  2ZY4 A;  5F99 B;  3MVD B;  3EPJ A;  4Z5T B;  4X23 B;  3AZL B;  2F2A C;  5CPJ B;  3REK A;  1F66 A;  5B1M B;  3B6F D;  1KX3 B;  5B2I B;  3AZN A;  5GT0 C;  3REL B;  1P3O C;  3VH5 W;  5CP6 A;  5B1L A;  2DF4 C;  4CAY A;  5AV6 B;  4NE5 A;  3W99 C;  3TU4 C;  2F8N D;  5GXQ B;  5AVC B;  3X1T D;  2HIO D;  4YS3 C;  1AOI B;  3AYW B;  2ARO D;  4YM6 A;  5CHL B;  3KXB A;  2RVQ C;  4CSR A;  5JRG A;  5AVB C;  5CPK D;  1P3F C;  5B24 D;  4ZUX D;  3A1I A;  1P3M D;  1ID3 C;  3AN2 A;  5B32 D;  5B33 D;  4G91 B;  4J8X B;  1P3P A;  3LZ0 D;  3B6G A;  3MGQ A;  1EQZ D;  1P3A A;  2VQR A;  5B2J A;  5BO0 A;  3AV2 A;  4KGC C;  3LZ1 D;  2NZD D;  2XD1 A;  5BS7 C;  3B0B A;  4HGA C;  5FUG A;  2YFV B;  5B40 C;  3AZI D;  5B31 D;  4KUD C;  1ULY A;  1R4V A;  4XZQ D;  3AZE B;  1P3I B;  5JA4 A;  4JJN A;  4WU9 A;  2HIO C;  5C3I B;  4LD9 A;  2ARO C;  3AZK B;  2IO5 C;  5AV9 C;  2FJ7 B;  4Z66 A;  1F66 D;  3C1B C;  2BG1 A;  1U35 D;  3KWQ C;  2Y2O A;  5GT3 B;  3W98 D;  4XUJ C;  5AV8 B;  3W96 B;  1BH9 B;  5B0Y C;  3AZN D;  2XD5 A;  1KX4 A;  1BH8 A;  5AV5 D;  5AY8 B;  5CP6 D;  4WV4 B;  3LZ0 C;  4DQY B;  3REH D;  4J8V B;  4Z2M G;  4R8P C;  3X1V C;  3AZF B;  4G92 C;  4YM6 D;  1TAF A;  3KXB D;  3KUY B;  4Z2M H;  4H9N B;  3WKJ B;  3AZI C;  1P34 C;  4XZQ C;  3UTB C;  5GT0 A;  3AN2 D;  1P3O A;  2Y2N A;  2PYO A;  3AZM B;  3AV1 B;  1Z2C B;  1M18 D;  1ZLA C;  3MGR B;  4H9R A;  3H0M C;  3B6G D;  4WNN A;  1P3A D;  5B2J D;  3TU4 A;  1U35 C;  4YS3 A;  3AV2 D;  3W99 A;  3W98 C;  4DRA A;  3WAA D;  5AV5 C;  5AVB A;  1P3F A;  3WA9 D;  5B0Z B;  3MNN B;  4NE3 A;  4KHA B;  3REH C;  1ID3 A;  3O62 B;  4JJN D;  4WU9 D;  4LD9 D;  5BNV B;  1H3O A;  3NQJ B;  1KX5 B;  3KSY A;  1P3K C;  4KGC A;  2NQB B;  5DNN C;  1KX4 D;  5BS7 A;  5F99 C;  1M19 A;  4Z5T C;  4X23 C;  1M18 C;  5B40 A;  3AZL C;  4KUD A;  3H0L C;  1B6W A;  3AV2 C;  2ARO A;  3AFA B;  5B32 B;  3WAA C;  5B2I C;  3A6N D;  5AV9 A;  4AWL B;  1N1J B;  3C1B A;  1S32 B;  3B0C T;  3REL C;  2RIQ A;  3KWQ A;  3VH6 T;  1EQZ B;  3WA9 C;  5CPI B;  4XUJ A;  4WU8 B;  5B0Y A;  3REJ B;  5GT0 