5B38A

Kir3dl1*005 in complex with hla-b*57:01
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Killer cell immunoglobulin-like receptor 3DL1 polymorphism defines distinct hierarchies of HLA class I recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b38A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5b38A01
5SX5H 6FABH 4HHAB 2FECL 1F58H 1K6QL 4FTVA 3PNWB 5IEKA 5GS0C 3IFLH 3ARPA 2WZPD 3DARA 3ZE0E 1F4YH 4CVZB 5C2BH 5IB1B 4MVBD 3QO0B 1PLGL 3PWPA 3O6LH 1ORQA 1ZVYA 2OJZH 1UXSA 2R39A 2GSGB 4E41B 1DZBA 4M3KB 2DQUL 1NUFA 4MNQA 4RISL 3QFJD 5F1IA 1OAZL 3QUXB 2NY3D 4KJQD 4XGZA 5DTFB 2E9IA 3LRSA 4ZO7A 3JSSA 5LGJB 4YHKL 4L8DB 2VNCA 2XRAL 5JW4N 4XNUH 4HUWA 1FBIL 5I1AB 1IAIL 1WWBX 1NJ9B 4JDTH 1GOFA 1QSVA 1MIMH 5FYKU 1DSFL 5ISZB 3AS2A 4NO5A 1BX2B 2C3VA 1H0DB 3MV9E 2OQJA 4HG4K 2R4SH 3SJVA 1ZANH 2GT9B 4RGMC 4Z7NE 3WE6A 2ZUQC 1HZHH 1BD2D 3L3HB 3Q6FA 2A1WH 4NFCA 4PBWD 4QXGH 5I8KL 4M6AA 3O3UN 4XPGH 2NY7L 4M5YH 3V52L 1JYWA 5IF0A 4XCEB 5GGRY 3WEXA 3C6LB 4JFEE 4F9LA 1BGXL 1II4E 5KS9A 4X99A 4JPWL 3VXME 5HHNA 4OF3A 4CJ1A 1IM9A 2G5BB 1M7IB 2QQKL 3PIQB 1EHNA 4K55A 4ZD3L 2WBKA 3L3OA 3RWDA 2VYRE 4N9GB 5CSZB 4F9PC 2VTFA 5HI4C 3LN5A 4P4KC 4GRLC 3LHPH 4Y2DB 4ZS6D 4PJIF 3K81A 3BH9A 4E5XA 3L1OH 3MJGX 1X5XA 4WHTB 5ICXA 1QZ1A 4MA7L 2VZ1A 3DWTA 1FN4A 5MHSE 5HVHB 1R5VB 1X7QB 4G9FB 1WC7B 3MRFA 2XWTA 3EW3B 3GUTA 5MEOB 3BZEB 1J0IA 1I8MA 3IS1X 2DJSA 4I0PD 4GUPA 1XAUA 4ZAKC 4UTAL 1KCKA 1IAKB 1RJLB 2NY4C 3F7PC 2AJ3A 4NPYA 4B7IA 1N59A 2AK4A 1HQRB 4JJHA 3D9AH 4JZJA 2BNRA 5KSAB 3EYOA 4L5FL 5CP3A 2IH3B 3HZMB 4LLMA 4ODVL 3CFEA 2A73B 5CCKL 1FPTH 1HQ4A 2DMBA 1MFDL 2F5BL 3IU3A 3QIWA 4U33A 5J9PA 3CMOL 4TVPD 4DKFH 4TN9A 5FM5O 5F88A 3GI9H 3LQMA 3T0EA 4PY7A 2GTZA 4OLVH 3CGTA 2DQFB 4JRXE 4WV1C 2BFVH 2PETA 1C5DA 4Z7UB 4HS8H 5DJXA 5T3XH 1KCVH 4XX1G 5GGRA 4PJHF 3SOBH 1F3JB 35C8L 1CL7L 4MAUL 4X6CE 2CLVB 3H3PH 4O2FB 2HTKC 2NY6C 4KMTH 1S3KL 5FUOL 5DD1H 3RVXC 1J87A 1OGAE 1QEWA 3ARDD 3GHEL 1UKSA 1VA9A 5HY9B 1NDGA 4N8CL 2I9LA 3OWEA 3RY6A 1U8OB 5AWNL 3O2VL 1SEQH 3CIQA 3RRQA 4GW1A 4HD9A 1IM3A 3EOTL 3OR7A 4Y16A 1HCFX 2H32B 5HPMB 1NCBH 3E6FB 3RWGA 3VFOB 4LVHC 3H8NA 1CFTB 1RZIA 3WV0A 3G08A 1T5XA 5ID1A 2HT4D 2P49B 3E8UL 1OF2A 1RZFH 2O26U 1D5XA 3MOQA 2EH8L 2X05A 2GUOB 4NQXA 2DD8H 4J23A 3U46A 3FB7B 4OI9A 2RBLA 4CVXB 1CG9B 2BP3A 3IF1A 1S5IH 4GG8A 1ORSA 5LAXA 2F5AL 2DQTL 4XP9L 2XTJC 2ZG2A 4JFED 3O6FA 3IETA 4QRUA 3VXMD 1A7RH 3QJHB 1FGVL 1IGIH 4QRSA 3RZWA 1AQDB 4RSVA 5C1MB 3RPIB 1MAML 3L5XL 3L5JA 4QHUB 4LF3B 4KKLC 1J86A 4PRBA 3B2VL 5BJTA 2VERN 3IDIA 1NFDB 4F58L 1CFNA 5C08B 5ENWA 3LQZA 4PJXB 3RIFK 5MHSD 3OKYA 1UM6H 3MQIA 5GHWH 4R4FL 4QRPA 3GFUA 2Q86B 5E4EC 3PL6A 1FYTA 3TH3T 2VN7A 3N1FC 5JMRA 4F3FA 3D0VB 1OW0C 1KGCD 2FGWL 4M7LL 4PGCA 3MMEA 2LE9A 3VGAB 2Z0BA 5HPOA 1ZWIB 4YAQB 4MQ7A 3EZJB 2ITCB 1LO5A 1EEZB 5ICYB 4HFUH 3WKML 3NCMA 3ZE1E 5KZCB 4M7ZB 5F8RC 2HKFL 3SKMB 4R90H 3KPQA 3GKWH 3QG6B 3QULA 1SY6H 3FQTA 1IGCL 1XF3B 2OL3L 4X6EA 1MREH 3VWJA 3VE0A 2YUWA 4XTRD 1ZS8B 1W72L 3VXOB 2A6KA 1EJOH 3TC9A 3HE7D 1NUNB 1VSCA 5F6HI 4NP4H 4DJMA 2NLJA 3ELAT 3I6GB 2FLBT 2QQLL 4TUKH 4JRXD 3S97C 2I24N 4LPYA 2DL9A 2WV3A 5K9JH 3BD4A 3V4UH 5D5ME 5JZ7D 2GCYB 4L29A 3ZHKA 1KPRA 2VXUH 2B2XL 5H2BA 4J3TA 2XTJE 1KEMH 1OGAD 1DVFB 2Q76A 3TZVB 1S7QB 1KTLB 4QXUH 4PGBA 5I75B 1KEGH 4HQQH 4MZ3A 3LH2L 2HFGH 4EDWH 5IB2B 2C4FU 5HI4D 5IFAL 4WI2A 3JV4A 3F7YB 2X6MA 2ZCHH 5DYOA 4GRLD 4G8GD 1KB9K 3MCG1 4WO4B 4TNVF 3X17A 1F42A 3VH8G 1P4IL 5KSUB 1H3GA 3UCRA 2ATKA 1WJ3A 2V2XA 3LQAL 4QOKB 1H3TA 1NFIB 1OCWH 2P5WD 4TSBL 5DQ9A 2IFFL 1R3LA 4NDMB 4JPKL 5BRZE 1R5IA 1HEZB 4BSJA 1IVLA 2BY0A 2Y1VA 3NIDE 4KPHL 3DNKA 2KZ1B 3ZDXF 2YBRB 4P2RD 1C8PA 2VXTL 4DW2H 2E7HA 1CFSB 3FOMB 3BGMA 4OIAA 1UM5H 4GKNA 2QQQA 3ULUE 1FHGA 4FXLA 4HIJA 4PGEA 4ZOAA 3EIFA 2OJEA 4FP8L 1F4WL 1OOAA 1S9VA 1D5MA 5E1AB 5L8KB 2AABH 5L0QB 3H42H 2A74A 1I1AC 4PV8A 4GW4A 3T0XA 5JHDD 1U92B 3Q48A 3BEVB 4R8WL 5T33L 3LIZH 1JI1A 4BFIB 2K7QA 3MRLB 4FQIL 2J8UA 4PY8J 5JR1L 1U2HA 3MR9B 2FJGA 3GK8L 2VDNL 5I71B 3TJHC 3PABA 5C0EA 1X5YA 2EYTB 4XNQB 4BQ8A 5JOFA 1OARH 5GS1C 1JZ8A 1N5YH 2P24B 1W0VA 5ETUB 2YD9A 3QO1B 4U1KB 2G75B 1RK0A 3PWJB 4NN5B 4OD1H 4NGHL 1C16B 4DZ8B 1EMTH 2HTKD 3C2SA 2NY6D 3DVGB 4GKZB 3RVUC 2VXVL 2N4IA 4M7JH 4J3VA 1JGUH 1HIMH 3DETC 3DYMA 4NQVB 2M26A 3SCMB 4WHYH 3BE1H 3OKDA 1S5HB 1FIEA 2NY5H 4R26H 4OZIB 3BDYH 4NKDA 5MI0B 3WFHB 4RRPA 3ILQD 1VADA 5E2VL 4JQXA 1A4KA 1AGEA 4PJ8A 4NZUH 4Z7UF 1J0ZA 2OTWA 5C70A 2VL4A 4MD5B 2V7NB 1HI6A 5GIRA 4KZDL 5BS0B 4AG4H 2HMID 1LEIB 4V1DA 3S35X 2RCSH 4JFFB 3R06B 2OX5A 5E8OB 1U91A 2P8LB 5JNYA 1EFXB 2FLRT 5DQJB 1S7UB 2VH5L 4K7FB 2EYSA 2EXYC 1FE8L 3MUZ1 1QSEB 3QXAB 4YHYC 1GHFL 3CDYA 4KI5E 1N0LA 1HH9B 4KRLB 2FD6L 4KWUA 1OSPL 4JFQA 4NNXA 4Y4KB 4HULB 2Q3AA 4PLJD 2R69H 4JY6A 5B3JF 1ZA6A 4U0RC 2DLFL 3RVTC 3MACH 4YHMH 5CBAA 2DM2A 5HHMB 4NUJA 5IR1B 2RGSA 3RWIA 4APQB 1SVCP 2MPAL 4Y89A 2A77H 4X6BB 2ZSWB 1BQHG 5BXFA 1YPZA 1DANT 5C0FB 1LEKA 4D9LH 1UWEL 5CS7A 2XY2A 3ZHLA 4JJ5A 2VR4A 3OB0H 4BZ2H 1JPSH 1TPXC 3O3EA 2ITDB 1XCTA 2BCKA 3R0MA 