5B38A

Kir3dl1*005 in complex with hla-b*57:01
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Killer cell immunoglobulin-like receptor 3DL1 polymorphism defines distinct hierarchies of HLA class I recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b38A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5b38A01
1MCJA 3D1MC 4ZAKA 4YHMH 4G9FB 5EOCJ 4U6HA 4PJAA 1P4IH 1IL1B 4PJ8C 1IKNC 4WFFE 3VFSB 5HYFA 3CC5A 2JJTC 2ICEA 2BSED 3GNMH 3HN3A 3OZ9H 1YDPB 3EYVB 1HE7A 1WCQA 4M6AA 5CLTA 3LKSA 3O8XB 3PWVB 4U1KA 1TQCB 4OKVA 1I7RB 1L0QA 1BP3B 4I0KA 2J12B 1WWBX 5ITFB 5K9KA 5I66A 3MNZB 4DFIA 4FQHA 1TZHB 4APQA 5HDQH 2YK1H 5K33A 5EUKB 3RP1A 1CD0A 3DGGB 3UAJC 4PS4L 2Q3AA 1RFDH 2GITA 4OCSH 1HZHH 3ZYJA 1ZEAL 1TCRB 3O3DA 1OP3H 4WUUA 1LNUB 5ISZA 4AIXA 1I9IL 3RUGA 4YEEA 2F19H 4NQDD 5IKCA 1KCRH 1EDQA 1XGPB 4YHOL 2G2RA 5DSCA 1IGIH 2CXKA 4U1SB 2J1KA 3QDMA 4IDLA 4S1QH 2OJEB 3HPJA 4PJXF 4BQCA 3QBTB 2C3WA 1LK3L 3LPFA 3LH2H 4P2OC 4RGNB 1JZ6A 5M94B 4MX7A 5D2NE 4WHDA 1ZA6A 2NX5A 1VADB 2V2XA 4TNWK 1PD6A 2MCPH 4G8FB 5LXGH 4IM8A 1JFQL 3V52L 2ITDB 5HYQA 2GEEA 4YIQA 4NWTH 4BH8B 1X3DA 3LRHA 1KPRB 4TOYL 1BWWA 5FM5M 5IB1A 5DS8B 3PWJB 4MAUH 2XNAB 2Z91B 5JIHA 1MHPL 1TTFA 3ME0A 3FFCB 5E8NA 3QJFA 3G6DL 1MRFH 1Q9LB 1CR9H 1ED3A 1KEGL 3MRCB 3MJ9L 5JPMA 3PV6A 5FGCE 2HH0H 3D39A 5IW1A 3P4OB 1FC2D 2H9GB 2F53D 3QQ4B 4RSVA 2I26N 2NXYB 5CILH 4NUJA 4M8QA 5I1HL 1D5BB 5DRZA 4BUHA 1BX2B 1U58B 1S78D 5EIVA 1GOFA 2IALB 3WKML 4DFHA 4KZEL 1IC7L 4LOUD 2EYSB 1UXSB 4EI6B 1NAKL 4KHTH 2AJZB 1RZ7L 2IPUK 4WWKA 3QEQE 1E6OH 4BK4A 4RISL 4LSDA 3QO1B 5CJXA 1GC1L 1X4ZA 3VFWA 1S5HB 1Z5LB 5DD5H 3ZYZA 1QSFA 2IFFL 3E8UH 3JTTA 1LO4L 1VKXA 4P48A 5FF6A 4UT7L 4EDXA 1I3RB 2G60H 4ZFGH 4XNUL 3SQOH 1A7BA 4X5XA 5LQBH 1XIWD 3NCMA 4FFYH 4OZIE 1KJVA 1QFWM 5I6XB 2VXTH 4WW1B 4AQOA 1NCWL 3GB7A 1JV5B 4MA1C 4LSRH 2FEEL 5BJTA 1MVUB 1MCQA 3H9ZA 2ED9A 5I1EH 2XWBA 4KV5F 4X6CB 3MA9H 4JHAH 1J8HE 1YZZA 3BW9A 4KY1H 4Y8AA 5IOPB 5EBGA 1R3KB 1NH6A 4YE4H 3KPRD 5GSVB 2YRZA 5A2FA 1WBYB 1VGEL 5ID0A 1U8KB 5BZDA 2Z0BA 2UVFA 4UUJA 2EDWA 4OFVA 1JTOA 4PLJC 3O45B 2PETA 4OCRL 3CFBB 4J3SA 4PJCB 3SDDA 3WFHA 3PDOB 2JIXA 5FDWA 3S3PA 2P7TB 3EOYG 3Q1SH 4PRIE 1NLDL 3BPOC 1LP9F 4HUKB 4OSUH 3SDCD 4OV5A 1MI5E 4HKZA 5CCKL 5IVXB 4F2MA 3RWHA 4Y19A 5T1LD 4OAWA 2LVCA 4U1HA 5C6WH 5TJWK 1RK0A 1P7QD 4HMEA 3DV6B 1RZKL 3DYOA 3PXJA 1N6QH 1GL4B 1N4XH 2YRPA 2WY3A 3H9SB 5E08H 1N5AB 1UZ6E 1CIDA 4M1GH 5EWIH 5FYJE 2CIIA 4DCQA 3QUXA 1OCWL 1AGEB 2Q8BH 5LAXB 1VEOA 4PJEE 4N9OB 3HS0A 4KZDL 4Q9CA 4DN3L 3P9LA 4WV1A 2P8PA 4M62H 1ZANL 4ZO6A 4MQ7B 5T1KA 3LKOA 2FL5A 5FKPA 1GHFL 4LPWA 2Q7YB 5BS0D 3D3VA 5JO5A 3MUZ1 4F9LC 1MRDL 1KYOK 2EDTA 2H2PC 1ZTXH 3QPXL 4LSQH 2UUDH 4P2QA 1YEDA 1BZ9B 2X1OA 3HA0A 3WKNA 5HDLA 2EEDA 1P2CA 3KHOA 3O9WD 3V5HB 3OHXA 4KVCL 4XXCC 2R4SH 3JWOH 1JGVL 1XGQA 5GRJL 1SJEB 2VDMH 3T2NH 3DX7B 4ZUVB 5TQ2H 1JRHL 3FN9A 3O6LH 4NN6C 2FWOA 3CXDH 4X6FA 5EZIH 1J0ZA 2ADGA 5EDXA 5F3BA 2BNQE 1MCKA 4XBPA 3H7BB 2PO6D 2QR0B 4YC2C 4YXHL 1FC1A 4N0CA 4QHMA 4LPCA 3BKML 3PJSA 4G59A 3BISA 2A6KB 5IVNA 1ERNA 1KF9B 5C0BB 4AMKL 2VKXA 2X4NB 3MV7A 4JKPL 3QUYC 2VZVA 4HLZG 2BOCA 3BGAA 1EHNA 1DBJL 1I7ZA 3KXFA 4RDQG 5SX4H 3V79C 4XVJL 1MFBH 2DIAA 3NAAL 3BGMB 1CFNA 4ODWB 1EUTA 4PV9B 3G6JF 2IH3A 4KXZI 2A6IA 4GS7B 4LGSB 5GGTA 2W38A 4M7ZC 3MOAL 1GGYA 4LK4A 4Z7UA 4AL8H 5K59E 1VCAA 3O6FC 1KYOJ 2BVPB 2MSPA 1OTUD 3VRLE 1W72H 1T2QH 1HWGB 3EJJX 5JHDE 5E2VL 3QI9D 1SMOA 2Y1VA 5CSZA 5GGSY 3MRNA 1G7MB 1M6OA 2Y06H 4H0HB 3WIHH 1A1MA 3ARDB 1S9KC 1XF5A 3U30C 3W5MA 4LP4A 1QBBA 