D;  1P3O D;  1JFI A;  2PYO D;  5AV6 C;  1P3G B;  2F8N G;  5AVC C;  1P3L B;  1AOI C;  3LZ0 A;  3AYW C;  4E45 A;  3W99 D;  4R8P A;  3TU4 D;  3X1V A;  2F8N H;  4M6B A;  2CV5 D;  2Y2L A;  2CWE A;  2RVQ D;  5G49 B;  3REK B;  1P3F D;  5B32 G;  3AZI A;  1W2E A;  1P34 A;  4G91 C;  4XZQ A;  4QLC D;  3UTB A;  1ID3 D;  5E5A B;  3AZN B;  1ZLA A;  3WTP C;  3A6N C;  1M1A D;  3W97 B;  5B1L B;  5DNM D;  1U35 A;  4CAY B;  2BYM B;  5GSU B;  3W98 A;  4KGC D;  3UTA D;  5B31 G;  2PYO C;  2JSS A;  5AV5 A;  3UT9 B;  1M19 D;  1P3I C;  5JRG B;  5B40 D;  3NQU B;  5C3I C;  2HUE B;  4KUD D;  3REH A;  1Q9C A;  3LEL B;  3AZH D;  2CV5 C;  3X1S D;  5GT3 C;  5AV9 D;  3X1U B;  2Y2J A;  1P3P B;  3C1B D;  3B6G B;  3KWQ D;  3MGQ B;  1P3K A;  2YFW A;  1TZY A;  4QLC C;  5BO0 B;  4XUJ D;  5DNN A;  5B0Y D;  3MGS D;  1F1E A;  5F99 A;  2Y2I A;  2J8P A;  4Z5T A;  4X23 A;  1M18 A;  3AZL A;  3LJA B;  1M1A C;  3AZF C;  5DNM C;  4R8P D;  3X1V D;  3VH6 W;  3WKJ C;  5JA4 B;  3UTA C;  3WAA A;  5B2I A;  1M19 C;  3REI B;  3REL A;  3WA9 A;  4Z66 B;  1P34 D;  3AV1 C;  2W8S A;  3UTB D;  4EO5 C;  3AZJ D;  3AZH C;  5AV6 A;  3X1S C;  5AVC A;  1ZLA D;  1AOI A;  3AYW A; 
#chains in the Genus database with same CATH homology
 4H9P A;  3VH6 A;  3C1C B;  3MGS C;  3MGP D;  5B0Z C;  3MNN C;  1TAF B;  3O62 C;  4NE6 A;  3F6T A;  2ZM5 A;  4J8U B;  1KX5 C;  3WTP A;  3A6N A;  3AZG B;  2NQB C;  1HQ3 B;  2UWX A;  4J8W B;  3EPK A;  1P3B B;  1P3K D;  3B0D B;  1TZY D;  2YFV A;  5DNN D;  4YS3 B;  3AZJ C;  3H0R C;  3MVD D;  5F99 D;  4Z5T D;  4X23 D;  2DQN C;  1P3I A;  5AVB B;  3AZL D;  5CPJ D;  2CV5 A;  5B1M D;  1S32 C;  3V9R B;  5B2I D;  5GT3 A;  3MGP C;  1BH9 A;  4WU8 C;  3REJ C;  3REL D;  3B6F B;  4QLC A;  4KGC B;  5BNX A;  5AV6 D;  1M1A A;  2ZY2 A;  5AVC D;  1AOI D;  3AZF A;  5DNM A;  3AYW D;  4ZBJ C;  4WZS B;  3WKJ A;  1TZY C;  2F8N B;  3WTP E;  3UTA A;  3X1T B;  2HIO B;  2ARO B;  3MVD C;  4H9Q B;  5CPK B;  5B24 B;  5CPJ C;  2BYK B;  3AV1 A;  4ZUX B;  3AZH A;  3W97 C;  3IP4 C;  1P3M B;  5B1M C;  3X1S A;  1KX3 C;  5B33 B;  3WTP D;  