5BRZD 1Q9KB 5BW7C 1AIFA 4LCIL 1BFOB 5DJ8B 3HTLX 5DJZB 3MUY1 2DS4A 4XAKE 3QEUA 5LCVL 1T7YA 3VFRB 1G0DA 2MTPA 3VGFA 4JGJA 3QUZB 4OLWH 3WXVL 2JCCE 3E2HB 1MCNA 4ODTL 1PLGH 4XMPH 2BSRB 3ULUD 5FA4A 2AGJL 2WUCL 1GZPA 3O4LA 1BHGA 3BIKB 4DN3L 5TH2B 1QQDB 2AKRA 4NHUB 1NFDF 4ZUWA 5FCSH 4JRYA 3IFOB 1VKXB 1BVKA 4RISH 4PJXF 1HKFA 4MDJA 2WWMC 3KS0J 3FB8B 2B4CC 3STZA 2C1OB 4O02L 3K0WA 4N5ED 4AEEA 4EN3B 4R2GB 3WD5L 1T03L 1HYRC 4U0QB 5JMOC 4GS7C 1FBIH 4JFOA 1GXEA 3P11H 1JPFA 3MUHL 3D2UD 4HJ0C 4P4RA 5FGCB 1KULA 3S3PA 1X44A 4QLRA 5D7LD 1NLDH 3RWCB 1IAII 3KXFB 1PY4A 3SDDA 1KLFA 4HPOH 4JG0L 1HILA 5I8KH 4GRWB 4UILL 5EO1A 2NY7H 3V52H 4NYLA 3HAEA 1MCWW 5EC2A 2V5TA 4N0CA 4HAFA 4WFGE 1OP5H 4FFEX 3AS0A 2IPTL 3K8MA 1K5NA 4Y4FD 4HFWA 1DQQA 2ZUVA 5DMKA 5IKCB 3MRPA 1E4WL 1IQDB 4J1UB 5F9WC 2QQKH 3X13B 3UTZB 2BOBA 5F7NC 4Y1AD 4ZNEA 1Q9WA 5ID0B 1KG0A 2ESVA 5IBTH 4HIXL 1N5AA 1T7VA 1V3LA 3QAZC 3CDCA 1NEZA 3IAPA 3FCTA 4MA3B 2AJVL 3D3VE 3TCXA 5JDSB 4M8QA 1LGVA 4FQHA 4L9DA 4KI5D 4MA7H 3NABL 2AV1A 3FQNA 1ZVSB 1L4IA 4RAHA 2BK8A 1YEDB 2EICA 4JQVC 1NCNA 4NO0D 4Q58C 1QYGL 5H94A 3CUPB 5DEFB 3HR6A 4IHOA 4W68A 3BPLC 1T0MA 5AG8A 4UTAH 2Z8SA 4XZUA 2YSSB 5A2JH 4M61A 4YDVA 4AY0A 4Q74A 3MLYL 3MJ7A 2WY3A 4R3SA 2XPGA 4Z8FL 2K1MA 3NVQA 1G7QB 4W70A 1UM4L 4L5FH 2CUMA 4ODVH 5D7JA 1NBYB 5GGQL 3RWEB 3NIGE 1TETL 1IQWH 4UNTA 4FFZL 2P48B 3HUJB 4K3GA 1VFAB 1JNJA 1MFDH 4ZSOB 3U7WL 1LP9B 2F5BH 4JGMA 3FT2A 1JHTA 4MQXC 3CMOH 2CDFA 4Y5YB 3OAZH 3VFTB 2NNAB 4XAKD 4OAWA 4Q97A 1U3HD 5C0JB 3BPNB 1XIWC 4PJFB 5FB8B 3RVUD 4NKOA 3M17A 1SHMA 5ILTL 5IQ9B 3DETD 4Q9BA 4YBLC 2UWEB 3QCVL 3RVVC 3S37H 1HHKA 1F4HA 1PG7L 1XH3A 2X1QA 5I1GL 1ZAGA 1U8MA 1GZQB 4B0MM 4MAUH 2N56A 3S9DB 5FUOH 1RZGB 2WMPA 4L8BB 4O00A 3GHEH 1HWHB 5MENB 4D8PB 4NC1C 4N8CH 4RGNC 3QQ9C 1VGEL 4G6AD 3PHSA 1CL7I 2VWEE 3O2VH 4YWGL 4DGIL 4M7LT 2W60A 4AH2A 3EOTH 3TA3C 3MJ8B 3K7UA 4GBXB 3ARBB 5CJQL 2AEIT 4Z7OE 2EXYD 5E1HB 5D2NC 3A67L 4MLSA 4X4YA 5SWZB 5MEPB 3I75A 2FO4B 2VSCA 2BVPA 1WVZA 4OZIF 3VRJB 3AREB 3O3AB 4ZXBA 4R7NB 3TN0B 2EH8H 1C5BH 1FGNH 1IGFL 3FQWA 4DWHA 4LDEB 3QDGB 4KDTA 1KCSL 1BQUA 3BT2H 1ZSDA 4ONHA 5IHZA 4D0CA 3RA7H 4KY1L 2F5AH 2VAAB 3PJSB 4XP9H 4WFGD 4U1SB 1ROWA 4JFDE 3MXWL 1FGVH 3CSYA 3VRIB 3U0TA 2FJFA 4Z6AT 3WIHA 4QNPF 4ZUVA 3L5XH 5GZND 4OGYL 4Z95H 3B2VH 4LCWE 5HHQA 2R8SH 5CEYA 4MJ6B 3ZE2F 3ARTA 4X4MA 2NY0B 5HHOE 1IC7L 3O2DH 3L3JB 4PJAA 4R4FH 4MMXC 1GAFH 3KYMB 1A14L 3WS6C 4UB0H 4OV6F 5I9QC 3LD8C 1IEBA 1B0RA 4GW5B 4Q6YA 4XX1E 5HI3C 1XCQA 3TCLA 2EYRA 4PP1C 2ZSVA 2EZ0D 3DBXB 5FUZL 3QBTB 2FGWH 5EOCL 4M7LH 5FDYA 3DPBA 4NC1E 3LDBB 5E8EA 2MMXA 3CX5K 3WKMH 1IAOA 1H3WM 1G9NL 4OD2B 5IB4A 3LN4B 1NGWA 2HKFH 1A9BA 3FOLA 3GZKA 1HSAB 4S1DC 1MHEA 1IGCH 3QEGH 2OL3H 4LIQE 3WIFB 3TBWB 3SE9L 1JYVA 4PYHA 1BVZA 5D2NE 3EFFA 1W72H 5K33A 3O45A 1EAPA 2Z31B 4P9HL 5T1KD 1K4DA 1PX3A 4CDGC 5F89B 1YMMB 3QG7L 4JDZA 4XRCB 3DROB 5HJ3A 1URLA 3NTCL 2YK1L 2WBJA 4LPWA 4ZPVB 5I1JL 4FXKA 3GSWB 3CCHB 1CXLA 5HD8D 4K8RL 3SQBA 3QNXA 4PJIE 2WAHA 3W9DA 5LXGL 1A9EB 1EZVX 2FNBA 2HG5A 1U8HB 1U8QB 1AGDA 3MSPA 4PD4K 1EGJH 3QHZL 5EORL 1CGXA 4XNMB 3LH2H 5D1QB 2DJ4A 3U0WL 4HCRA 4NO3B 1G84A 3JV0A 4KRMB 2EEBA 3QWRA 3SGEI 1I1CA 5JW4M 1CF8L 3UJTL 5EU6B 4U2YA 1G7MA 3PE9A 1P4IH 1TMCB 2PYFB 2PTTA 3C8KA 3IDGA 3SDCB 5TDOA 5KW9L 1V5JA 5I74B 2R23A 4TSBH 5D8JH 2IFFH 2VLLA 3QIUC 4N0UB 4JPKH 3P30L 2OK0L 4F7TB 1A3QA 1WBZB 3MBED 1FO0L 3MRRA 4YHNA 2QR0A 4Z78B 5E95B 4LL9A 5GSVA 1YNTA 1U93B 4K23H 5IJKA 5HGBB 2ZKHL 4MSWA 4OZHB 2HJKA 1F4WH 1UT9A 3DRTB 2NW3B 1T1WB 4QRRE 4JFDD 4HBQA 1OSZA 3NGBC 3JXAA 3C5ZA 3NAAL 2XNAB 1FNHA 4R8WH 5T33H 5I18L 5CZXC 4PJGB 3GB7A 4FQIH 2AJSL 4ZQKB 2VDNH 5IROC 1P9MA 2BY1A 4LCWD 3QT2A 2DJUA 2VDPH 4OZGA 1CBVL 3DSFL 4UDTB 1E28A 1F11B 1T1YA 2LQRA 5HGHB 5HHOD 2R29L 3ARFD 4O5LL 3RBGA 2ZPKL 3RVVD 5HDOA 3G5VA 5CEXB 4ZFOB 1JGEB 4KDWA 1ZLUK 2I27N 2XKNB 5DK2B 1PVHA 1QNZH 4M1CD 3RI5F 5IMLA 4YE4L 5LKNA 3HUJF 4NBZB 5GQBA 3U4AA 4MVBA 1RAMA 2JKXA 1OM3H 2HP4A 5I17B 1CCZA 1CDCA 1QSFD 2Z91A 4MJIA 4QHNA 3BUTA 4G6FB 3HPLB 3PWLB 3IVKB 1DJSA 2VZTA 2ILLA 4FQXA 4KKCD 4PJFF 3GJEB 4PG9A 1U41A 3KPLA 3QUXC 5E2VH 4JN1L 2H26A 2ARJA 1T0NB 1D6EA 1BZ9B 4ODXB 4KZDH 1AD9B 3SDAB 3DJ9A 2AXGA 1BOGA 3DIFA 1Z9LA 3WUWA 1E6JH 4RQQB 2GKIA 4KKAC 1X5GA 1X5IA 1IGMH 5BVPH 4PTUA 1WFUA 2VXSL 7CGTA 1H3PL 5TE4L 4LKXA 1FE8H 4LBEB 5HYIA 1A47A 1KCUH 1CVRA 3CXDH 1HDMB 2FD6H 4I4WA 1WZ1H 4B50A 4M4PA 3WJJC 2EDOA 2X4OB 5SWSA 4LLWB 3QCUL 3EGSB 4JAMB 1T2JA 4HZLB 1YQVL 3PGCB 2DLFH 2PYEB 4N90E 1NBZB 2X7LB 3C6LC 1Q0XL 4BJLA 1C7TA 3IJHA 3SGKC 1INQB 1ITBB 1S9XA 1JFMA 4XWGL 1S8DB 4MLIA 4U6VL 4R0LB 4JFZL 1WZMA 2DWEB 1JNNL 1EIBA 4JZOB 3LMJH 4FQPA 4WI8A 2DKUA 1MQ8A 1J0YA 5TJWK 5F71A 4MXQA 4GKSB 4U6TA 4K3JL 1S7VB 3J8F7 1GOHA 2P47B 5DHYA 3MLRL 1IC4L 4KRNA 5DJCA 5HI3D 3U9UB 3VDCA 3PDOA 3EO0B 3RPKA 4LHQB 3OXSB 4F80A 3WXVH 4PJDB 4ODTH 5F70A 3EYUL 1PZ5B 2AGJH 2WUCH 1G7JA 1CICA 4U31A 3O3DB 5DF0A 4JQIH 4DN3H 1QO3A 4E41E 4QRRD 1BREA 4XPAH 1BZ7B 1XGTB 5HYSA 3A6OA 4P2OB 4B7LA 5I30H 1K4CB 4M43L 4YGVA 3Q3GA 1CDBA 5IB5A 3ARXA 5KSAC 