5AEAA 2MOVA 4X7EC 2NTSP 1T1WA 1KELH 1WZKA 1S7TA 1ZKAA 4UTBL 4P46B 4GXVH 3PHOA 4Q6YA 4CADB 5E4IA 4QEGA 4KC3B 3CFJA 4Y5XB 2O5ZH 4J4PC 2GJZB 4JG1H 1S3KH 3RWFB 2WBJA 3BZ4A 1IGTB 3LHPL 4E9LA 1ZGLM 3AREB 2GK2A 3FHAA 4BQ6A 3L5IA 5EZOL 5L8JB 2R0WH 4XTRD 4LSSL 1DQML 3IAPA 4JFFA 2X05A 3S88L 3UO1H 1DBBL 5EIIB 1F58H 4RWYH 3CJJA 1ZMYA 3OF6A 5I1LB 4QYOA 2YPVL 2HFTA 3GDBA 2XA8H 2XWJA 2J88H 2WINA 4LLVB 4JN2A 1DQQB 4P2RE 3OMZA 5C0CB 1FFRA 1OPGL 4F9PC 4LLDB 1JPFB 4FTVB 1RAMA 1J0KA 1LO2L 4M5YL 3FB8B 1YN6A 1VACB 4BSWA 4JKKA 4KROB 1J05A 1MFNA 2O5XL 3DI2B 4G8EB 3JWDC 2C3VA 1JZ3A 3V4VL 2D3VA 2ZUXA 3GJFA 4WDIA 4ZPVA 2FLRT 3H6JA 5I19L 4XPHL 2AK4A 1TJHH 2FH6A 5KVDL 2Z8SA 5JW4N 1MFAH 1JHKL 1BOGA 3FQTA 3QWQB 2VSDA 3TJHC 4LIQL 1NFDE 3GSXA 2HTLC 4MB4A 4FXGB 2DMKA 4PP1C 4TSCL 3ILPA 3VDBA 1I7RA 3QNYB 2AGJL 5SWQA 4K94C 5ITFA 3P73B 4K3GA 1KB5A 4JG0L 4MAYC 1TZHA 5EUKA 4GH7B 3H3PH 1MEXL 5CJQH 3DGGA 1NAMA 3LKPA 1ND0A 5DR5L 1UWEL 5ALCH 4TULH 4XHJC 3HE7D 5DA0B 3WLBB 4LSVL 4CVZB 4A2MA 1VERA 1J87A 1H3VA 4M6MH 5J1AA 4M3JA 1FL6B 1NGYA 3BH8B 3MGAA 4LSTL 4UT6L 1GRWA 4LCYB 3DARA 5C2UB 4WY7L 2OJEA 4G8IA 3O4LA 4K23H 1XR8A 1H8SA 3VA2C 3WJLA 1U8PB 3G5VA 1MCFA 2ATKB 5I76A 3NGBB 4QXTA 4ZDHB 1OTSC 3CSPA 2W9EL 3QYCA 3OXSA 1DEEB 1IRAY 1UEMA 3D18B 4YHZL 3MPCA 1IJ9A 2W0PA 1NSNH 4GRWB 1WICA 3PL6A 5D71H 4JKMA 3RIAK 3DRTB 2P5ED 4OLYH 3PF2A 4PUBH 2A83A 4EQ3A 1EJOH 4TPRL 3RVXD 3WXVL 3O3AA 2F54D 2XN9B 3WNKA 5DS8A 3RVTD 3PWJA 2Z91A 1D7FA 3ARGB 3QFDA 4MQTB 5D9SB 4L5FH 4UILL 3QFJA 4TUJB 3UPCA 2F5BH 2XZZA 5HGHA 2EXWD 2P5WA 3MRCA 2VXUL 5ADPH 2YSSA 1SVCP 3L9RB 4MMZC 1GPOH 3MODL 3P4OA 4PLKD 5K9OB 3GMRA 2R2CA 12E8L 2VQTA 4L3EB 2D0HA 3BYYA 2VDPL 1FH5H 1IGFL 4IOSD 3RKDD 2GSGB 4G9DB 4JFHE 3WIIL 3EHBC 4M00A 2GQHA 1U58A 1UYWH 3NH7H 3TPUA 5FV2A 1KTKE 4FNLL 2OTUB 2IALA 1YPZF 3K1DA 3T04D 4UMGA 1UM6L 2XFXA 4PRBA 4NWUL 2GAZB 5AYUH 5IESH 2HJFB 2OXGA 2NPLX 4L8DA 5JXAL 4ODSH 3EFDL 3IDJB 1A64A 3ZKMC 1S5HA 1Z5LA 2AXHA 3V4UH 1I9RH 1GIGL 3P77B 3GO1L 3HFMH 1CG9A 5CGYD 2R69L 1RZJC 3R06A 3VG0H 3V4PL 4IRJD 4P4KC 3HG1B 1DQJB 2DKUA 3MBXH 4OCMC 3QNXB 2X6MA 2FJGA 3VXUE 1P69B 3HHRB 4R7NA 1SEBA 4XCNB 5TGBA 3CAFA 5IMLB 3MRIA 1QRNB 3P30H 4IRSA 2V7HA 4KHXH 2IPKA 1JF1B 4L1DA 2FX9H 4OGAD 3LD8B 4JHWL 5ANME 1CGYA 1L0XA 3U1SL 1UEYA 4YBQD 3DYMA 3O45A 2ORBL 2ZSVB 1UA6H 3EYQD 4AH2B 4H26B 3E6HB 2NY4C 1SYVA 3K4AA 4HFUH 3N85H 1OAZL 5I6XC 5SX5K 1WFOA 4LCIL 3LMJL 4JM2A 2X4PB 4KJWD 5HI3D 1MIMH 5IVXA 1A7PL 3TYGL 1UCTA 2UYLA 4M1DH 3T08A 3DBXB 4OLUH 3TYFA 3BYTA 2CDEB 3BEVA 3LQAC 4PY7B 3ULUE 3DNKA 4CUCA 4NNYA 2YPKA 1N5AA 4AY0A 1OL0A 5L9DH 1AGEA 4LDEB 5H35B 1YMMB 1H5BA 3ZE0E 2VERN 2FCBA 2BXYA 5EPMA 1Q9KB 4DZ8A 2NNAA 5DHVA 1C16B 5ERWB 3V6FB 4OZGE 3FQNB 5MEQA 5F7KC 4KAQH 1A6UL 3E2HB 4HWBH 1H3PH 4EI5B 2VLKE 1OSZB 1BZ9A 3U7YH 1I3VA 1U3HA 3E1F1 1CLOH 2OBGA 5IBTL 2MFNA 3TZVD 3WNNA 2AEIT 1SJEA 1UCBL 2P49B 4DGYH 1UM4H 4ZUVA 2F58H 3TA3A 5I18H 1QLEH 4NRZA 5E8OA 2HJKB 3KLAB 1B6UA 4HMDA 1QLRB 5D7IF 4P23B 4MCZA 3V0AC 5GZOC 2J8OA 1BF8A 1J8KA 3K7UA 1CQKA 5DUPL 1MCCA 3S5LB 4G9FE 3SJVD 4LAJH 3DSFH 4MJIA 3ET9F 1RI8A 3QXDB 2A6KA 3NMEA 4PJFB 1PQZB 1U8OB 1HCFX 4NKMB 5E0QA 3NIGE 4OFKA 2X4NA 3M17B 3Q3GB 4JJ5A 5E94A 3TFKC 2AQ1A 3LEXB 3UZVB 1CU4H 1B4JL 2R0ZH 2OJZL 2X70A 2CDGB 3BGMA 4WFFD 4PV9A 4HJ0D 4M7LL 3IFNH 2ZUTA 4MZ2A 4YK4B 1CXEA 3FB6A 1HXMA 4XNZB 3UBXA 4NYLB 4JPWH 1KGCE 5C9JB 5F9WB 1ZT4A 4FFWC 3MXVL 4HHAB 3T2PA 4GAFB 1XGTB 3S4SG 4BKLA 5IFHH 4LHUB 1F90L 4NBYB 3LS5L 2A73A 5HDBE 3KVQA 2R4RH 3ZYIA 5ILTH 1PG7H 1QBLH 5E6ZA 1A6WL 1CXFA 3HZKB 