5GSU C;  3VH5 T;  3LZ0 B;  2G5H C;  1T3U A;  3UT9 C;  3MGS A;  2HUE C;  5B0Z A;  3MNN A;  3LZ1 B;  4G92 B;  2NZD B;  2ZY5 A;  4KHA A;  3AZE D;  1P3I D;  3O62 A;  5GXQ C;  3LEL C;  4UUZ B;  3AZI B;  5B31 B;  5BNV A;  2Y2H A;  4XZQ B;  3NQJ A;  1KX5 A;  5GT3 D;  2NQB A;  5BT1 C;  1F66 B;  5AY8 D;  4J8X C;  1U35 B;  1WWS A;  4H9O A;  3AZJ A;  3W98 B;  4J8V D;  5AV5 B;  5CP6 B;  1A7W A;  3AZF D;  3KUY D;  1PZR A;  3REH B;  3WKJ D;  1S32 A;  3REI C;  3MGP A;  5KDM A;  4YM6 B;  3AZE C;  4WU8 A;  3KXB B;  3REJ A;  4CSR B;  1HTA A;  3AZM D;  3AZK C;  3AV1 D;  3MGR D;  2L5A A;  2FJ7 C;  3AN2 B;  1M18 B;  5AV8 C;  3W96 C;  3C1C C;  5G49 A;  1P3A B;  5AY8 C;  5B2J B;  3AV2 B;  3R45 A;  5B0Z D;  3MNN D;  3MVD A;  3WAA B;  5E5A A;  4J8V C;  3O62 D;  5FUG B;  5CPJ A;  4J8U C;  3WA9 B;  3AZG C;  3KUY C;  3B0C W;  3W97 A;  1HQ3 C;  4J8W C;  5B1M A;  1KX3 A;  3A1K A;  4JJN B;  4WU9 B;  1KX5 D;  1P3B C;  4LD9 B;  2BYM A;  5GSU A;  3B0D C;  2NQB D;  3UT9 A;  3AZM C;  4H9P B;  3MGR C;  3NQU A;  2Y2K A;  1KX4 B;  1BH8 B;  5GXQ A;  4E44 A;  3LEL A;  3AFA D;  3VH5 A;  3X1U A;  1S32 D;  3AL0 C;  3B6F C;  5CPI D;  3WTP B;  3A6N B;  4WU8 D;  3REJ D;  1BFM A;  1P3G D;  4J8X A;  3LJA A;  1P3L D;  1KU5 A;  5GT0 B;  1P3O B;  2PYO B;  3X1T C;  3FDD A;  4H9R B;  3REK D;  4WNN B;  3W99 B;  3TU4 B;  3REI A;  5CPK C;  2CV5 B;  5B24 C;  2F8N K;  3AZE A;  4ZUX C;  5E5A D;  4H9S C;  1P3M C;  1P3F B;  2Y2Q A;  3AFA C;  5B32 C;  3AZK A;  5B33 C;  4QLC B;  4AWL C;  2FJ7 A;  5B1L D;  3W97 D;  1ID3 B;  1KX3 D;  1EQZ C;  5BNX B;  5CPI C;  5GSU D;  3W96 A;  5AV8 A;  3C1C A;  1M1A B;  3LZ1 C;  5DNM B;  2NZD C;  3UT9 D;  1P3G C;  1H3O B;  5AY8 A;  5JRG D;  1P3L C;  3UTA B;  5B31 C;  4J8V A;  5GXQ D;  3LEL D;  1M19 B;  4HGA B;  2G5I C;  5B40 B;  4J8U A;  3AZG A;  3KUY A;  3X1U D;  4KUD B;  1HQ3 A;  4J8W A;  4H9N A;  3EPL A;  3REK C;  4EO5 B;  1P3P D;  3AZH B;  2JCH A;  1P3B A;  3MGQ D;  1F66 C;  3KFU G;  3X1S B;  2IO5 B;  5AV9 B;  5E5A C;  5BT1 D;  3C1B B;  3AZM A;  3AZN C;  4J8X D;  3KWQ B;  3MGR A;  3LJA D;  