1NQBA 4TUJA 1NGZA 2EE3A 5J8OA 1EXUA 4HWEL 3KPRD 3ALXA 4Y5XA 4U6YB 3QFDA 2IANB 4AIOA 1RZKH 1F6LL 3LQAC 4HV8B 3AGVA 3W11C 3Q5YA 1S7RB 1IEAA 1T03H 3CH1B 5ISZE 2E27H 4LCCB 5F6HJ 3LSOA 5BZDB 4AM0B 1TCMA 4JKKA 2JK5B 1FNEA 5CZVL 4PP8C 2QADB 5CKAA 5AZEH 1ZEAL 1YEEL 2GAZB 4G59A 5ALBH 5T1MA 3SKJL 2X4UB 2VAJA 2XFXB 1WV7T 1K9TA 4JG0H 2AEPH 3K3QA 4UILH 1P6FA 3MLXH 3BEWB 1D5BA 1L0QA 1D9KD 5FCUL 2A2QT 3ZDXE 3ARDA 3QP3A 5IMOB 1F3DH 1T04A 2BERA 3WJLA 4BA8A 1E4WH 2R0KL 1L0XA 1TQBB 3QDJD 2EDQA 1UJ3A 3T4YB 1EUTA 2A6IA 4MXVF 4FFYL 5EU3A 3FZUC 2YC1A 2PCPA 3DTXA 3HMXA 1FJ1A 1LK3L 4JKPL 1KXQE 1PKQA 1I9EA 2XICA 2AJVH 4X7TA 2YOCA 1F8TL 3EYFB 2NCMA 3MO1A 2DLHA 3NABH 4G9FE 3GSNA 4H20L 3MV9A 3QISA 2PXYB 1N4XH 2UVFA 3LOWA 5A3ID 1QYGH 3HG1B 3ZL4H 1MJJB 1T21B 1ZHNB 4N90D 3LS5L 5D1ZA 2OMBA 3MLYH 4JY4A 4KGJA 4PYGA 3REVB 1SYVB 4CU7A 3NFPA 4Z8FH 4IRSD 4KJWD 3U2SA 1UM4H 1INEH 4RA3A 2X70A 1TETH 4EUPH 4FFZH 4P3DB 3U7WH 5I8CB 3DUSB 4HT1H 4P23A 4CU8A 2FX8L 4H8WL 4OZHF 2W0PA 3UTQA 1QR4A 1YYLL 1YDPB 1WK0A 1FZMB 2Z4QB 3T0DA 1A6VH 4Z7UE 1JP5A 1SJEA 5E8NB 4UIMB 5ILTH 4WHYG 1I8LC 4PJGF 3SDYH 2J1KA 3QCVH 4F2MA 2CUHA 1CD1B 4YK4B 3VFWB 3AB0B 1PG7H 4LVOC 4E41D 5I1GH 1QLRB 3GSQB 1A1MA 4G6ML 4ZYKA 3VGAC 4RNRA 5E8PA 3ZSTA 3O3BA 1N26A 1K8IB 5DRNB 3O41B 1AO7E 4M7ZC 4AEIL 3ZKQD 1G0XA 2O61B 1VGEH 3VFMA 1MIEL 3B6SA 1HHJB 4WU7B 4DGIH 3D39B 1DUZA 5EN2B 2W92A 4D0DA 3BQUB 5ACMA 4LNVA 5CJQH 2DMKA 5DEGB 5ISZD 3Q5OA 1MJ7L 3I84A 1RHHB 1BEYH 3A67H 3CX5J 4MDIB 2XYCA 3I6KA 3IFPB 4JEGB 2IAMC 5F3HB 2GEEA 3QIBB 1U8NA 4PJ9B 3OX8A 5IOPB 1MLCB 1UB5A 2VE6B 2NW2A 3LPGA 3OZ9L 4NRXA 4JRXA 5FGSA 4XBEL 1P7KA 1PGRB 1FVDA 4TSCL 5C0BB 3HE6B 1KCSH 2DTSA 2XWJB 3QCTL 5CBEA 1PEZA 2R9HC 2BDNH 4RMQA 4KY1H 4L3EB 4LQFL 3OPZH 3CK0H 1M6OA 5I75C 4ZDHA 3GHBL 3FKUS 1OGTB 5IK3B 2C3XA 3S88L 3MXWH 2DQGH 4L4TB 3L6FA 2H2PC 3MUGB 5I1IH 2EC9U 3WHXA 4F9PA 2ADGA 1AQKL 3DRQB 4MB4A 2V2TA 4F7CA 4KQ3H 1P6AB 4Y2DD 4P4KA 2X1XR 4GRLA 4WEBL 2DB8A 1AY1H 4X5XA 3L95A 1C12B 4OGYH 4F57L 1F4XL 2DKMA 3VWKC 1OQOA 5C08E 3RGVC 5I0ZA 1LQVA 4PD4J 4HWNA 4PJXE 5GISH 4TSAL 1MFEL 1HYSD 1G1CA 4LDOB 2JJWA 2F8VA 3F7RA 3CFDA 4YQXL 4PJ7B 1LO4H 5HYEA 3LKNB 4IOIB 1A14H 4K94L 4DUWA 2DWDB 4LHJB 1JRHI 4NC0B 1L8JA 2J7LA 3CLFH 5FUZH 4X80L 5EOCH 2CKBA 3EYSL 4QXWA 5KSAD 3PGDB 5GGUA 5L0QC 4GAYB 1G7HA 1LD9A 2NTFA 3WNPA 1NL0L 4JN2A 3RWHA 1HE7A 3HS0B 4S2SA 3GMOA 3T3MF 2BOCA 3MLZL 3VA2C 5IV2A 1P84K 2HT3C 4QCIB 1SJHB 3SE9H 1A3RL 3UAJD 4FNLL 4H1LA 5I71C 1OTSD 1UJTA 3FRPG 2XG5A 4XCCL 4P9HH 3PP3H 3U7YH 4OCXL 2HWZL 4V2CB 5AZ2H 2RHEA 1PKOA 2EDLA 4FZ8L 3QG7H 1ITCA 2BVYA 5DI8B 1JI2A 4WV1A 3NTCH 2YK1H 3TPKA 2C3WA 5B8CB 1G6RA 4X5WA 3NPSB 4XMKL 1I7UB 2XA8L 2VLKA 3CXHK 4NKIL 4OF6A 2B1AH 1BAFH 2FWOA 1RUKH 4X7DC 1FDLL 1FLTX 1XF1A 2C26A 5LVEA 4CMMB 2FL5A 1N8ZB 3ULVL 3G6JE 3GIVB 4OGAC 3X12B 1MRDL 5I1EL 1NMBH 3F5WB 1JF5A 2Y72A 4G9DB 3U0WH 5FOBB 2EIEA 1U6AL 4K3DL 4YJZL 3RTQC 1MVUA 3T2PA 1CF8H 1JUFA 3GM0A 2ZOLA 3UJTH 3DX8B 1WQVT 4XWOD 5EOTB 3RDTC 4TTGA 2NY2B 1A1NA 4JDVA 4QOKE 1J05B 4CADA 1YNLL 2GY7B 3BP7B 4FZEH 2R1WB 5KW9H 1T2QL 3RIAF 4JG1L 3V6BR 5IHUL 4K71B 3SN6N 4IS6B 2H45A 3P30H 1ZKAA 1XMWA 4U1GB 2OK0H 4U3HA 2DMCA 4X0KA 4MCYA 1MHPL 1GGYA 5DJ2A 3EDJA 3MLTB 5C6TH 5L2JA 3CMGA 5D9SA 1ZGLB 4ZUTA 4LLQA 3EO9H 4EI6A 3V0WL 5I2IB 4MNGA 4R96B 2ZKHH 1BBJA 1P7QA 1AKJA 4X5LA 1GIGL 1NCDL 2WSKA 3Q1SL 3KHOA 4KV5F 3W9EB 5SX5K 5I18H 3LKSA 1RUQH 4MD0B 1TCRA 5IBUG 1J1OH 3VI3F 1NC4B 4CMHB 1G0YR 4IM8A 4NZTL 4BSVA 3ISWA 1T89C 5C08D 4G8FB 2I07A 3MRDB 3I3EA 3DSFH 5IVXF 5IFJB 5K9OA 4M02A 1KJ3H 4L4TA 1Y18A 4DK3A 2R29H 4OV5B 4XCNB 4O5LH 3MJ9A 2ZPKH 1V3MA 1DQJA 4PJCB 2HT2D 3SO3C 5D70L 4NZRH 2D31A 1G9ML 4XBPA 3DVFA 3G6DL 1OW0A 4CW1A 3SDXF 3O4OC 3LV3A 1F90L 4OT1H 4UOJA 1XGUA 3WLWD 4C4KT 5E9DB 2V2WB 3S34L 3HMWL 3KLAB 3MRBB 3N06B 4H5SA 4OCYH 4TUOB 3BW9A 2NXZC 5BZWB 1F45A 4RIRA 4WENB 3VFPA 1VACB 3ARWA 1BIIB 2VLJA 4L8SC 4P49A 2K3TA 4Z0BL 1E27A 3TIDB 1PYWA 3S8WA 1C5CL 4PJBF 4FFWD 3TFKC 2DQJL 5BS0E 3IXTB 1QBAA 4XHJC 4L3CA 1KT2A 4JFFE 4XP4L 4EN3C 1SMOA 2ZWLT 3BO8A 5H8DA 3VJ6A 2P8MA 3NCJL 4G7VH 4R2GC 1UQSB 4FQLL 5F7DB 3OKMB 1LQSR 3OKEB 2A9ML 4RMUA 3OMZA 1QSEE 1KLUA 5JPNA 4NFBA 3D2UA 1H3PH 1RK1B 3QR2A 4QNPE 3RX8A 4UBDD 2R9HD 3QPQC 4IDLA 1P2CB 1DVFD 1FAIH 2GJ6B 4FQCL 4TPRL 3QJFA 3TZVD 5CD5D 3RL2B 1I3VA 3AU1A 3MJ6A 4FFVD 4M93B 1FL6A 4RDQF 3CFKA 2CK2A 3ZE2E 3D85A 3IXAA 3EBAA 3QCUH 2KKQA 3BOVA 5GSRA 4C83B 1YQVH 2H2PD 4JRWA 1EK3A 2WINB 4Q9CA 4EQ3A 5HHME 1XR9B 1G9NC 3ARYA 5E08L 2E6PA 5DT1L 1Q0XH 5B3NA 4Y19A 4WO4D 3U83A 3ES6A 4YBHA 3EUUA 4U6VH 1J7VR 4HK3J 1B4JL 3ZMRA 4QOKD 1JNNH 1MFCL 4X8JB 3QZWA 3DV6B 3TO2B 2YUVA 3U9PL 3H0TB 4LLYA 1I7RA 3FRUB 3FTGA 4K3JH 1JF1A 3EOAA 1Z5LA 4KRPB 1TQCB 2PO6B 4NQEA 4LLUB 1IC4H 4LCYA 3DYPA 1VFBB 5D72L 3WO4C 3RQ3A 3W82A 2OLDA 3HPJB 3ZKND 1FFNA 1LK2B 4K8RC 3DVNB 2VR9A 1DDHA 2OXGA 3LKRB 3KPNB 3MLSL 3S4SG 1DQTA 4YDKL 4NHUE 2V9QA 4NRYB 1E4XL 4XNXL 2NX5D 2VIRA 1DN2A 5FFLA 4V2BA 5GRVK 1I1AA 4IRJB 2YN5A 1RJZA 3OJDB 2NY3B 3CLEH 4HIIB 4ZO8A 4FQQB 4PFEA 2HT3D 1FNSH 4OZFA 3L3IB 4PRDB 