4G6FD 4L4VB 2J8UF 3B9EA 1U2CA 5HGAA 1CGVA 2WWKO 1CICB 1R3HA 4DVRH 4NQEB 1RQ5A 3RL2B 1G7MA 5CIPH 2DQHL 2AVGA 5I15L 4MNGA 5J7CC 1KIUA 1OSPL 1A6TA 4DKAA 4GW4A 1YNKH 1DLFL 3PHQB 1GJIA 1QFUH 3L3KB 3LN9A 5EU4A 5FYKE 3UTSB 3GSNA 4RGNE 4OLXL 4HJGA 4EQ2A 1BLNB 2C7UA 3SOBL 3KPQA 4K8RD 1JI2A 3JUYA 3NACH 4P46A 4XRCB 3QPQC 3HUJA 4CVXB 3WHXB 3IJSA 4G6AC 1YJDC 3NZ8A 3QULB 4LRNH 3X14B 2E5EA 1CLYH 3TM6A 1MCPL 3V0VA 3RWFA 5DZNA 1IGTA 3MREA 4U1JA 2EC9T 2VN7A 5T33H 3CLEL 4MGXA 1LD9A 2F9BT 4N68A 4HUXB 2E7MA 3FFCE 1FVEB 4BFEA 1R5VA 4LNRB 2R1YB 1IC1A 5I1LA 4HUNB 3SKMB 2O93L 1JGLL 1RMFH 2PTTA 1HQ4A 3M8OH 5LCVH 3ZL4H 1ACZA 5C0CA 3HRZA 3KR3L 1S5IH 4LLDA 1JPFA 2ENYA 4QOKA 4Y5XC 2F8OA 5DURB 1S7UA 5JXEC 2WK2A 4GW1A 1OGTA 4PY8J 3FB8A 1FIGL 1RU9L 1HEZA 2IH1B 4G8EA 2BX5A 3BPCA 5DI8A 3BQUD 1A3QA 1I8LA 4L4TA 5J6GB 3MLVL 1CIUA 3DV4B 4AJ0A 1ZLWH 4KUCD 3BKYH 1DANT 3OKDB 3T0BA 5CSGA 4X5LA 1T1YA 5GRUH 2WQRA 3QIWD 1CQYA 1I9EA 2YEZA 3QEQD 3UTTD 3ECBA 4HCRA 2XZQL 4PJGA 3VGHA 1YECL 3HNSL 4WW2C 2QTEA 2Y07L 5GGTH 1RUPH 3U36B 1OARL 4YXKL 4HJJL 1JIBA 2DWEB 4NDMA 4ZYKB 1C5DB 1WAAF 1OB1A 2UWEA 1FVCA 3MO1B 4S1RH 1OWRM 4X6CE 2VRAA 3B9AA 1MJ8H 4ODUA 1KENL 5HHVL 3KPOB 5D2LF 1NPUA 1P4BH 3SBWC 3T0EA 4LGPB 4N5ED 3FN0H 5GJTL 3WLBA 1S7WA 4N8CH 3FL7A 2P44B 5C0RL 1J8HD 5KS9F 3C5ZA 1FL6A 1TCMA 1F6FB 5KTEL 4PJCE 4D8PB 2J6EH 5CKGA 1N3NB 2DIJA 4ZO9A 1A21A 5F7YC 4JPIB 2WZPD 3S36L 2VAAB 1XF3A 3QCUL 2DQUL 5D93C 2ATKA 5FHBH 1QSEB 2NY1B 3ULUH 1IEBB 2E7HA 3B9DA 3IDGA 4PRID 3WO3B 2WW8A 1MHCB 2CKBB 3H9SE 1SMAA 1MI5D 5IBLC 1FNGB 2VSCA 4HV8A 1B0RB 4YO0B 3WXWH 3MBEB 4X9IA 4OCXL 1U8MB 3CFCL 1NEZA 4W4OC 1H3XA 1S9XB 2DM3A 1TVBA 4RNRB 5FYJD 4D0DA 2VKWA 4ONGL 1OAKH 1JGEB 3VFVB 3F7VA 4JREC 4TUJA 3IDIB 3LSOB 4Z0XB 3NOIA 5C0GA 4LSUL 3QRGL 1CD1B 4LSPH 1UT9A 1T7ZA 3DHMA 1RSFA 4KMTL 4XGZA 2BXZA 3ETBF 1R6VA 3WS6A 2WIMA 4PRHA 3MRHA 4YPGB 2NZ9C 1YEKH 4BQ8A 4NNXB 4K94H 4PJ8D 3B9KA 3GMLB 1EFXB 1OF2B 3REVB 3NABH 1PYWA 1RUQH 1BFTA 3SO5A 2HMIC 4NHUB 2Z93A 4U1MA 1X5GA 2HP4A 5EC1B 4XP1H 3OAUL 3LV3A 4UV4H 3ARGC 5SV3A 4DQOH 3PE9A 4LRIA 2GAZA 4N0RA 1BAFH 1U8HA 2BNQD 4AZ8A 3H3BC 2QLVB 4OCYH 5DK0A 5TE7L 3IAGC 4H1LG 3SCMA 5DZLA 5HI4D 2LFGA 3IDJA 4PG9A 5C0BE 1QLFA 3QUZA 3RIFK 3ZKQD 1JWUB 3TBYB 3UAJD 2P46B 4Y4KB 4HEPG 4P99A 1E28B 3P77A 2VR4A 4Q0XL 2JCCF 4ODXB 5C7XH 1E0OB 3RU8H 4S0UC 1AFVL 3RNKB 1MF2H 4G7VH 2IBGA 1WF5A 4XVSH 4JRYB 5CAYB 3MLTB 3D9AL 3SKNA 4LMQI 2DI8A 4ONHB 4P3CH 4XCNA 3X12B 2ZKHL 4WO4D 5IMLA 4OGYH 4OD3H 5CFHA 2DYPA 4FFVC 5B39A 3UPRB 3IDNA 2VDNL 1OGAA 1EIBA 1RK1A 3GBLA 4ZNCD 5IEHB 1MCDA 4ODTL 5F7UA 2BFVH 2C1PA 4K9EL 4JDTL 1WIOA 2V17H 4JQXC 2Q76B 5IROA 1K3ZA 2ZSVA 4IDJL 1MWAA 4P5KB 3ZSSA 3NCYS 4ELME 1I1AC 3K3QA 1X5KA 4ZUUA 5JHDD 1EBPA 2ZUQC 5FYKH 4OCWL 1A1OA 1U3ZA 4Y16B 2DN7A 4NQCA 2X4PA 3BFOA 1PW3A 4L29B 1CFVH 3EJYC 4GBXB 4R26L 2CDEA 3PV7A 1TENA 1H3GA 3P0YL 4PY7A 4X7TB 1YA5A 1N0LA 2KH2B 4LPVA 1LO0H 4LASH 1MFCL 3FT2A 3MV8B 2RIKA 5EG6C 1DQDL 5C0EB 3V6FA 3BKCH 2V9TA 3NIFE 3SDYL 5KN5A 3MV9B 4YLQT 3ZDXE 1IMHC 1AQKH 2YHGA 5FK9A 5GRVL 2QSTA 1IKNA 4IMKC 2DI7A 3LKQB 2WBKA 3QAZC 1QKZL 4XT1C 5BXFA 3B8SA 3MXWL 5AUMB 3OJVC 3O4OB 5T1MB 4X6DE 4FTVE 4F8QA 4PG2A 1HXYA 2V5YA 4OLVL 4IJ3B 1M05B 1PG7W 4Y5YC 3U7AA 4O2CB 4MA7H 4P2RD 1UGNA 3U0PB 4MXQA 1QACA 2JB5L 1QLRA 3QEHB 1E4KA 3VFNB 2PXYB 3E2HC 4WHYG 3ALXA 7CGTA 4EI5C 1F97A 5HDOA 1RZGA 1DL7L 3IGAB 4HK3N 2IMNA 4GO6B 1GSMA 1RY7B 5DQ9B 1J9CT 3QXDA 3IT8D 1PQZA 4LMQE 2Q86A 3Q0HA 2FEEI 5HJ3B 4HULB 3MNWB 1RIHH 2AV7A 1IGYB 1NGPL 5I8KL 5IB3A 2PYEA 1DUYB 2QQLH 