5CP6 C;  4XUJ B;  5B1L C;  5B0Y B;  3MGS B;  1JFI B;  2FFF B;  3V9R A;  2ZY3 A;  4YM6 C;  3KXB C;  4R8P B;  5JRG C;  3REI D;  3X1V B;  4Z66 D;  3B6F A;  3EG5 B;  4UPK A;  3AN2 C;  3AZK D;  4WJ3 C;  1P34 B;  3X1U C;  3UTB B;  2FJ7 D;  4H9O B;  3P5J B;  3AZJ B;  1P3P C;  2Y2P A;  3MGQ C;  3B6G C;  1P3A C;  5B2J C;  2F8N A;  3X1T A;  5AV8 D;  3C1C D;  2HIO A;  1ZLA B;  3W96 D;  2Y2M A;  4H9Q A;  5CPK A;  3LJA C;  5B24 A;  2BYK A;  4ZUX A;  3MGP B;  5KDM B;  4H9S A;  1P3M A;  3AFA A;  5B32 A;  1B67 A;  4JJN C;  4WU9 C;  5B33 A;  4J8U D;  4LD9 C;  4DRB A;  3AZG D;  2LY8 A;  1N1J A;  1HQ3 D;  4J8W D;  1WWI A;  1EQZ A;  4Z66 C;  1P3B D;  4NFT A;  5CPI A;  2JE5 A;  4YS3 D;  2Y2G A;  3LZ1 A;  2NZD A;  1P3G A;  4ZBJ B;  1KX4 C;  3EPH A;  1P3K B;  5AVB D;  2YFW B;  1TZY B;  1P3L A;  4UUZ A;  5DNN B;  5B31 A;  3R45 B;  2ZY4 A;  5F99 B;  3MVD B;  3EPJ A;  4Z5T B;  4X23 B;  3AZL B;  2F2A C;  5CPJ B;  3REK A;  1F66 A;  5B1M B;  3B6F D;  1KX3 B;  5B2I B;  3AZN A;  5GT0 C;  3REL B;  1P3O C;  3VH5 W;  5CP6 A;  5B1L A;  2DF4 C;  4CAY A;  5AV6 B;  4NE5 A;  3W99 C;  3TU4 C;  2F8N D;  5GXQ B;  5AVC B;  3X1T D;  2HIO D;  4YS3 C;  1AOI B;  3AYW B;  2ARO D;  4YM6 A;  5CHL B;  3KXB A;  2RVQ C;  4CSR A;  5JRG A;  5AVB C;  5CPK D;  1P3F C;  5B24 D;  4ZUX D;  3A1I A;  1P3M D;  1ID3 C;  3AN2 A;  5B32 D;  5B33 D;  4G91 B;  4J8X B;  1P3P A;  3LZ0 D;  3B6G A;  3MGQ A;  1EQZ D;  1P3A A;  2VQR A;  5B2J A;  5BO0 A;  3AV2 A;  4KGC C;  3LZ1 D;  2NZD D;  2XD1 A;  5BS7 C;  3B0B A;  4HGA C;  5FUG A;  2YFV B;  5B40 C;  3AZI D;  5B31 D;  4KUD C;  1ULY A;  1R4V A;  4XZQ D;  3AZE B;  1P3I B;  5JA4 A;  4JJN A;  4WU9 A;  2HIO C;  5C3I B;  4LD9 A;  2ARO C;  3AZK B;  2IO5 C;  5AV9 C;  2FJ7 B;  4Z66 A;  1F66 D;  3C1B C;  2BG1 A;  1U35 D;  3KWQ C;  2Y2O A;  5GT3 B;  3W98 D;  4XUJ C;  5AV8 B;  3W96 B;  1BH9 B;  5B0Y C;  3AZN D;  2XD5 A;  1KX4 A;  1BH8 A;  5AV5 D;  5AY8 B;  5CP6 D;  4WV4 B;  3LZ0 C;  4DQY B;  3REH D;  4J8V B;  4Z2M G;  4R8P C;  3X1V C;  3AZF B;  4G92 C;  4YM6 D;  1TAF A;  3KXB D;  3KUY B;  4Z2M