4PJ7F 1KF9B 3GBNH 4ZTPL 1NC2A 1XF5A 4Y4HD 3W0WA 1ZGLP 3TJHA 2OSLB 2AJUL 3GMQB 1P53A 5I76A 2W38A 2I5YL 2X4TB 5C0GA 5GS1A 3UROR 4MS8C 1J18A 5FGCE 3UBXI 4KJYA 3T04D 1P4LA 3ARGD 4XPHL 5FEBA 2FIKB 2HVKB 1DE4A 2NYYC 5F7MC 1ZLSL 3BPNC 1IGTA 1ZEAH 1YEEH 1XZ0A 3KXFE 1CGWA 3SKJH 1BD2B 1JK8B 2JCCA 3RVWD 3HRZB 4GRWE 3ROOB 3QEHA 3MNZA 4KVNL 3SCMD 4CUCA 4RMTA 3U82B 1MI5B 2Y06L 3KPSE 1DQLL 1T1XA 2CDGB 3QUYD 1QFUL 3O2WL 2DYPD 3REWB 4JFXA 3MRKB 3R8QA 1M71B 5ACZB 4O2CB 1IGJB 1CE6A 1N64L 5JQ6H 1LO0L 5BS0D 1SYSB 2R0KH 1DUYB 4Z5RB 4DCQA 5EZLA 1IC5L 4JFFD 4RDQG 1S9YA 4GBXC 3C5SA 4QO1A 4UQ2A 3ARBC 3SY0B 5EIQA 3TVMB 4FFYH 4WNQA 4G5ZL 2VQ1A 1LK3H 2PW2B 1KNOA 1S78D 1QSED 4JKPH 3STLB 43C9B 3HNTH 3LKOB 2VO5A 4MA1B 5EOQL 5J89A 3NCFB 1B4RA 3WUZA 1MFNA 3MGOA 1F8TH 3LVEA 5EWIL 5L8LB 2E9WA 5HGGS 4Y4KD 5DZOA 3BPCA 3OKKA 5EBMB 4BH7A 1CGYA 1N3NB 3ARSA 3GJFA 5IJVA 3KPMA 4XCYB 1FFOB 3NA9H 4GQ9L 4WGVB 4ZMAT 4ETQB 5L7XH 4P5MB 5FK9B 4HH8A 4APQD 3LS5H 2IMNA 4JZNB 5KSVA 4G42A 4LLVA 1KELH 4FTVB 1HKLL 1QRNA 3CNKA 4J4PD 1BP3B 3FB6B 1CT8A 3HUJE 5GGSB 4ZSOE 2FGZA 1LP9E 3ZT7A 3WFEL 3QH3B 4YH6A 1CU4H 4HPYL 1Y6NR 1CGSL 3PWPB 4R6UA 1ORQB 2E7LC 4P59L 3QSKB 2FX8H 4HLZH 4H8WH 5BW7A 1UXSB 4PJFE 4XH2A 3QUZD 3GGWA 3D3VA 1XF4A 1QP1A 2NY0C 4N8VA 4MNQB 3PHOB 4X9BA 2UWEE 5F1IB 3D25A 4XGZB 4ISVA 5E94A 4RAVB 3ECBA 5AUMA 3QEQA 4F37F 3V4VL 5E8DL 3FONB 4KK5D 5C2UB 3QHTC 5MENE 3P4MA 1Z0MA 4KK9D 4GAGL 3I6LD 2EDYA 1UCBL 1A7NL 4AEIH 4PJCF 1OTTD 4V3DB 4QEGA 4L1DA 1MIEH 2CRIA 3RI5K 5HDLA 4EN3D 2OQJB 1MAJA 3MRGA 3BXNB 1KCGC 4LHUG 3ZKXB 3HFML 3WE6B 5EZOH 2IJ0C 5D96C 5SWZE 1MJ7H 2XACC 3B3IB 3PWUB 5HVGB 1HINH 5IF0B 2QHLA 4KK6D 3UTTA 3WEXB 2APFA 4P46B 3V5DA 3BGAA 4YO0B 4K7PL 5KS9B 1DBAL 1DCLA 2R2EA 3OZ9H 4NWTL 2AXHA 3QDGE 1IM9B 5HGDA 4H0GA 1VB9A 1AJ7L 4XBEH 4LSUL 4TSCH 1YEKL 3IKKA 3RWDB 4QHLB 2J8OA 4MD4A 3MNWB 4AENA 2MQ0A 4XVSL 3LN5B 4M6OH 1LNUB 3EO1A 1GCFA 2HJFB 1CXEA 4EJ1C 2Z92A 5J13C 4I48A 3OB8A 3GHBH 4PTTB 5FKPA 3BH9B 1AC6A 5D1QC 4OCWL 5ICXB 1NMCB 4EXKA 5I66A 3S88H 1FN4B 4G6JL 1TZGL 4HIEB 5DC9B 2E7LE 1L9MA 5CLWA 4WEBH 5IHLB 3GUTB 3A6BL 5DJAA 1QOKA 4F57H 4GUPB 2OBGA 3JTSA 5FM8A 2XWBB 2OS7A 3IDYB 2YA2A 5FYKE 1GGIL 3X3FL 1TVHA 5KTEL 2XIDA 3GM8A 1MH5A 1KJ2A 2AJ3B 4LSQL 2ORBH 1D5ZA 5E00A 2AK4B 2Q6WA 5HHVL 3GIZL 1JWMA 4YQXH 2BNRB 2GITA 4X4XB 3EYOB 4JQVA 4POZD 3TBYB 2LU3A 4QY8A 1P5VA 1AGBB 3CFEB 5B39B 3KPOB 4M6NL 3TGXA 5T1LD 4QKXB 1HQ4B 1NAMA 4W6XB 1BQLL 2D0HA 3P73B 3K8LA 5JLZA 5F3BB 5HYJB 3HC4L 3IU3B 3O8XC 3HC0A 4LEOB 4X80H 5AAWA 3EYSH 5ALCL 1V7MH 5DRXB 5J9PB 1MRFL 4NHCL 2DRUA 4YXLL 3HZYA 3EJZC 4P5TB 5F88B 4PJEA 3T0EB 1NL0H 1WGOA 5D7SL 1D5IH 1UB6A 2W1NA 3MLZH 4MS8D 5CEZL 5DJXB 1RIUL 3THML 3SHSA 1A3RH 3VU2A 4O4YL 3W2DL 1J8HA 1JNHA 5GGRB 2D7MA 4OLXL 4XCCH 3ROLA 1N6QL 2NYYD 1JGLL 1KLGA 1KCRL 3BH8A 5DD0L 2HWZH 3MRNB 1YMME 5J4MA 4WW2F 1XIWA 4PRHE 5IQ7L 3OV6A 1V7NL 4V3EB 3T0VA 4DGVH 5HHOA 3U36A 5EZIL 2I9LB 4ESKA 3T3PE 4KZEL 1KFAL 1WEJL 4MXVE 4ODUB 4XMKH 3QXDB 2X4SB 2XA8H 5M95B 1IM3B 2Y36L 1CR9L 1U8KB 3HR5A 5KVFL 5C07B 1AR2A 2AXFB 4YUEH 5MEND 2R2HA 3RWGB 4DOHB 1DN0B 1QBMH 4I77H 1U8LB 5A43C 3ULVH 2P1YA 5D1XC 5I1EH 1RZIB 4DVBA 1T5XB 3IJSA 4G8GB 4GBXD 5JW5A 3CX2A 4K3DH 5EU6E 3TA3A 5C7XL 3OR6A 4K9EC 3B9DA 4HS3A 5I1KL 3K46A 5GGTA 4CNIB 1A6ZA 3KPPB 1T1ZA 3OJMB 2P5WB 4H8WC 5D2NA 1YNLH 3SDAC 3HN3A 4TVPL 2VDQL 5DFVC 1F6AA 1T2QH 3QUKB 1MCRA 4GG8B 4N0UE 4JG1H 5JHLL 3ARED 4LSTH 1ORSB 5LAXB 3TN0D 1IL1A 5GGVL 4A6YA 5IHUH 3NZ8A 3MNVA 4LSSL 5CD3A 3IETB 4P2RB 1RVFH 4QRUB 2DDQL 2YRZA 5IB3B 4QRSB 1MHPH 2HLAA 2D7OA 1GGCL 4OZHE 5EPMA 3VFNA 4EUPG 5E03A 3P9LA 3HAEH 2RB8A 3CFBA 4PRBB 5BJTB 2VR5A 5CZKA 5JHDB 1GIGH 1NCDH 4QRTA 1N6UA 2GIYA 3Q1SH 5L6YL 3OB0K 2YKLH 1T22A 5ENWB 1QFWM 4PJGE 4TVSa 3F6LA 3E3QC 3DURA 1Q9LA 3TEUA 3DGGB 4QRPB 4IDJL 1YECL 3BD5A 3B9KD 4WWKD 3PL6B 4F8QA 4UIKL 1FYTB 4I8DA 4NZTH 5LWYL 4RGOH 3ZZ1A 4QGYA 1OB1A 4F3FB 5IW1A 5C6WH 1L7TL 1NUGA 4HC1L 2NY0D 5FYKD 5FF6B 4ZFZA 2FBOJ 5K9QG 4MHHI 4MQ7B 4S0TD 4G8IB 2CJUH 5IW3A 2NY1C 3O81A 4EXPX 2HFFA 5J12C 3U7AA 3WS6A 1JN6A 3SE3C 3HKFA 1BLNA 4RFEB 4BFBD 5GRUL 2FEEL 3G6DH 3QULB 2BHYA 5DR5H 3FQTB 4X6EB 3VWJB 2EXWD 4E42A 5DRZA 4C57C 4PB0L 1ZHLB 3NFNA 3S36L 1AFVL 3S34H 3HMWH 4WUUD 5MERB 4Z7QF 2R4RL 4P2OC 2WWKT 1A6AA 1BBDL 2VXQL 1PG7W 1M7XA 3W39B 3M1BA 4NT6A 1C5CH 2FJHA 2Z31D 3MRIA 3RU8L 5CJOL 1RZ7L 3U30B 3BSZL 2IEPA 4L29B 4U1JA 2JB6A 2UZIL 1KPRB 3FT3A 1K85A 4XP4H 2ZUWA 3UDWA 2XA3A 4JO3H 3NCJH 4OM0L 5DJ6B 5H2BB 4FQLH 3V8CA 5L88L 4MWFA 4YNYB 4LCCC 1U8IA 4WUKL 2CO6B 2F19L 1UXWB 2QADC 1HHIB 2VLRA 1BMGA 4K94C 4XBGA 2MFNA 1WZKA 5D7IA 3JV4B 1OP5K 5HYFA 4HEPG 1KXTB 3LEYL 4Q9QL 5F44A 5FGRA 2ATKB 2PYEE 1I1YB 1PG7X 3PQYA 3E3QE 2Z35A 3DXAD 4MX7B 1R3LB 5DT1H 5K59F 2RFXA 3GSRA 3TNMB 5EU6D 1YYML 1MWAL 4LPXA 4NKMA 4LKCA 3QNYA 4OLEA 5KS9F 3L7EB 1B4JH 3SDCD 1EERB 1PJ9A 2K7PA 4ODWA 5C0IB 1BF8A 4GKNB 3U9PH 4HIJB 5JW4Q 2SEBA 4JO2L 2FYYB 1PD6A 1WTGT 4PGEB 2FATL 3QIUA 3QUMB 2EE9A 1D5MB 1KPUA 4DUVA 1CWVA 4JGUA 3T3ME 1EJ6A 1LE5B 1Q8MA 5EBWB 2A74B 4PV8B 1HXMA 4GW4B 5D72H 2DI8A 