2R39A 5ALBH 2X4OA 3P0VH 4FQQB 1YQVH 1E6JH 1BJ1J 3OKEB 2BSSA 4P2OA 3PQYA 4W6WB 4P23C 1RZFH 1OAXH 2VR9A 1CXHA 5C9JA 2ZCKL 4U6YA 1CLCA 1MCIA 1ZWIB 2NY6B 1N2RB 2QBWA 5DRNB 1KTLA 3C6LC 1CGTA 4FQXA 3QUKB 2OP4H 4KQ4H 2YN5A 1BJ8A 3B8YA 2ZJSH 5KSBF 4LKXB 4X7CC 4I9WE 3RL2A 4FXLA 2IQAA 1FL3B 4BYHA 4HX1A 5ICXA 1J0JA 5HHMA 4M7JL 4PJIA 1U36A 1CK0H 1NBYA 2OI9C 4XNZC 5DHYA 3GJEB 2W59A 4XPAL 1NMAL 3L3KA 5F9WC 2J4WH 3RTQB 3G9AB 4RFEA 4PJAF 3HMXL 3MLZH 3QIUB 2H2PD 3EYSH 5D1XB 3U0WL 3LS4H 5D72L 5ACLA 5DHVH 3T0XA 3HTLX 3SGDI 1CICC 3VGGA 1FGNH 4ZTPL 2OCFD 3DVNA 5CD3B 3LN4B 5EUOA 2BDNH 3DXAA 1LGVA 3MLYL 1YYLL 2WIIA 2XN9E 4BELD 1R5WB 5K9QI 3QXWA 1EEYA 2B5IC 1MAKA 4FA8A 1MH5A 3UMTA 4FP8H 4LNRA 2WP3O 1XZ0A 4UDTB 6FABL 4X4ZA 4PY8I 1CZ8H 2Q8AL 3TO4A 1XGUA 1Z9SA 4XC3H 2IMMA 1V05A 3H0TA 4E42B 4LF3A 4RAUA 1V7NH 3F7QA 2PF6A 4L3EE 5E2JA 2A77H 3ZSTA 3RUGF 4FQ2L 5IQ9A 4P3WA 3T4YB 1FV1B 1I1YB 3MRQB 1NGQL 2APXA 2Y36L 4FQJL 1Z9LA 1S9VB 4R2GC 3AS3A 1OP5K 3PP4H 4K3EL 3WD5L 3UYPA 4AT6A 3UTPE 1FORL 3BDXA 4Y89A 5T3XH 2IH1A 2GFBA 1PKQE 3GRWH 3P4MB 4JVWA 5CJ8A 5A2KH 1U2HA 2OS7A 1V3MA 3QG6A 4JFHD 3A6CL 4PJBB 3AS2A 1AY1H 1LDPH 3I6LE 5AAMA 5FM5O 1IQWH 4O4YH 4EIGB 2OQJB 4KKCC 1Y18A 2HT4C 1FNFA 4Y4FB 5E4EB 3TN0B 5A16B 3O6FD 2C3GA 1FFNB 1MFEH 3MJ6A 4Z95H 5FHAH 2W9DL 4I0CC 3SGKC 3HG1E 4PLOB 3U36A 4PJXB 2Z31A 1CD8A 1DDHB 4XNYL 1I7UA 2PN5A 1BD2B 3BPLC 4L1HA 3NFPB 1N8ZA 5FYKU 3N06B 1QRNE 3L7FA 2D03H 2VXSH 1HILB 3VXUD 3FQUA 3O6ML 3GKWL 4AEHL 2XG4A 1JTTA 1U8JB 3PWLB 2X1WL 4MNHB 4NIKB 1P9MA 5FO9B 2YD9A 1RHFA 1KCSH 5EO9B 4HIEB 3F65A 3KPSB 1P4LB 3CFIC 4GKNB 2ERJB 4KVNL 4TNVK 2NW3A 5T1DL 1RIVL 1X7QB 4GAJH 3F7PC 3TNNB 1R0AH 2O61B 1FPTL 3U46B 43C9A 2HRPH 3HI6H 4F58H 3NIDE 3C9NB 3ROLA 2VH5L 1QSEA 5DQDH 4QRRA 3OKOB 1VENA 4XXCA 3VFUB 2FB4H 4U6XB 4NO5B 3VFRB 3B3IB 5F7HA 2CKBA 3EFFB 1MCSA 1FNGA 5F7DB 2BVYA 4UINH 3HC3H 4V1DA 4POZC 1YMME 4Y1AA 4QGTA 1A8JH 1YY8A 4UQ2A 4TRPL 3MMEB 2ADFH 3MYJA 2P8MB 3L7EA 4IIQB 5CWSB 1AO7A 3MFFA 3ULUD 1KULA 5F1OB 2D31A 1W8NA 3ARBB 4Y4HB 4P59H 3RGVD 3HC0A 1EO8H 3JWNC 3H2WA 4HUWB 5CP7B 4EOWL 5C0AB 5DYOA 2NY1C 4GAYB 5ESQB 5F1NB 3KYOA 4K07A 3MRBB 1Z3GL 3QUYA 1YEFL 2NR6D 2QL1A 3IJHB 4LGRB 5DK2B 4YPGA 1O5DT 2VLKD 2DQCL 5C09A 3T3PF 4NNXA 4GT7A 3MBEC 3IYLW 1ZA3B 4PRDB 4R3SB 1KLUB 1EFXA 4WI5A 4EUPA 3REVA 2V5RA 4C55A 4PS4H 1KSRA 5FYLL 3TH4T 3TVMA 1BQHA 1B0GB 3GIVB 1KXVC 1ZEAH 4K7PY 5BW7A 4K7FA 4JO4L 1OAYL 3GMPA 1I9IH 4HXAL 4XP5L 1T0MB 4U2ZA 3MLRL 4YHOH 4PJFE 5DEFB 4JFPA 1ZSDA 3PDGA 5HI5C 4MAYD 1VEMA 2A9ML 2SEBA 4G9FD 4XPBL 4Y4KA 2ZZUT 3D85B 4MB3A 3C6SA 1BVKB 5EU3A 3LKNA 2F74B 1LP9B 4XHJD 3K2UL 1LK3H 5CHNA 2V6HA 4N90E 3ZKXB 1HHGB 1OTTC 3BMWA 4RGMB 4ZUTA 2AQ2A 2X09A 1I7TB 3QEGL 3K1KC 1J11A 5MERB 5L0QB 1CL7H 3X12A 5TDPB 3O8XD 5CD5C 1JL8A 3SDXA 1KIRB 1JFQH 3V52H 1VPOL 4QO1A 4Y2DB 2M2DA 2JJSA 4L4VE 1KGCD 1OTSD 4L8SA 1UKQA 4GW5A 4NQEE 1A6VL 1P1ZB 1IAIH 3B6SA 3KS0J 3G6DH 1KEGH 2CIKA 3MJ9H 3F5WB 1HIML 3S37L 1A22B 3FAXA 1UB5B 2VNCA 4J1UA 1U8IA 1WZ1H 4NM8L 1I8KB 1O7VA 1X5LA 3UTSE 5F7LB 1YEGL 1JGDB 1DBKL 4GRWH 3QB7C 1NC4A 2MQ0A 4JB9L 3CPLA 1F4AA 5I1HH 4X7TA 3SO3C 3MACL 4P4RA 4EDWH 4M7KL 1P4IL 5FYKD 3S4SB 1UWXK 4RGND 3TJEH 3RWJB 1AXTL 1PAMA 3WKMH 5I1JL 3DX8B 2O5YL 4KZEH 4WTZG 3PWPB 1IC7H 1NAKH 5JOPE 1RZ7H 3BIAX 1D6VL 1MY5A 1KT2A 4RISH 4UAOB 5HHOB 3CZFB 1GC1H 5L6YL 4HSQA 2IFFH 3EHBD 4OQTA 1LO4H 5INDB 4Z7UF 1EGJL 1RUML 3LKQA 4UT7H 2CR3A 4XNUH 5DRXA 1K85A 4TUKL 3TJHA 4I3RL 1WIUA 5JA8B 3FFCD 3SE8L 3ULVC 4PB9L 1FFOB 4K71B 4YR6B 4U31A 4LPUA 3HB3C 2WLZA 4ISVB 5C0JB 