H;  4H9N B;  3WKJ B;  3AZI C;  1P34 C;  4XZQ C;  3UTB C;  5GT0 A;  3AN2 D;  1P3O A;  2Y2N A;  2PYO A;  3AZM B;  3AV1 B;  1Z2C B;  1M18 D;  1ZLA C;  3MGR B;  4H9R A;  3H0M C;  3B6G D;  4WNN A;  1P3A D;  5B2J D;  3TU4 A;  1U35 C;  4YS3 A;  3AV2 D;  3W99 A;  3W98 C;  4DRA A;  3WAA D;  5AV5 C;  5AVB A;  1P3F A;  3WA9 D;  5B0Z B;  3MNN B;  4NE3 A;  4KHA B;  3REH C;  1ID3 A;  3O62 B;  4JJN D;  4WU9 D;  4LD9 D;  5BNV B;  1H3O A;  3NQJ B;  1KX5 B;  3KSY A;  1P3K C;  4KGC A;  2NQB B;  5DNN C;  1KX4 D;  5BS7 A;  5F99 C;  1M19 A;  4Z5T C;  4X23 C;  1M18 C;  5B40 A;  3AZL C;  4KUD A;  3H0L C;  1B6W A;  3AV2 C;  2ARO A;  3AFA B;  5B32 B;  3WAA C;  5B2I C;  3A6N D;  5AV9 A;  4AWL B;  1N1J B;  3C1B A;  1S32 B;  3B0C T;  3REL C;  2RIQ A;  3KWQ A;  3VH6 T;  1EQZ B;  3WA9 C;  5CPI B;  4XUJ A;  4WU8 B;  5B0Y A;  3REJ B;  5GT0 D;  1P3O D;  1JFI A;  2PYO D;  5AV6 C;  1P3G B;  2F8N G;  5AVC C;  1P3L B;  1AOI C;  3LZ0 A;  3AYW C;  4E45 A;  3W99 D;  4R8P A;  3TU4 D;  3X1V A;  2F8N H;  4M6B A;  2CV5 D;  2Y2L A;  2CWE A;  2RVQ D;  5G49 B;  3REK B;  1P3F D;  5B32 G;  3AZI A;  1W2E A;  1P34 A;  4G91 C;  4XZQ A;  4QLC D;  3UTB A;  1ID3 D;  5E5A B;  3AZN B;  1ZLA A;  3WTP C;  3A6N C;  1M1A D;  3W97 B;  5B1L B;  5DNM D;  1U35 A;  4CAY B;  2BYM B;  5GSU B;  3W98 A;  4KGC D;  3UTA D;  5B31 G;  2PYO C;  2JSS A;  5AV5 A;  3UT9 B;  1M19 D;  1P3I C;  5JRG B;  5B40 D;  3NQU B;  5C3I C;  2HUE B;  4KUD D;  3REH A;  1Q9C A;  3LEL B;  3AZH D;  2CV5 C;  3X1S D;  5GT3 C;  5AV9 D;  3X1U B;  2Y2J A;  1P3P B;  3C1B D;  3B6G B;  3KWQ D;  3MGQ B;  1P3K A;  2YFW A;  1TZY A;  4QLC C;  5BO0 B;  4XUJ D;  5DNN A;  5B0Y D;  3MGS D;  1F1E A;  5F99 A;  2Y2I A;  2J8P A;  4Z5T A;  4X23 A;  1M18 A;  3AZL A;  3LJA B;  1M1A C;  3AZF C;  5DNM C;  4R8P D;  3X1V D;  3VH6 W;  3WKJ C;  5JA4 B;  3UTA C;  3WAA A;  5B2I A;  1M19 C;  3REI B;  3REL A;  3WA9 A;  4Z66 B;  1P34 D;  3AV1 C;  2W8S A;  3UTB D;  4EO5 C;  3AZJ D;  3AZH C;  5AV6 A;  3X1S C;  5AVC A;  1ZLA D;  1AOI A;  3AYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...