2WLZA 1FZOA 4PJDE 1WBXA 1JZ6A 2F74B 5DSCB 3P4OB 4JM2C 2EDBA 4UU9A 2PXYC 5GZOD 1LDPL 3MLSH 1BJ1H 1C7SA 4XNYL 1JFQL 2CIKB 2FJGB 3EJZD 4YDKH 1TJGL 3OAYH 1E4XH 3PABB 4RMWA 4XNXH 5C0EB 2YEZA 1LEGA 3DV4A 1HK6A 3OAZK 3V6OC 2Q8BL 4QGTA 3WIHH 3MRQB 5C71A 2CXGA 4RMRA 5IROA 2IANE 4HJGB 2AJUH 5I8EB 3TBTB 4KDVA 2A0LD 4FABL 2I5YH 1HCVA 1CFVL 3IFNL 4KTYA 3UPAA 4YBQD 4KTDL 2HTLD 4NM8L 3BHBA 1JYNA 4HHAA 3PNWA 5IWLC 4XPHH 2ZNXA 1ZLSH 4PRNA 4JHWH 1EEQA 5D7LB 2FSEA 1JL8A 5IB1A 3SDDC 3QO0A 1J8KA 2Q87A 3HI5L 1FFPB 3QYCA 1W8OA 1I9IL 2CR6A 1B2WH 1KN4H 2I26N 2H3NA 3NZHL 2GFBB 5IFHL 2CKBL 4G6FD 2OTWB 2H2SD 4QRQB 1CZ8L 3AB0C 1HI6B 5C0DB 5GIRB 5F8QC 1W2KT 4BH8A 4E41A 3MA7A 2Y06H 4OCMC 3V8OA 1DQLH 4OI8A 3QWQB 3LEXA 4MAYC 1QFUH 3O2WH 4F7MB 5B38A 1U91B 3QUXA 2EYSB 4OZ4A 3FB5A 3GMMB 4Y2OA 5DTFA 5LG1A 1N64H 4Y1AB 1F6FB 1MCIA 3VXSA 5LGJA 2B1HL 5KN5B 1WUNT 4L8DA 3FAWA 1IC5H 2CRMA 4LCUA 4G5ZH 3TT1L 4F15C 5I1AA 1JWUA 1DTUA 4JY6B 3JWNC 5ISZA 2C7UB 1BX2A 4LVEA 5LGHL 5A2FA 1H0DA 3QIBC 4PJ9C 4ZS7L 5EWIH 1G9MC 2F15A 2EDKA 2GT9A 3NH7L 4NUJB 1KC5L 4OLYL 3HG1E 1A7PL 3WJJA 2R2BB 1CI5A 3HRPA 3L3HA 5BXFB 4DQOL 3VG9B 1O7VA 5CGTA 5C09D 1BOYA 2FB4L 2PYED 4CVWA 3RIAK 4JJ5B 4XCEA 3BGFB 3FFCB 1HHHA 3C6LA 4HCRH 3BN9D 5HHPB 3RWJB 4K3EL 3SGKA 2BCKB 2OL3A 1PAMA 2G5BA 1J1PH 1M7IA 4N9GA 5ICZB 1MCLA 4GG6B 1IILE 5FA4B 1GZPB 4G80A 4N0RA 4P59H 5I19H 1WF5A 3DHMA 2EE2A 2VDOL 3FFDA 2FX9H 1QFWL 2AKRB 3WSQL 5GRZA 2BXZA 2JELL 1A6TA 3ZTNL 3OBAA 1R5VA 3TT3H 3V0VA 4G9FA 1NFKA 4PRPA 3KR3L 5MEOA 3BZEA 2W65A 2P8PB 3STZB 3WFDL 2YRPA 4I3GA 1T80A 1RJLA 4P2OD 1I7TA 3SGDH 4WJ5B 3V4VH 5E8DH 3VFUB 1OL0A 4Z7VB 1X5AA 4P3CL 2R0LL 5TFSL 1HQRA 4C55A 3KYNB 5KSAA 1W0WA 1JPFB 4XHQA 2IH3A 3HZMA 1A7NH 2CUIA 5FYJU 2A73A 3D39E 5ABDE 4C56A 1FC2D 5F7WC 3C60C 4FRWA 3CC5B 5BQ7A 1AHWC 3V4PH 3RHWF 4GAFB 3HFMH 4MNHB 3UP1A 1J1XH 2DTMH 5J06A 2QADD 4DKEH 3WFZA 1I8KA 3WS3B 5EO1B 4DEPB 1OWRM 4EDXB 4YPGA 3HAEB 5EC2B 2XKUA 5CJXC 3ZKMC 4KDTC 1KYOJ 5E5RB 1T20B 4HFWB 4K7PH 3VG0L 3VGGA 1DBAH 3MRPB 4NWTH 5C0BE 4YLQT 5B8CC 3ULUL 2VITB 3NPSC 5D71H 1AJ7H 5TF0A 1YEKH 2CLVA 2PNDA 3NN8B 4L3EE 1KG0B 2ESVB 3BWAA 3DHJA 1CK0L 2E9BA 1NEZB 4LSDA 5HY9A 4LEXL 1U8OA 4ZPTB 1NGYA 1AO7A 1RUAL 4M8QB 4FQHB 3GO1L 4JREB 4OCWH 4MQTB 1SBBA 4G6JH 4KKBD 1TIUA 1LO2L 2IGFH 3OF6A 2AV1B 4AT6B 1KIQA 5HPMA 1ETZA 4XPBH 3AC0A 2YMXL 3VFOA 3A6BH 3BRDA 2Y25A 4IHOB 1CFTA 1T0MB 1NCAL 1NAKH 4M61B 1GGIH 3X3FH 3QA3A 5KTEH 2VISA 4PJ7E 5D2LE 4U1IB 4R3SB 5HHVH 2XPGB 4N68A 3O11A 3HG1D 2EE6A 2HFEB 3GMRB 4HUKB 3BZFA 3FN9A 3QPXL 5D7JB 3FB7A 4K07A 4M6NH 1UACL 5AYUL 1BQLH 3W5NA 5J11C 5FM4A 4O9HH 1JHTB 1ZTXL 3H9SA 4MJ5B 1MRFH 3S35H 5CGYC 1MQKH 1CIDA 4YXLH 4EBQH 5HYQA 4KMQA 3MYJB 1PFCA 3VD3A 5A40E 3GMNB 3QJHA 3UTPE 2G5RA 2GY5A 4ZUUB 3DMMC 2W59A 1AQDA 4HK0A 5EUOB 2CLZB 1KPVA 3QI9C 3RPIA 3DX9B 4LQ1A 4LLDB 3PP4L 5DJDA 5CEZH 4QHUA 5T1KB 3THMH 4CMHC 3MRJB 4LF3A 5E2UL 2YPKB 5IVZA 2DBLL 1XH3B 1N6QH 4RBPH 1JGLH 1IFHL 2DQDL 5DZNA 3T65B 1JTPA 5C08A 1T2XA 2WBJC 1UKQA 3IDUA 4S1QH 4ZG1A 5I6XB 1I8LA 1B9ZA 2HLFC 1QSZA 4L4VB 4KZEH 2X41A 3NCCB 5LQBL 3PHQA 1FV1A 3D0VA 1UGNA 2WIMA 2W60B 1QVOA 5ANMB 4AH2B 3GBML 5IT2L 3VI4E 1ZWIA 2P7TA 2KZWA 4GMTL 3F12A 1EEZA 2QKIB 2FZ3A 4EOWL 4P0DA 1RJCA 4D9QD 3D39D 2BVPB 3QG6A 3BQUD 1XF3A 1LO3L 5C7XH 1OLLA 4ZXBB 4XC3H 3TH2T 1ZS8A 2YD7A 4NO2B 3VXOA 3FQWB 2X89D 3BP6B 2IADB 3E0GA 2VDQH 4TVPH 2P4AB 2IAMA 4PV9A 3I6GA 4ONHB 5IHZB 1O7SA 5JHLH 1L9NA 3EDEA 3S5LA 3MBEB 4KTEL 2AK1L 5C0BD 3HE6D 3I3DA 2DDQH 1DL7H 3K4ZA 5DURB 3DI3B 4QT5A 1S7WB 2FJFB 1NCWL 3PV6A 3MOAL 3B2UD 4L3ED 3WN5C 1GGCH 2P45B 5HSFA 5GJTH 1S7QA 3C5ZC 3RNQB 2NZ9D 1KTLA 5FECB 1R6VA 2YD3A 2JB5L 1DFBL 3G6JA 5HHQB 5IB2A 1Q0YL 3KYKL 3F7YA 4LVNB 1JV5B 1KB5B 1P9MC 4OLZL 1S7SA 4GQPH 3P0YL 1IEBB 1B0RB 5KSUA 4UIKH 3VWKA 5LWYH 3RGVA 4HBCL 2ZSVB 1YPZF 4QOKA 1L7TH 1NFIA 5CIPB 1TVBA 1T5WB 1RULL 4YHLH 4PJCE 5E8EB 3NPZB 4L8CB 2FDBP 3GSOA 5DLML 5E56A 3ZDZF 4C4KO 3G9VA 4IIQB 4DN4L 1CFSA 3CAFA 5GRUH 4FQ2H 1QSFB 1U2CA 3ABZA 1IKFL 9CGTA 5E9DE 3EFFB 4PB0H 3KNBA 5E1AA 3E6HA 5ESQB 3BPOB 5BV7L 4M03A 3C2AL 4OB5L 1K4DB 1U92A 3IT8D 2R4RH 4LU5L 2XXMB 4RX4A 2X42A 4YHPA 2NY3C 1A3LH 3AAZB 1BBDH 1YEFH 2VXQH 2XQBL 3MRLA 3G5ZB 1TTGA 3MR9A 3P77A 4FXKB 1NSNH 3MRMB 3BIBX 5CJOH 3RU8H 1RZ7H 3C87A 3BN3B 1LWRA 4LPTA 5KJRH 4XNQA 4PGJA 1XGYL 3BKML 1QFPA 4F37K 3QNXB 3U1SH 5GS0H 1WZLA 4OM0H 4PREB 3ZKMD 1TITA 1NUDA 3QO1A 4U1KA 4WUKH 1H3XA 2G75A 3PWJA 5I1CL 1AGDB 5DMIH 4JVPA 4RRPG 2GJ6E 1LE9B 1KV3A 2IG2L 3DVGA 4K2UL 2R1XA 3BRGC 2FH8A 1MCOH 2CQVA 4LLAA 3LEYH 1FNGA 3UTSA 1G7MB 1MJ8L 3NCYP 3QWOB 2X09A 1U3JA 3C8KB 2AV7A 4NQVA 2FH6A 5K9KB 3SCMA 2B4CL 1JPGA 2R23B 4OFPA 1S5HA 1B90A 5FYLE 3TV3L 1I9RL 3G04B 4NQDA 3ALPA 2VLLB 3RTQA 1RIVH 4F8TA 5ERWA 1YYMH 5M7QA 1X5HA 2NY2D 1J0JA 4MGXA 4HS6A 4YHNB 4I3SL 2QR0B 1MAKA 1LEIA 1IGYA 4ZS6C 4YPJA 5C9JA 3MGAA 5EIIA 2IQAB 4JO2H 1EFXA 5DQJA 1S7UA 5E5MB 4GLRH 2HJKB 4OKVB 4LDLB 4MA1C 3CVHL 3MC0A 3SQOL 5EG6C 2PW1B 3QXAA 1JHKL 2Q7YA 3UJIL 2HRLA 3WIIH 3OHXB 1A02N 25C8L 4I0PC 2JLLA 4OF5A 1LDPH 2IF7A 3MCKA 4KVCH 