1NCWH 5FDYA 3S35L 3NCJL 3G6JB 1M05A 1FZJB 3ZKMD 2JK5B 2OSLB 3EOAB 1NKOA 4ETQB 2GK0B 5DFTA 3PGCA 2HN7B 3PP3H 4UIMB 1SQ2N 1AKJA 1T1XA 2EKSA 1YNTA 5C1MB 1ZVHA 3JVGA 1VGEH 1VFUA 1JTPA 3FOLA 2FR4A 1QVOA 3CU1A 5H2BA 3PNWB 3ES6B 5F1IA 2NY2B 1XF2B 3ISWA 5DVNA 4OCRH 5DQ9A 4HZLB 2EH8L 3CMOL 3VWKC 4Z7OE 5J56B 3O4OC 1NLDH 1WTLA 4FZ8L 5EBLA 1KBGL 3RWGB 2MCPL 1NGWB 5CCKH 5IIEA 4J2XA 3QDJB 3CH8A 1GZPB 4HC1A 1IT9L 1YUHA 2B1AH 2CLRB 2GUOA 3QEUA 4N0FB 5CINL 5DJ6A 1RZKH 1JPSL 1U8LB 4EN3B 1DSFL 4HFWA 3GSWB 3TBVA 2YUZA 3C87A 3QXAA 4I18B 3IKKA 4MAUL 2YUWA 4ZTOL 3CSBA 1OCWH 2DMBA 4NKOB 1N2RA 1HH9B 3BUYA 4O2FA 3MRPA 5E9DE 1FBIL 1UJTA 4TUOB 5JLZA 4KZDH 3QUKA 3SDAB 1ZANH 2OL3L 3MGOA 3IU3B 2NY5L 3MV01 2PYFB 1MRDH 4QHUB 3QPXH 4JFQA 2DIBA 2VLJB 2EDEA 3BZFA 3LAFA 1QSVA 5CILL 3QO0B 5DJCA 3MCLH 4KVCH 1JGVH 1H9VA 2N7AA 2R2BA 4B50A 4F37K 1B3JA 5I1AA 1JRHH 4ACPA 3DUHA 4Y88A 1ZAGA 1D5ZA 3VRIB 1JWMA 5D1XA 3H3KA 1WUNT 3GGWB 1DVFB 4MD0B 4M02A 4P5MA 2AABL 4S10A 2X4QA 5HYEA 4YXHH 3LN4A 3E8UL 3H9SD 5IF0B 3VDCA 4JAMA 3STZB 3BKMH 2G60L 3BIKB 2AJYL 1R5WA 2DLGA 5F71A 4UB0L 4GG6A 4NBXB 4NT6A 4C4KO 1G7QB 2QSCH 4AMKH 4CL7A 3D2UA 5TQ0L 3PIQB 3VXSB 5D1ZB 5FECB 5HYSA 4UDTA 1DBJH 2ATPA 4ORGB 2B7DT 4MQXC 2ICCA 3NAAH 3QIUC 4JHAL 2BVEA 2GJ6A 4FQLL 2M26A 1F3JA 1N64L 4YE4L 1CDHA 4OFPA 2BVTA 4P4KA 4HGKC 3VWJA 2FX8L 2W0LA 1FV1A 3TCLB 1PY9A 4KRLB 5DZOA 5CEXB 2ADIA 5EOTB 2BHZA 4U0RB 3MOAH 3QRFM 4NHUE 4EJ1C 2N4IA 3TFKD 2BNRB 1VGKB 4OSUL 4H8WH 4PJBA 5E2VH 3LDBB 2CDFA 5DJZA 2RHEA 2OQJA 4GLRI 2B4CL 3L3IA 1A7OL 4IS6B 4X7FC 1U92B 4KI5D 5E08L 3HE6B 5A16A 5IM7B 1UJ3B 3ESVF 4XCEB 5I74B 4AIOA 2W0FA 1YN7A 2DM2A 5C0BD 4WI3A 4C83B 3GK8L 1AI1L 1LE9B 4R7DA 5F8RC 1DDHA 4Z7QE 4JRYE 3N0PB 4JY4B 1G7IA 3WE6A 4PJ7E 1W0YT 5DD1L 3AS1A 3VXMB 1HILA 3C8KA 4QWWD 4EBQL 1AGDB 1MJ7L 3LHPH 3VGFA 1K6QH 2AS5M 1BQSA 1TZIA 4LSSH 5FO9A 5D7LB 5CJ5A 1JYXA 4JO1L 1DQMH 3RNQB 1YYML 4Y4FC 5E4EC 3TN0C 3S88H 5DDHA 3JWOL 1DBBH 2R1XA 4H1LB 4HIEA 4ODVL 2E7LA 2NTFB 3QPQD 3OJ2C 2ICWB 4G6AD 3MCKB 3QCVL 4NO0B 5HYJB 3HI1B 3O6LL 2YPVH 1NCUA 5F93C 4M4RA 1QNZH 5BOZG 1OPGH 4LCWB 5BRZA 3ARDD 2NY3C 1F3RB 1ZHBA 1C5CL 4U6XA 4NO5A 3CGTA 2X7LB 3EO1B 4WFGE 5SWSB 1LO2H 3F6LA 3AGVA 5F7DA 1EV2E 4CGTA 4HIJB 2O5XH 5JNYA 3MV8E 3KWWB 3V4VH 4R96A 2NY0B 3DRQB 5JR1H 4U6VL 1DANU 3ARBA 2FLBT 5GSRB 5I19H 4XPHH 1MFBL 3MV9E 4TQEL 4JO3L 4OZHA 5KVDH 3BHBA 4JFDE 4WFHE 5JXED 1ONQA 1INQA 3TESA 4P3DA 5CP7A 3ARED 5ESQA 4GAYA 1R3JA 3QXVA 4ODBD 3TT3L 2V2WB 4LIQH 4OF0A 2HFEA 2BHUA 1RJCA 1YEIL 4NQVA 3QQNA 4GMTL 4TSCH 1I3GH 1MREH 2IPTL 2AGJH 2VL5B 3JBG7 3QQ3B 4UT9L 1MLBA 1LQSR 4O02H 4BFIA 4XMKL 1QZ1A 1MNUL 3G6AB 3ZE1E 5L2KA 4JG0H 3DUSB 4IIQC 4HQQL 4HKBB 1MEXH 1D5IL 2Y7QB 3KPLB 1GAFL 4C4KT 5DR5H 4FTVD 1UWEH 1JFMA 2DWDA 1A5FL 4YBHA 4JM2F 3WNLA 5IVXF 2YA2A 1D9KC 1LEKB 3EAKA 4LSVH 4YHIB 2AW2A 3HAEB 3IFPB 4KROD 4F7CA 1MRCL 3O2DL 2HTKC 1CE6A 1M4KA 2AJXL 3TLRA 5A2JH 3G5YB 4LSTH 2YS4A 4UT6H 1KLGB 4KTYA 3FKUS 4WY7H 1TJGL 4WU5B 2A6JA 3T1WA 1HHIA 1ZGLA 1AD0B 3P3YA 4ZSOB 1JJUA 4CNIB 1FJ1A 2W9EH 5E6IB 1EEZA 3VXTB 1S3KL 1AR1D 4OI9A 4YHZH 3P9MA 5D1QB 1T0NB 3QUML 3I9GL 2IANB 4QKXB 5MENE 3M45A 3EDKA 5HVWA 2GCYA 3VFOA 1A7QL 4TPRH 2BVQB 2V9RA 3WXVH 1Y6NR 4K9EC 3C60A 2J88L 4HIIB 2A1WL 4P5TA 4UILH 1CDGA 1P84K 3ZKXC 3C8DA 3HPLB 4RGMC 2FECL 1CT8A 4I9WD 12E8H 3CMGA 4R4FL 3GSRA 3KNBB 2BRRH 1CBVH 1I8KA 2CKBH 5KVFL 3INUH 5IHLB 1JGDA 2VDPH 5C08B 5HGBB 1EHXA 3QH3A 3OR7B 3WIIH 5DMKA 4LU5H 4DK3A 1MFAL 1S7RB 5F70A 4QY8A 4PRNA 5IGXL 3DX8A 5EOCH 4Z77B 4NWUH 3PWPA 3VFMB 2NZ9D 1X5JA 