4XNYH 1JFQH 3DX7B 1TJGH 4ORGA 2ENYA 3L3KA 1KTKE 1YY8B 4I5BA 1E28B 2CPCA 4PJHB 5HHMA 1U8JA 4LSRH 4APQA 1EHLL 5J6GB 2Q8BH 2C5DC 3KPRB 4X6BA 3LB6D 3SO5A 1K3ZA 3HC3L 1CFQB 1IARB 4JFYB 4FABH 3T2QA 1CFVH 2V5RA 3IFNH 1KJ2L 2ITDA 4KTDH 4NM8H 4KHTL 5MEQA 1Q9KA 5FYJH 4U6HA 5KVEL 4MJIB 1BFOA 2ICES 5DJZA 2IQ9L 2YS4A 1OPGL 2VDKL 4FQXB 1BD2E 1NAML 4Q2ZA 4NIKB 4I18B 3HI5H 4MJ2A 5E6ID 4NBXB 3T2NL 1EA9C 1I9IH 2H26B 2YZ1A 4EKXA 3ZYJA 2XKSA 5E9DD 2CKBH 5IFHH 3BIKA 1CZ8H 3MRCA 4FQJL 1MI5E 4MJ4A 2AXGB 3FO1A 1D9KB 1BOGB 1VKXA 3DIFB 3QB7C 5IVOA 4UNUA 4L8SA 4BELD 2BVEA 3C08H 3VH8B 2IALA 1L6ZA 4XT1C 4PTUB 1RY7B 3TFKA 1ZT7B 3L5HA 4LKXB 2C1OA 4H1LH 1JZ5A 3V0AC 3DO7A 1FIGL 4U1LB 4EN3A 1QA9B 2EDHA 2UY7A 4I4WB 3MLVH 4WTWA 4N9OB 5L2KE 2NXYB 3TT1H 3MLPA 4GMSL 1T0PB 1L7IL 5SWSB 1PZUB 3OKOB 2HT4C 4Y5VB 3SEPA 5HVFB 3HAEG 3MV8B 1AI1L 4OTXL 4HGWB 2YXMA 4J8RB 4ZO6A 15C8L 1G6RH 2GJ6D 4ZS7H 3IJHB 3NH7H 3RWCA 1S9XB 2M2DA 1KC5H 4OLYH 1A7PH 3KXFA 3MODL 3TIEB 4DQOH 3BMWA 1CQYA 3HZKB 1KJMA 2FB4H 2ARJQ 1KIUA 1JPTL 1NEZG 5FYLD 4YFLF 3KPSA 4FTVE 5BMFL 4K3EH 2ZJSL 4OFYA 5IKCA 5DHYB 1JZ2A 4MQSB 4HXBL 4HX1B 4LIQL 1IQDA 4J1UA 3UTZA 1CE1L 3OAUL 1CLYL 3PWPE 2MSPA 5JIPA 5ID0A 4PRID 1CTNA 5F96L 5EU4B 1T7XA 4KRPD 2PO6D 4JHBA 1G7JB 3IGAA 1NKOA 4NN6C 4A6YL 1FLRL 1T6WA 4Z7QE 1MUJB 3IDYC 2VDOH 1QO3B 4MNQE 1HH6B 3WSQH 1EPFA 5EZJA 3CZJA 3ZTNH 1MEXL 5IB5B 4JPVH 4QXTB 4TUJB 4TRPH 1NGZB 3K74B 1A7QL 5F1KC 3CUPA 4RFOL 5DEFA 1QFWI 1EAJA 1EXUB 4YX2L 3BKCL 4IRJD 3WFDH 4C59B 3VD4A 3P4NA 4Y5XB 4N1EA 1DQML 4HKJA 4QTHB 8FABA 2ED9A 2J88L 4NWUH 1NLBH 2R0LH 1J0KA 5TFSH 2Z93B 1ZT4A 3LSOB 3PP3K 4GXVL 4P5TC 1Q1JL 2EKSA 3HUJA 4KROD 3FMGL 4XTRC 5BO1L 5T1MB 1LP9A 3WDJA 2AI0H 4U4BA 4KH2A 1CXIA 5CILL 2V17L 3HE7C 4MS8A 2ADIB 4ZNCD 4D9RD 1B0WA 2AEQH 2NNAA 3VFTA 5DEZA 3I3BA 3MJ9H 4H88H 1ZHBB 4MA8H 4LASH 1AP2A 2VRAA 1H5BB 1T83C 2CO7B 1FO0A 3FHQA 5C0ND 3RX7A 5KS9E 1SEBA 2VLME 5JZ7C 2UWEA 1T04B 4YEFA 1O0VA 3ULUH 4NCC1 4JHZA 3HI6H 1IRAY 1MI5D 1T4KB 2A6IB 5KG9A 1RZGA 4M1GH 1QTYT 1A4JA 3V6ZB 3H3KA 2PCPB 2ADFH 3GMPB 1CK0H 3HNSL 5MENA 1FJ1B 4D8PA 3TO4B 5IG7A 1BQHB 1PKQB 4LEXH 3H9ZA 1RUAH 3MO1B 1ACYL 1MPAH 3TVMD 2X4QB 3GSNB 4GBXA 2VABA 1WSST 3ARBA 5L2KD 1I9JL 2YMXH 1FZKB 1FQ9C 3O9WB 5T5FL 5DJYB 1SBSH 5SWZA 5MEPA 1NCAH 3DX6B 4GKOA 1I8IA 2AK4E 2FO4A 4XI5D 3TF7C 3JVGC 2BNRE 5D1ZB 4JY4B 3AREA 3KYOB 2IBBA 3NFPB 4JHAH 4R7NA 1KGCE 3JV5A 5C8JA 3QPXH 2ENSA 5HYJE 3QDGA 4ELKB 1UACH 3MFFB 4F7PB 3ARUA 4KUCF 1MFBL 3KG5A 3VXPA 4LRNL 2VUOA 5JA8B 2AQ1A 3PJSA 2X9XA 4P23B 4FTVD 1EEUA 1ZTXH 4H26B 3BESR 5SWQB 1MCCA 1SQ2N 5CUSH 3T0EE 5F1NA 2BSTB 4YZFF 4JKMA 4XXDB 1BJ1J 3PWPD 1XGPB 4EEEA 5DUMH 2E7LA 3ILPB 1FFRA 4RWHA 4YXHL 5E2UH 3KVQA 1FL3B 3G6AB 2W0LA 1IFHH 2DQDH 4MNQD 4NM4L 3HB3C 4MJ6A 2BNQB 4RNRB 5E8PB 5EO9B 2DQCH 4FXGB 5EFIB 2YXFA 3S6CA 3WFBH 2Y07L 3KYMA 5B4MD 3VFMB 3UTOA 1MRCL 3B6SB 4JCLA 4LGPB 4JLRB 5LQBH 2Y5TB 5C07E 5TGBA 4P5KB 2JJTC 1AGFB 4XVTL 4O2EB 3GBMH 1DUZB 5IT2H 4DOHE 4D0DB 3H3BC 4TYUA 1OD9A 5DO2D 5GS2D 2QQNL 4OZFH 4OD3L 2VUYA 4KK8D 3T4AB 4EOWH 3UMTA 4G8GE 3I6KB 2X4PB 4OD2A 3LN4A 3ILQC 2G2RA 1LO3H 3GRWA 1A5FL 1CDGA 2EDDA 1YJDC 2R15A 2P5WE 2HMIC 1KN2L 4HUUA 1FVDB 1DANU 5F89A 4YXKL 4P46D 1YMMA 3BYYA 2OTUB 4P2RE 1I4FA 5J3HD 4PRHA 5EBLA 1D6VL 3VDAA 4KTEH 1IM9D 2VLMD 4ZPVA 3GSWA 3CCHA 1CIUA 3OSKA 3PWVA 3SKOA 1A6UL 1UWXH 3NBNA 2ADGB 2DI9A 4PLJC 5J7CC 4CAGA 1P69B 4F7CB 1GYAA 4P4KB 5JHDE 3L95B 1U8QA 1U8HA 2H9GB 2JB5H 1DFBH 4XNMA 4WFFE 5D1QA 3UBXA 1Q0YH 4QRPE 4NO3A 1I3GL 5JW4R 4OLZH 2YUZA 3CFDB 2AJXL 1FYTE 5EU6A 2XZQL 12E8L 2W9LA 4XP1H 1LILA 1TZIB 1I85C 2PYFA 3P0YH 4ZAKB 1WWWX 2WLYA 4ZTOL 2ZUYA 2AK4D 5F1SA 1ZMYA 3VD7A 1MFAL 2BNRD 3HHRB 4N0UA 1RULH 3JWOC 1Y0LA 1QPPA 3NA4A 4F7TA 1WBZA 1WFNA 2ZG1A 1G7HB 1LD9B 3GJFH 3WXWL 1FG2B 3ULUC 4JN2B 5HYJD 5AG9A 3GMOB 2EH7H 3QQ3A 4DN4H 4XVJL 5HDQH 2WWKO 3O8XA 3BAEL 5E7FA 3NFSH 5HGBA 4NUGL 1J5OH 4Q9RL 1IKFH 4KJPD 4P5TD 4H1LB 1OT1A 1OP9A 3T0ED 3C2AH 4KUZL 4LP4A 2D9CA 2UYLB 2MCPL 4HF5L 3B9EA 3IRPX 2XQBH 1Z9OA 2PR4L 4ALAL 3BKYL 4PUBL 4WV1B 3OL2A 4ZQKA 2HRPL 4N5EC 5J1AA 4X5WB 1Q9OB 2VLKB 1XGYH 1XGQA 2X4RA 3BKMH 3Q2CA 1JBJA 2FRGP 4UDTA 4WY7L 5HGHA 4F33B 4NNYB 3RKPA 2FL5B 5FDWB 3RNKB 5I1CH 4ZFOA 1YN7B 1JGEA 3HI1B 5DK2A 3AMLA 4Y16D 1I3RB 5C07D 2IG2H 3N1GC 4K2UH 1MVUB 3ZE0F 1N2RA 2J4WL 5EDXA 3RHWK 3UPRB 3V7AG 1OAQL 1MJ8H 2WIIA 3CPLB 1A1NB 5T5NF 5D1XA 1CLZL 3IVKA 4ZOCA 32C2A 3WUWG 4MB3A 1MNUH 2B4CH 3GJEA 4Y4FC 4M48L 4ZOBA 1I9RH 4AYFA 3K1DA 3PG2A 1C08A 1CD8A 5I1HL 4FN0A 4NQUA 1T0NA 1BZ9A 4MCYB 4ODXA 4X0KB 3SDAA 1B88A 1SMAA 5DJ2B 5D9SB 3B83A 4UAOB 1XT5A 3MV7B 4ZUTB 4Z76B 2BJML 3O6FD 4HWUA 3DUUB 4MNGB 2ZNWA 1BBJB 1P7QB 4KI5C 5TE6H 3SQOH 4Q7DA 1JHKH 3UJIH 3U6RB 2CLRB 5TE7H 1YEHH 1HDMA 1OLZA 2B20A 4CKVX 5I1LA 1TCRB 2O93L 2NX5B 4HKBB 1IE5A 2E6JA 4K7PX 4UT9L 2QHRH 4HZLA 5LGKA 4WFFD 3BGFC 5CMAA 2PYEA 1NBZA 1OAKL 2X7LA 3NACH 4NJAL 4QRPD 3E3QA 5TDNA 1INQA 1Y18B 3JTTA 3P9MA 1IJ9A 1OVZA 2A6DA 2DL2A 3OG4B 3PL6D 4Y4HB 4JM4L 1EEYB 1FYTD 1ACZA 2NZIA 1FVEB 2UY6A 3T2OA 3LS4H 4XP5L 2D31B 4JZOA 4XBPB 1OAXL 1Y6KR 3CDGA 2LTQC 3HB3D 1XF2B 4UV7L 4QWWD 3MOBL 2BVOA 1RJYB 4GKSA 4CW1B 1FNAA 2XN9B 1KJ2H 3MCLL 4KHTH 3ARGB 1PDKA 3M8OL 1U3HC 1XGUB 2ZOKA 5KVEH 3MREB 1BVLA 3TH4T 5D7LE 2BY3A 3QDMA 3EO0A 1OPGH 2VDKH 3SE3A 2V7HB 1P4BL 5D6CB 3BW9B 3LY6A 3OXSA 5D93C 5I0DA 4UNVA 3VFPB 3VWJD 1NAMH 4PJDA 2VLJB 3ZHDA 1PZ5A 3MBXL 1KXVC 3CZFA 1E27B 1QG3A 4YDJA 4XMLL 1YMHB 1KACB 3H9HA 3O3DA 5DD3L 1K2DA 5EU5A 2ZCLL 3QUYB 2DYPB 4PBVC 3BIAX 4PIRF 3BO8B 4P2OA 1K4CA 1HSBB 4G6AC 4JPIA 3MV01 1QBBA 2VC2L 4FA8A 3QHFH 5INDB 5T1DH 1G7LB 4Y1AE 1WIPA 2YZ8A 4WHDA 2F54B 3WFCL 1QHOA 4UDUA 5E2WH 1GGBL 1CGUA 2IANA 3LAFA 1A0QL 1FIGH 4HV8A 1FH5L 5T5NG 5E2TH 3FO2B 5T3ZH 1FL6B 4LCCA 4GMSH 1S7TA 3CFKB 1NANI 5BZDA 3D85B 2YD8A 4OCSL 3IXAB 1AI1H 4OTXH 1UVQA 5DA4A 2GAZA 3HNVL 2X2YA 4WI6A 2GHWB 1JHLL 1RMFL 4Y19B 2MOVA 4PP2B 3RAJL 3TWCL 1UA6H 3ES6B 2AJYL 2XFXA 1WLHA 3MODH 4NQCA 5GRJH 4HG4J 5BV7C 3FFCE 4EIGB 1JPTH 3BEWA 1EH9A 3KJ4C 4S0UC 1JF1B 3EOAB 5BMFH 2M8XA 3V79C 3ZDZE 3S96B 2ZJSH 4IBLT 3BJ91 5IMOA 4NQEB 5ADPL 4LCYB 4D3CL 4HXBH 4P2YA 1DBBL 4JREC 4LIQH 5GGTH 1X5JA 1DLFH 2Y9RT 2APWA 3T4YA 4GG6E 2NMSA 3PWNA 4UV4L 3OKNA 5GZNC 1K6QH 5F96H 1ADQA 1DDHB 4PRAA 1AR1D 3S3SA 2DQEL 4A6YH 1FLRH 2VIRB 3TNNB 4JY5L 5JPMA 4WU5B 1I1AB 1MLBB 1NPUA 4S11A 3B5HA 4HKZA 2Y6SD 1DBJL 4JM2A 4WIQA 2PXYA 3IU4L 4F7EB 1A7QH 1XF5B 2EZ0C 3W0WB 4RFOH 1WT5C 2DQUH 1MJJA 3HA0A 3MROA 4AQOA 4YX2H 3NCBB 4YDLC 1ZHNA 1OAZH 5C0GB 2QEJA 4Z7VE 3MZGB 3RL1B 3FO0L 3REVA 1SYVA 2J88H 6FABL 3OGCB 1CLCA 5E7BA 3V6OA 1F58L 4R7DA 5C0CA 2JIXA 5FAAA 4KJYB 4YHKH 1Q1JH 1DE4B 2P5EA 1F4YL 2XRAH 1IGTB 2OI9B 1XZ0B 2F9BT 4P3DA 5J1SC 1IAIH 3O6LL 1DSFH 4X7FC 3DUSA 2V17H 1J12A 1D3CA 4HGKC 3B5TA 2OJZL 3RZCB 4U6XA 3ZLQC 3G5YB 3TJEL 1YDPA 1B0GB 5IWLA 1QLEL 2Z4QA 3X14B 2NQCA 5EUKB 4C58B 4GOSA 4UIMA 5I6XC 5HD8C 1CE6B 4XB8A 2IC2A 3VFWA 4LRIC 4ZNEE 1YZZA 4L3AA 1QLRA 3GSQA 2ESVE 4DCQB 5DMYA 1S9YB 1BGXH 3C5SB 4JPWH 1ED3A 2VQ1B 1K8IA 4G8EB 4MAYA 5DRNA 4E9LA 3HNSH 4ZD3H 1GOGA 2VWEC 1KBGL 1MIML 3SKNA 2I9TA 3SPVB 1HHJA 5DMGD 5DHXB 3S36X 4YHYB 3GSUB 2R4SL 4O51B 1ZANL 1ACYH 4YHIB 5TF1L 4YC2B 4BH7B 4HUVB 1I9JH 1M1SA 5F7EL 5T5FH 3PXJA 4QXGL 4MDIA 2ATPB 4M5YL 4U0RB 2Y7QA 1WAAA 2Z8RA 3QIBA 4PJ9A 2MHAA 5CP7B 3CFJA 5IOPA 2VE6A 5E0QA 3MBEC 1EO8L 4LLVB 5T1LB 1QRNB 3WNLA 1JZ7A 3EHBD 1CT8B 5C0BA 2FR4B 3V6FA 1Z3GL 2XWJA 3FFCD 2HH0L 1A2YA 2D3VA 4LRNH 1TPXB 3A0OA 5CCKH 4WCYL 1OGTA 3L1OL 5IK3A 3T8XA 3GGWB 5EUOE 1X5FA 3MUGA 1U95B 1FZJA 3OXRA 3U4BL 4OBRA 2ZUTA 4WW1B 3DRQA 2A83A 4CBPA 2AXJA 1KCLA 4M6ML 1C12A 1S9WB 1OD7A 4YXHH 2AAVA 5E94B 2X10A 4DGYL 5AUMB 4JRYD 3QEQB 4NM4H 3ARFC 2DAVA 3P4MB 4X9GA 4PGDB 1WIOA 1ZV5A 35C8H 4L4VE 4UZGA 1CL7H 2Y07H 4M1CC 5D2LA 3LKNA 5ESVB 4WEMB 1S3KH 4JKLA 1FSKB 4XB7A 1FPTL 1CDJA 4IIQC 4IMLA 5ANME 3MRGB 4XVTH 4H1LG 5AWNH 4DKFL 4GS7B 3PGDA 5GPRA 2X1PA 3BPOC 5I16B 2QQNH 4GAYA 3GI9L 4KKCC 5HBBA 1A7OL 1I1RA 2YA1A 3TYGL 2BRRL 3LKPB 3VGBA 5E99L 3UTTB 2VDRL 3C60A 1AHWA 1A5FH 3RWFB 4J3WA 1SJHA 2R2EB 1YEIL 4PGZA 4TNWF 1KIPB 3N50A 1S7XA 1JGVL 5CFHA 1A7BA 3E8UH 5FHAL 4Z9KB 1X4YA 1CDIA 1MHHB 4OBSA 4KMTL 4N0CD 4AENB 4YXKH 3FAXA 3ZTJH 1OAYL 3WNNA 5CJXA 2Z92B 4I48B 4X9IA 2F58L 5FKPB 5B8CA 2MQ3A 5I73B 4OIIL 3I9GL 1RZJC 1UZ6F 2X5PA 1I7UA 5F9WB 2DQTH 1RZ8A 2ESVD 4NOFA 3V9FA 1FL5B 3PF2A 5C3LD 1MCHA 1MOEA 1EHXA 2D7QA 1FFQA 4D0BA 2H41A 4W6WB 1N8ZA 3GIVA 2H8PB 1KTDB 4X4ME 3F5WA 3L7FB 4G9DA 4TQEL 1MAMH 3MLUL 5FOBA 3ZYOA 4ZOEA 5DVMA 3B9KB 4HMDA 1R3HB 4P9ML 4WWKB 2Q6WB 3KLHD 3O0RL 4ELMA 1CN4A 1JRHL 2AJXH 4F58H 5IVNA 3DX8A 4I2XB 4QY8B 12E8H 5CKGA 2OM5A 1J05A 3ET9F 3BPLB 2R1WA 1ONQB 4CJ0A 1REIA 1ZT1A 3HCVA 4XPFL 4ZTOH 1KB9J 3HC0B 3L5WB 3ESUF 1FCCA 1MFAH 4KI1A 1M05B 3OAYK 2ZUSA 3DUHA 4WI3A 5D7JD 3WLBA 1A7RL 4PJEB 4BSWB 1IGIL 5F7LB 4HDIA 3JUZA 2APBA 1KTRL 1QSFE 1TXKA 3IDJB 4XVJH 3JWDC 1VERA 3QXVA 2C1PB 3BAEH 4RCAA 2OTPA 5FXCH 4Q9RH 1R5WB 5JORB 1Z9SA 1TTFA 4WUUB 1J8HB 3X11B 4HLJA 3ROLB 2EECA 2R2CA 1KLGB 4KUZH 1OT2A 1GGTA 1XIWB 2MCPH 4HF5H 4M62L 3W9EA 1UM6L 3DMMA 3OGOE 3QI9A 5GHWL 2GSIA 4MD0A 4ALAH 2I25N 3BKYH 1GC1C 5EU7C 1A64A 3U36B 2YD1A 4YBLB 5FO9B 1NC4A 3UDWC 4X6DA 1QR1A 2QQLH 4G8FA 3HR5B 5IFJA 1W0YT 4X9FA 3BP4A 2R2HB 4OV5A 4XCNA 4L4VD 1OAUL 4PJCA 4LGRB 2YWYA 4RGNB 2KUTA 5HTSA 2B2XH 1R3IL 2YUXA 5ITFB 3SGEH 3GDBA 3IJSB 5JW5B 2CDEA 4PR5B 4I18C 3TA3B 4WGWB 5DDHB 2D4FA 4K7PY 4WFED 5BVJB 5CWSB 1EJOL 1OAQH 5E9DA 5IFAH 1Q94B 2V2WA 2X1OA 3KLAA 1CLZH 3DXAB 3MRBA 4TUOA 1D9KC 2ERJC 5BZWA 3VD9A 3B4NA 4ZXBD 1VACA 1EUUA 4M48H 5CLTA 1BIIA 1IL1B 3TIDA 3MNVB 2VDLL 2LVCA 3LQAH 5K9JL 3AM8C 3IXTA 2VXUL 3D0LB 5SV4A 1YUHB 3N1MC 5F7DA 3OKMA 4KPHH 5EPMB 3VFNB 2BJMH 3P9LB 4YZFE 2VXTH 1QD0A 5DURD 1H15A 1RK1A 4EDWL 1T22B 1JMZA 4FP8H 5A3IC 2ZCHL 1P2CA 2GJ6A 4NC2B 3RY5A 5KSBA 2DM4A 3WN5A 2HYMA 3RL2A 5A2IH 3AFLA 3T77B 3QZWG 3BRFA 2GTWB 2AEWA 3ULSA 1QLFB 4UT9H 1OCWL 4PJHE 4NFDA 5JR1H 4S1SL 2R1YB 4IRSC 4KJWC 1OAKH 3GK8H 4NJAH 5EU7E 3KPRE 1M7DA 2HFFB 4JM4H 3UZVB 1X4XA 1VEPA 2AQ2A 1AXSA 4I13B 3RJQB 3VCLB 5I9QB 4OFIA 1P1ZB 3DV6A 1OAXH 4UV7H 3MOBH 1BFVL 5DJ0A 1MCBA 4MJIE 