4MVBD 1NBQA 5I9QB 5JXAH 3EFDH 5MP6L 5DC4B 4PRAA 3SQBA 4G8GE 4LEXL 3VXRA 5DVLA 3VRJB 3AY4C 5HHOA 3CZFA 5EU7E 1QFHA 2HMID 3L3JB 1GIGH 2XN9D 3GO1H 1Q94A 5J11B 3ARGD 3CFDB 2R69H 5HVHB 3H3PL 3V4PH 1E27B 5JTWA 1G7HB 1FFOA 3B2VL 4YR6A 4TULL 2NZIA 4XCFH 3LQZB 1JNHB 3G6JA 2DD8L 2ILLA 3WFEL 1G6RA 2OSLA 3L3HA 2AXGB 4L3ED 1BVLA 4UIMA 4PJDA 2AJVL 5EORL 4KTDL 2BY1A 1T03H 1D6EB 1KPUA 4I77L 4RMVA 5EC2B 1P84J 4UAOC 3SBWA 1XGYL 4K23L 4PJ9B 5FGSA 3PNWA 2J8UB 3OKMA 3UTPD 3SGEI 2OL3B 2ORBH 2R1WA 3MOBH 2AP2A 3NN8B 4YDLB 3RWEA 1WT5C 5FV1L 2VDLH 3OJDB 2F8VA 3HUJF 4JFOA 4NPYB 1OAZH 4FFVD 2EDDA 2XTJC 1WITA 4LCIH 3LMJH 1XGRA 2J5LB 1A7PH 3TYGH 4GKOA 1I8MB 1A7NL 4PJXE 1TNNA 5JMOC 5C86A 1BD2E 1M7IB 1EJOL 4HF5L 2MPAH 4XZUB 4XHQA 1BIIA 1HHJA 1L8JA 3GSWA 4XAWL 3HG1D 4OFIA 4NKDA 2BK8A 3GSUB 1WBZA 2ADJA 1OP3K 4CJ1A 1G9NC 4TUOA 3E3QA 4QRSA 5JOFA 2EDBA 5TH2B 2R56L 5EU6B 1BQLL 1GPOL 1QRND 3EJYD 1X5YA 1Q9WB 2K3TA 4QRUB 3DIFB 3GMQB 4W4OA 4JPKL 5C0FA 43CAA 4OZFA 4HLZH 4YDVB 5F9OH 3O11B 5C9KA 3KPSE 1U6AL 2VLJA 5I30H 1HNGA 4YUEL 4E41A 5FM4A 1OWWA 2VLRA 3MR9B 5GS2D 5I17B 3QO0A 5C07B 1GGBL 5IBTH 5SWZB 3P40A 3L5JA 3X11A 1UCBH 1IM9A 2VISB 3EDEA 1ZOXA 4YHYC 3DJ9A 4S1SH 5AYUL 3UX9B 3THML 2YN3A 3KJ4C 5FUOL 5F89B 1DN0B 1KG0A 3HZYB 1C8PA 1FFQA 4PJGF 3T65B 5IF0A 3STZA 5DUPH 3HFML 3BJ91 3U9PL 1RJZA 4OQTH 5EN2B 4Z7VA 1YMMD 2UZYB 5FKAB 2VWEE 4UOJA 2EIBA 2FSEB 1MJJA 1FFPB 3MBXL 2UWEF 4MDJB 1KJ2L 3LB6C 5C0AE 5DXWA 5KAQG 2CJUH 5CS7A 1FZOB 2YZ1A 1QEWB 1ZV5A 1B4JH 2RFXB 4EI5D 1CTOA 3TCLA 1MSPA 1PZ5B 4MD4B 4QRPA 7FABL 1N6VA 1ZVYA 5CEXA 3MXVH 2ZWLT 1F90H 3LPWA 3LS5H 1KCVL 1UA6L 5IV2A 4KV5E 5E8PB 3QWRD 3OR6B 4Q9RL 1A6WH 5D2LB 5L8KB 1GZQB 1F3DH 5I0ZA 2AEPH 1VGKA 1VFAB 1JHLL 3RZCB 5D1ZC 3SE3C 4P23D 2NCMA 1YEHL 4Y8DC 2DQHH 2YC1B 3OGCA 5I15H 2YPLB 1ZS8B 4JY6A 4GRWF 1J1PL 4CRPA 1INDH 1OSPH 4PP8C 1I1AA 1TMCB 3EGSA 4FOMA 4XCEA 1DLFH 5EO1A 3KPPA 1LP9E 1MCBA 4LARL 1BWMA 3FO9A 5L9DL 4U0RC 4OQ1A 1FG2A 3SOBH 5GS0L 1MCEA 3TF7C 1HHKB 1F4HA 2FX7L 5KZCB 3WN5B 3G5ZA 4MA8L 1FNSL 4F33B 2NLJB 1OT2A 5J12B 4IOFD 4N90D 3L3GB 4R90L 1S7VA 3K46A 1H3PL 2DM7A 3LDBC 1MCPH 1OM3H 5IFJA 2JJVA 4IBLT 4MLSA 2H45A 3QZWA 4YEFA 3CLEH 5D7LA 4JM4L 2JKXA 4LHUD 1RUAL 2A6DB 3V5KB 3HE6C 4H1LA 4M48L 5MI0C 2IF7A 1E4XL 3Q5OA 1UM4L 5KSAB 4L4VD 3GBMH 5IHUH 1H8NA 2EO1A 1CICD 5E8DL 3S96A 3CUPB 1JGLH 5I2IA 3QSKB 1GGCH 4NQED 4QLRA 5BV7L 5IB2B 1VEPA 2B8OT 1F42A 4YFLI 5HHNB 3K4ZA 5DT1H 2DI9A 2DS4A 1ZT1B 4H88L 5ACZA 2HKFL 3EBAA 5C92A 1F4WL 1FIGH 1RZIB 4W4NA 5DMGD 3UTSD 4Y5YA 3V2AR 5LGJB 2APBA 2YZ8A 4NQTA 3KWWA 3IFOA 3TV3L 3FB7B 3MLVH 3FO1B 5FGRA 2HJLA 2UUDK 4FQCL 3MUY1 5BO1L 3I02B 3QI9C 5JOPD 4GRLB 2BCKA 3VMOA 1YECH 2AQ3A 2HVKA 1XH3A 3PWUB 4HK0B 2JCCB 4GKZB 3MZTA 1XT5A 4YXKH 4HJJH 1BOYA 5ILTL 1NDGA 2XTJE 1QBLL 3N1GC 4OZ4B 3G6AA 4NRXB 5DJ0B 4YX2L 3DUSA 2FBOJ 2NY0C 1KENH 5HHVH 1J1XL 3V5DA 2CK0L 3UJTH 5DURD 3QUMB 2C1OA 4H25A 1NANI 1Q0XH 1DLHB 3L95B 4OUUB 3C6LA 4MWFB 2DOCA 3MQIA 5GS1B 5GJTH 5C0RH 4F3FB 2VZ1A 1A7RL 2E8YA 4X7DC 4YH6A 2Y5TB 2Q20A 4XX1G 1BFOA 1YMHA 3ZZ1A 4XTRC 3VXNA 3FT4B 1MCOL 1A3RL 4WU5A 3IETB 3T2QA 3S36H 4HUUB 3QCUH 4CN1A 4ZSOA 3QDJE 4LRNL 3ZDZF 4RBPH 5J57B 3R4DA 4JLRA 3VXTA 3MROB 1KCKA 3RDTB 1UQSA 5IBUG 5T33L 5I8CA 4MNQA 2YRLA 5FO7B 2IANA 5DQJB 3MUGB 1IKFL 4NO2B 2GT9A 1I75A 4OCXH 5J89A 5TDNB 1MAJA 3CFCH 3R0NA 1IM3B 3MRRB 2C3HA 1EERB 4ONGH 3KPNB 2HA1A 5E9DD 1T7XA 2XICA 4LSUH 1ZVSA 3QRGH 1A4JB 2X89D 3OQ3B 4POZD 4KMTH 3HPLA 4M8VA 5D96B 1OW0C 5D1QC 1W8OA 4EVNA 4OFDA 5FB8B 4CU6A 3QA3B 1KPVA 4JDVB 5ITBL 2CUHA 