4NGHH 3MCLH 4E42B 5DRZB 3VXNB 2PO6A 5IGXL 4W6YB 4LLUA 1VFBA 2VXVH 3EJYD 3HPJA 1OWWA 1P4BH 2VL5B 4OZFG 3CSGA 3TBVA 4WRLA 3LKRA 3KPNA 3MBXH 3V7AE 4XMLH 4EVNB 2FJHB 3HZVA 1I7ZA 4BQBA 3EOBB 2IPUG 4U1JB 3ME0A 2ZCLH 4IRJA 1A1OB 3BZ4B 3QFJA 4LMQE 3OJDA 3DLQR 2J3SA 4HIIA 3QDJE 3BP5B 3L3IA 4PRDA 5FKAA 2DM3A 1K8DA 1JVKA 3WFCH 2VLRB 2CMRL 2OSLA 1GGBH 4XBGB 1EMTL 2ICEA 5DVLA 4LOUD 4ODHL 2RAMA 5D7IB 1A0QH 2E7MA 2VH5H 3JTCA 1FH5H 3H7LA 1HIML 5FYKL 5SWSE 2FEDD 1GHFH 3MRHB 4Z7WB 2W91A 3MV8E 5EULV 4Z0XA 1OSPH 1H5BC 3TPUA 4XC1L 3PQYB 2E5EA 1DBML 2NY5L 3QWRD 4R26L 1ZOXA 3HNVH 2Z35B 4PJ5B 5GGVY 3GSRB 1BD2A 1JHLH 4Y8AA 4UQ3B 2W0KA 3RAJH 4LKCB 3TWCH 5HI5D 3QNYB 5INCA 5C09B 2LAGB 1F4AA 3A6CL 3HRZA 3ROOA 4ODWB 1MI5A 2ED8A 2MPAH 2LAAA 4DAGL 2CDGA 2SEBB 1VEMA 3REWA 5IBUB 3MRKA 3QIUB 3TO4C 1M71A 4OCLC 5ACZA 3GRWL 1UWEH 1IGJA 5ADPH 1DUYA 1HXMB 1DBBH 4KUCD 2VZVA 3Q5TA 4Z5RA 1MCFA 3KDMB 1FZOB 1WBXB 4Y2DC 1O5DT 2AJZB 4UU9B 5EIVA 4LCIH 4G6KL 3QQ4A 3SY0A 5DUPL 1FCGA 2GK2A 2VQTA 5LCVH 3O9WC 5HVHC 2PW2A 43C9A 3LKOA 1X6LA 1JYXA 1LHZA 4LGSB 1HYSC 3OKLB 3NGBB 2HKHL 4YHML 4WDIB 1FNLA 4O58L 3DV4B 4WI7A 5EBMA 2GJZB 4I0PA 1N3NA 2A77L 4QHMA 4H25B 4XCYA 1FFOA 4QHKI 2NTSP 1G7PA 1B6UA 4ETQA 3JBG7 1MCDA 5GRXG 3VXQB 1DQDL 1JPSL 3AXLA 4OQ1A 5FK9A 5TDPA 3FO0H 3WL9A 5LBSL 1HOCA 1XR8A 4O02H 4RBPK 2DQHL 4ZFGL 3FB6A 1JGDA 4U05A 4N8VG 1DLHB 2XZAL 5GGSA 4PJEF 2R0ZL 4PRNB 2AQ3A 3WD5H 2FSEB 3QH3A 4OLWL 2FHBA 3UAJC 4XMPL 1OTSC 4N0YL 3RUGB 4MJID 2H3NB 5BOZG 4M7KL 2W07A 5EC1B 1TLKA 3TJEH 4FQXD 3SBWC 4BH8B 4HUMB 4DVRL 4HWZB 4L9LB 1QLEH 3MA7B 3PHOA 3LEXB 5B38B 2BHZA 4X98B 1U8PB 2BSED 4OZ4B 3FB5B 4HIHA 4OCRL 4RAVA 3VXSB 1PW3A 5EH1A 3C5JB 2IPTH 5A2KH 3FONA 4LCUB 5C0RL 1Q72L 4G43B 5IIEB 2BVQB 5I1DB 2DLIA 1PKQE 1JWUB 3P11L 1EHAA 1KBGH 2Z8VC 4HIXH 5IM7A 3N1QC 2XV6B 1NLDL 3BXNA 4PPTA 4XWOC 2NXYD 5TF1H 4ENEC 4HC1A 2QTEA 5SWSD 2WNGA 2H6PB 5F7EH 3MV8D 4HPOL 3B3IA 3PWUA 4ZFOL 3BX7C 1HHHB 2VJXA 1CXFA 3S4SB 4PDCE 4P46A 2L0DA 3ZDYF 1EO8H 4P57B 4YO0A 1X4ZA 2OL3B 4UI2A 5IVXB 4M00A 4N0FA 5DRWB 4W81A 1W72B 2VMFA 1Z3GH 4MXQD 4NSKB 4QHLA 1TZHB 3SE4A 3WBDA 5CEZD 4YR6B 3MNWA 5IBTL 2HH0H 4JFEA 4XNZB 1LNUA 2HJFA 2OR9L 4G80B 5GGQH 3VXMA 1TNNA 3ZYIA 4WCYH 1JF6A 4K9EL 3UC0L 4PTTA 5DUBA 3FFDB 3SDXB 4IEFB 5F7YC 4UUJB 4AMKL 4HXAL 1A6TB 4RZCA 4HIEA 3V0VB 3U4BH 5CSBA 4BUHA 4FG6D 1CICD 4PRPB 1SJXA 3FHAA 2W65B 4M6MH 2OCFD 2P43B 3QNZA 5JXAL 2XWBA 3D69B 2BNQE 4DGYH 5IESL 1I7TB 4PJBB 2A6JA 3FQXB 2HT2C 2WP3T 4WFHD 4RAUA 2NR6D 4X4XA 1W0WB 3TBYA 3I02A 3VXTA 1AGBA 2DM7A 5B39A 3MLWL 3KPOA 4C56B 1IQWL 1C1EL 3P73A 5F3BA 3PUCA 3U4EB 5HYJA 3P0VL 4LEOA 2O5ZL 5BQ7B 3WLWC 5DRXA 4RFNB 4YWGH 5H37H 3ETBF 4P5TA 1I8KB 1MWAA 2P46B 1A7OH 5TQ0L 5B3JE 3TYGH 2BRRH 5EO0B 4YPGB 1M4KA 1R3JA 4FFWC 5E99H 2VDRH 2W9DL 2D9QB 3HE7A 3S37L 1YEIH 1JGVH 3FQUB 2HJLB 3MRNA 3MYZA 4FOMA 5FHAH 1T83A 3BWAB 1IGFH 2X4NB 1OAYH 1T7WA 5DFTA 4BM7A 4YFDB 2F58H 1ZK9A 4LARL 4UBDC 4OM1L 4X6CA 1NGYB 1AO7B 4ODUA 1DVFC 3I9GH 3QXDA 4OIIH 2X4SA 3TZVC 5CD5C 1OGAA 5DVOA 4FFVC 1U8KA 1XFPA 5C07A 5D7IF 1KIQB 2AXFA 5LJYH 5L9DL 1ETZB 3GEWB 5JIHA 3TO4D 1VEOA 1IZJA 1DN0A 4LSPL 1U8LA 2CR3A 1XGRA 4Z7WF 3UZQA 4GH7B 1OQXA 4WO4C 5FYJE 3QA3B 4TQEH 3MLUH 4G8GA 1ES0B 5GRWA 3MV9D 2VISB 1NFDE 2DQIL 2OMNA 3E1F1 4P9MH 2YN3A 5A1AA 3O0RH 3O11B 3O9WD 1JRHH 1C5BL 1FGNL 3VGEA 4CNIA 1TFHA 3KPPA 1ZHKA 3BZFB 2P5WA 2RQ8A 3IDMA 2WUBL 1IC7H 4KC3B 3BT2L 4OFKA 4Y7MA 2WQRA 3QUKA 4WWID 4XPFH 4UAOC 5D1ZD 4HH9B 5F9DC 2YD4A 3RA7L 4EI5B 3TF7A 3JVGA 4DKAA 3H9SB 4P2RA 5HYQB 2I60L 3ZKNC 3KWWA 4HUXA 1EZVY 5IB3A 1WIUA 1D7FA 4IOFD 1YEJL 3VFVA 4HK0B 1KPVB 4GRWH 4ZUSA 4P23D 3M07A 3H2WA 5DJDB 1G9NH 4AZ8A 4Z95L 1HHGB 5JHDA 5IVZB 5GS0D 4NQTA 2R8SL 3BUYA 4M62H 4LHUB 4YIQA 3O2DL 4Y4HC 3DGGA 1KIRB 1GAFL 1ADQL 1BJMA 4UB0L 4X83A 3WKNA 2VLKE 3OTTA 2CIIB 4QF1A 1ZGLM 2GJJA 1U9KA 1NBVL 4L4JA 3PHQB 4LVOB 1FV1B 5J1TC 2BNQD 1QVOB 5FF6A 4NN5C 1MY5A 1OTUC 5J6HB 5I1JH 2P7TB 4HKXA 4G8IA 2CGRL 3ARGC 4JVUA 4WVRA 3F12B 2ICCA 4K8RH 1OAUH 2FZ3B 1GPOL 2ADJB 4U1NA 1R3IH 3UEZA 4RFEA 5DS8B 4E0RA 5LXGH 2DIJA 1R3KA 3RVWC 2JJTA 3D18B 3QEGL 3IAQA 3EYVA 3T1FA 3QHZH 3RUGF 5EORH 5JUEL 3SCMC 1ZHLA 3MTRA 1OP3K 5MI0C 7FABL 4HAGA 3QUYC 3G5XB 3JV6B 5MERA 3GSVB 4NRZB 2IAMB 4PV9B 2D2OA 1CQKA 3TBSB 4ENED 4LSVL 3S5LB 1G7IA 2B7DT 3W39A 1NDMB 2VDLH 1TJIL 4X7CC 4YEEA 4QT5B 3MV7E 3IJYA 1UZ8A 5HGAB 3PV6B 4U1MB 4IMKC 4MNGE 5DJ6A 3BZDA 1S78C 4KHXL 1FO0H 1IEHA 3AS3A 4YNYA 5ACLA 1WBYB 2J6EA 1UXWA 5D5MA 1EGJL 2X9WA 4Y4KC 1HHIA 3G6JB 1KJVB 1JWSB 4NQSB 2NX5E 4P4KD 2ICWB 1S7SB 5ADOL 2GQHA 3NAAH 1DBKL 4LPCA 5DQDL 4AIXA 3VWKB 3RGVB 3B5GA 4APQC 1I1YA 4TTDC 3TP4A 5FYJD 1TVBB 4L4TE 5D8JL 3FQRA 2AJSH 4FMKA 4MX7A 2C3HA 4S1SH 4J4PC 1E4JA 3SGJC 3TNMA 1SJVA 5IEHA 1CBVH 5FV2A 5B21A 3L7EA 3GSOB 4ZAKD 1I85A 2DIAA 3NIFF 2NY4D 5C0IA 1ND0B 4Z77A 2XN9E 5BRZA 4B5EA 4BYHA 1BFVH 4HEME 4K23L 4WEUD 1T3FB 2FYYA 5FA3B 2L7UA 3QUMA 3QUZC 4YE4H 3KNBB 3E6HB 5IGXH 3E2HC 1LE5A 5EBWA 5F72S 3VMPA 3LCYA 5E6IB 2VLJE 4YHPB 2F74A 3D87B 3P4OA 5DSCA 5AD0B 1RU9L 2F53B 4OZIE 2CIKA 3P77