5J06A 3EJZD 3CFKB 1G7PB 5FGBC 2ICWI 5EZJB 1GYAA 1F00I 2NY1D 4LPYA 4YXLH 4TVPL 3OAUH 1S7RA 5H94A 4M61B 4X6BA 1IGJB 2Q6WA 1C12B 4Z77A 4PRPA 4JFEA 2KL6A 2YD4A 4NC1C 3VFMA 4C59B 3BVNB 2C26A 3KDMB 4RWHA 5TE7H 3MBED 5D6CB 4UI2A 4HD9A 1QA9A 3HE7C 5DJAB 2QKIB 4G42A 2XKUA 3R8BB 3TBWB 3QNZB 5FFLA 3VXSE 3Q5YA 5KANI 1L6ZA 1MCNA 4R0LB 4C56B 2EDHA 4XI5D 3WSQL 1WWCA 1MCWM 5EB9A 2BNUB 1MJ8L 1G7HA 3KYKL 1P4BL 3C5SB 1DZBA 2ZUWA 1LEGA 3SGKA 4HXBH 4U1NB 1JNHA 3KYMB 2CK2A 2XG5A 4N8CL 1FNEA 2ZKHH 1G9ML 4L9LC 2AXGA 2EDRA 5C0DA 3VXQA 2G9HB 5DFWH 3REWA 4WNQB 4PJIF 1VESA 3HR5A 5I9QC 1HH6B 5HVFB 2VDNH 3MRMA 4GUPA 5EC2A 4JZJA 1ZHNB 2BNRE 1AGBA 1AD9A 1VFBB 1NC2B 4ODTH 4PJ9A 1B6DA 4P2CG 4K9EH 4JDTH 3BP5B 3TBTB 5J11C 4IDJH 4DKFL 5KSBB 3SKJL 3ELAT 4NPYA 1FYTE 3UBXG 5FCUH 4OCWH 3ZKNC 5JMRA 5AZ2L 3K8LA 2EXWC 3V7MA 2X5PA 4WI7A 4LLYA 5EUOF 1GGIL 1FP5A 4OGXH 4PLKC 4R26H 5IMKB 1MAML 5D7JB 3P0YH 5DJXB 1UACH 4U6HB 2H1PL 25C8H 2DDQL 2KZ1B 1OAKL 1NGXA 3RKDC 1MPAL 1T6WA 3VXME 1MFCH 4JRYD 2CMRH 4LCCC 2ICEB 4Z78B 5I16A 1R3IL 5I1KL 1FL5A 1DQDH 1QSZA 2ZSWA 5EU6A 3SDYH 3VU2A 2DQGL 1QG3A 4E5XA 3DIFA 4JRXA 4U1KB 1GVIA 4PJ5A 4OKVB 4ZQKA 2J5LC 2BOBB 1F8TH 3D25A 5HYJE 3FFDA 5I66B 2IAMC 5INCA 4WFEE 4FQHB 1QKZH 3MR9A 5E99H 1KJ2B 1V3LA 3NABL 1HQRA 4Z5RA 4LCWE 2VZOA 5EBMA 2ZUVA 5CGYC 3G5XA 2IJ0C 3O3DB 2X42A 4WUUB 4OLVH 4Y16D 4PP2A 5SWSE 1DFBL 3X13B 5IKCB 3RBGA 1CDBA 3GM8A 3DETC 2G2RB 5DSCB 4ZS7H 5ESAB 2JB5H 2OR9H 4GBXD 1VFOA 2BSRA 4BH7A 4D9LL 4WFGD 3QDMB 4W81A 5FYLE 3RL1B 5EA0L 1YPZE 3BEWA 3BGFB 3HPJB 3HB3D 4RZCA 1DL7H 4XPGL 3RU8L 5FKAA 2FSEA 3MV8D 1KB5L 4MX7B 1FFPA 3AB0C 4BUGA 1ZA6B 2NX5B 4Q7DA 4P9HL 5KW9L 1NAML 2V2XB 4WCYH 1NGPH 35C8L 3MV9D 5I8KH 3V6BR 5JQ6L 4WFHD 4NQSB 2FDBP 4OGYL 4ZXBC 4HWEL 2MQCA 2X4RB 1JE6A 4PREA 3LEVL 5HYQB 1W0VA 4YIQB 1NCTA 3F62A 3BPNB 3ZHLA 5IB1B 3RI5F 4MD4A 3VWKD 5JHLL 2YD2A 3OKNA 2A9NL 2D0GA 2ZCKH 3P4LA 2V17L 4PBVC 3QJFB 3RWIB 5EBWB 3D39B 2L7UA 5IW1B 3ARTA 4MD5A 1VFAA 3CVIL 3SPVA 4YHLH 1O7SA 2YWZA 1W0WA 2PXYD 2B4CC 5E1HB 4M7JH 1TITA 4NUJB 4M8QB 2K7QA 5DRZB 3WUWG 3IDMB 1WISA 4HWUA 4J23A 3QHFL 3L3DA 4QT5A 2DQIL 3T4AA 3ZHDA 1NMAH 1T89A 5EU5A 5BV7B 4JN1L 1FO0A 4JHZA 4IOIB 3HMXH 4PGCB 3TZVC 3U0WH 2NLJA 1A14L 5D72H 1QD0A 3RZCC 4HMCA 3VFWB 4NKIL 4R9HA 3V7AE 1QSFB 3M1BA 1VKXB 4X83A 5FF6B 4EDXB 1YYLH 5KVGL 4X4MA 2BY0A 4X5XB 5MEND 3JWOC 2NY6D 3UDWA 3VJ6B 4WEBL 1KJVB 1JPGA 1KCUH 4JQIL 4NC1E 3VI4F 2VAJA 1R3LA 1SY6L 5KSAA 3ZYOA 5BJTB 6FABH 1I1CA 1LMKA 1TPXC 3CUPA 4NQDB 1XCTA 4QXUL 2Q8AH 2XWBB 1H15A 1NMBL 2W07A 5ID0B 3FRUA 5C08E 4FQ2H 5BZDB 4UUJB 4MHHG 2EEBA 4GQPH 2Y36H 4FQJH 1N6UA 2XZAL 3JV6A 3WD5H 1C5BL 5LGHL 5LGJA 3SDDB 1FORH 3RTQD 3WFHB 1BVZA 5FDWB 5DVOA 5EIQA 3RA7L 4NBZB 3QIUD 4HGMA 4CKVX 3KPMA 3CCHB 3EOTH 5D7IE 3KYAA 1UADC 5JIPA 4G7YL 3GSQB 4OV5B 4HKZB 3RWHB 3UZEA 1T1ZB 4OAWB 3IXAA 4U1HB 1RV6X 1RK0B 1NANH 1AC0A 2C4FT 3BO8A 3SDXF 3I3BA 1GOGA 4G8GD 2DLFL 2W9DH 1NMCB 2CIIB 3QUXB 4MXWL 4HK0A 2JCCA 1K8DA 2AAVA 2MNUA 4F8TA 4XNYH 2OP4L 2HLFD 5E8EA 2P8PB 5C71A 3FTGB 3QWOA 2XZCL 4NRXA 2ZJSL 3LKOB 2FL5B 5FKPB 4O2EA 3D3VB 4RAVA 3L6FA 1TIUA 3MOQA 4PTUB 3O6MH 4P2QB 3GKWH 1YEDB 2F15A 4AEHH 4HAFA 4OUUA 4WTZA 5I75B 3BJLA 1CK0L 5D2NC 2UZXB 2NXZB 4F3FA 2ESVA 3OHXB 2J8UE 4AM0B 4KVNH 5T1DH 1RIVH 2ED8A 2FWOB 2VOTA 4I0PA 5IUSA 1FAIL 1FPTH 2AJSL 3IETA 4HUUA 2KDGA 3K4DA 4P57A 5F3BB 4XBPB 1WSST 2VLLA 3S3JA 5B39G 3SKUD 4Y4FD 4QHMB 3O2VL 3TN0D 3RDTA 3PJSB 4JZNA 3NVQA 3X17A 5FO7A 5DQJA 5GS1C 1BD2D 3DROB 5J9PA 3MV7B 3FN3A 4TRPH 5TDNA 3NZHL 4FP8L 5CKAA 2BOCB 4H1LH 1ADQA 3PGFL 3KXFB 1QR1A 3MRRA 4TNWF 5HY9A 1ZLSL 3L5HA 3KPNA 1CFNB 4NZUH 3UXFA 2HFGL 4NQXA 5J1SC 4UQ3B 4EOWH 5JQHC 4HKJA 2A6IB 2Q1EA 1VSCA 1UXWA 3CFEA 3HMWL 1CGWA 1QPXA 5DMIL 2CRYA 1YEFH 4Z7UB 5C07E 4WEMB 1KB9K 2DF3A 5SWZE 1EFQA 3KPSD 2WSKA 3BZDA 4NN7C 2BVOA 5T3XL 4YHKL 3W0WE 1LE5A 5SX4I 2Q7NA 2CRMA 3SDCB 1L9NA 5EZJA 4RFNB 4LVHB 3ARFC 2DLEA 1AQDB 1IQWL 5CSZB 5FYLH 2LABA 3MRNB 4TTGA 1M6OB 4IHOA 5EFIB 1A1MB 1SHMA 4MS8A 4JO4H 3BSZL 4HW6A 2FD6L 1C12A 3H8NA 1B2WL 1OAUL 4O58L 4ERSL 1ITCA 3MLRH 5DJDA 5D96C 1T1WB 3TBWA 3QNZA 3ARPA 1S7TB 2A9MH 4GMSL 4Y4HD 4XPBH 3PHOB 4TSAH 1FNAA 2FJFA 3WFCH 3RVVC 2RR3A 1G1CA 3CFJB 5DVKA 3K2UH 1D9KD 2VXSL 4X9FA 5C0AD 3VFGH 3IVKA 3QIBA 4KDTC 5KVMC 2WBJB 3BZ4B 2BSTA 4HH8A 2B2XL 4U1NA 3NA9L 2HTKD 3QEGH 4WJ5B 5D4QA 3JSSA 3O9WB 3ZTNH 2F8XC 4JFFB 1WAAE 4D9QE 3S6CA 3HAEH 1VPOH 4FN0A 5D2LE 1Y6KR 4QYOB 1ZLWK 1VFBA 2XT1B 2XWJB 4ONFL 3GSNL 1KIQA 3P2TA 2XY2A 2WINB 4JN2B 4R0LC 3RHWK 1A6VH 3TBTA 5KS9E 1KB9J 3DHJA 2YPLE 3OX8A 5L2JB 3RAJL 1HIMH 2R23A 1OAQL 4MJ6A 5E5RB 1YN6B 4RA0C 1YQ2A 4QHNB 1J05B 3ROOA 4XB7A 3FONA 2XY1A 5F7FA 1YEGH 2C3VB 1DBKH 4JQVA 1DBML 1NDMA 2YXFA 3BXNA 3GJFB 3D85D 3MC0A 3D69A 4JB9H 5DJXA 2IWGA 4GG6F 4CMMA 1FAKT 4P59L 3MACH 2AK4B 5DRWA 4M7KH 1EO8L 5JORA 2D4FA 4WHYH 4Z6AT 1Y0LA 1AXTH 2KKQA 1K4DA 4K7PX 4Z78A 1BOGB 5I1JH 2O5YH 3FQTB 3BP6A 2D7OA 2LAAA 2XOTA 4XVTL 3TWCL 3GSXB 4ZPTA 5BZWA 2ED7A 1L9MA 4DEPC 1D6VH 4M43L 4LDLB 1YC7A 5DJ2A 4JKWA 3VD4A 3ILPB 4Y2DD 5SWQB 2KPNA 5L6YH 2Z8VC 2BOBA 5EULV 5F9JB 4ZNEA 1EGJH 1RUMH 5HI4C 1KB5B 4TUKH 1KJ2A 5D7JC 4I3RH 4ZAKC 2COQA 1NAMB 2R2HA 2GY5A 3LKPB 1ND0B 4WENB 4PB9H 5E2UL 3SE8H 4FQIL 3V6OA 2OMNA 1KC5L 3S35H 4PJBF 4KRNA 3NCJH 4HDIB 2P8LA 4X6EA 5J1AB 3LEYH 1AP2A 3UZQA 3WNOA 5AD0A 3X13A 2KUTA 1NGYB 5ESAA 4HCRL 3FQXB 3V95A 4WO4C 1WFNA 2EDJA 3RL1A 1M71A 4G8IB 3O4LB 3T1FA 3VXOA 1XR8B 4DW2L 1UVQA 3VGBA 1HHHA 3G5VB 5I76B 4QXTB 2EH8H 4APQC 3SGJA 4QCIB 2WQ8A 3CMOH 3OXSB 4I8DA 1T66C 2QHRL 3QDGA 3AUVA 3PHSA 2EDNA 4FZ8H 2ZP0T 4ZO8A 2V9QA 1KBGH 1CL7L 2BJML 4NJAL 3PL6B 1TVHB 3Q2CA 4WI8A 4NQSA 5DTFA 1JWSA 1QO3A 2X4RA 1IT9H 4PGBA 2A83B 4LKCA 1UB6B 5CINH 1KXTB 1JPSH 2WUCH 5E1AA 1DSFH 3O3AB 3TEUA 3BKJL 4U33A 5D7SL 5ETUB 3QFDB 1IAKB 4ZTOH 4PR5A 3UCRA 3QFJB 2VITA 3BGFC 1IAIL 1FBIH 2XTJD 5HGHB 1FNHA 3RWIA 2P5WB 4L4JA 5EBWA 1JYNA 2YSSB 4WU7A 2OL3H 3MJ7A 3QHZL 2NY5H 3GMRB 4OUOA 4RX4D 4H5SA 3NCYP 4F7PB 1WZ1L 3ZDYF 3DMMA 3VGAC 3GI9L 3W11D 4FXKA 8FABA 2X4TB 4IEFB 3V8CA 3I3EA 3IDMA 4EDWL 3CVHA 3BPNC 3TPUB 3CH1A 1HYRC 3HR6A 3TJEL 5GS0C 3C2AL 2DLTA 2CR6A 1JGUL 2XFXB 4PRBB 4IOIA 4OZHF 4PGCA 4L8DB 3UTTE 5E00A 3QDJD 1N5YL 2AABH 4OD1H 3MRGA 3S9DB 5FUZH 4EN3D 4Z7WA 4QTHA 1IGCL 4K2UL 1CG9B 2ZOKA 5EH1A 2AJYH 3R06B 1JP5A 3W9EA 2Z92A 4UB0H 3VJ6A 1LQVA 4IMLB 3GM0A 3SDAD 2FJGB 3I6KA 5TQ0H 3JTSA 1Q72H 5IB4A 4R7NB 3EO9L 2X1PA 3AM8A 1SEBB 2R9HC 4NQDA 5BV7C 5TGBB 2XV6B 3MRIB 4IRSB 4KJYA 2V7HB 4FQLH 4WWKC 1N64H 3TBSB 2IPKB 3HZMA 3N9GL 2FX8H 5CJXC 3N50A 4QRTB 3MYZA 3LB6D 1Q8MA 2MKLC 4DAGL 3K8KA 3J7HA 4NC2B 1SJHA 4G3YL 5CP3A 3MUJA 1SYVB 4MXVF 3CCHA 1AIFA 1ROWA 1DVFD 4JM2B 3WHE1 2A2QT 3GSQA 4LCUA 4NN5B 1T1ZA 2UYLB 1EVUA 3TYFB 5H8DA 2B1AL 3CNKA 3STBA 2B4CH 5TFSL 1A7OH 3BEVB 5C3LD 3VXPA 2F54B 1WT5A 4NNYB 4C56E 4EUPG 2YPKB 5DO2C 2IG2L 4NO3A 1BQHG 4Q9QL 1H5BB 3GK8H 1AI1H 1MIEL 5F1SA 3VXSD 5D1ZD 5EPMB 4DZ8B 2NNAB 5DHVB 3SDDC 3FTGA 1S9YA 3VMPA 1MWAL 2F53A 1H8OA 3MJ8B 5MEQB 4Q9BA 1KN2L 5DD1H 2I5YL 2ZCHH 4PTUA 4EBQH 1BZ7A 1HCVA 1MJ7H 1S8DB 1TQBB 2CXGA 2GTZA 4HGWA 1OD7A 4Y5VA 1A3LL 4J8RA 1RULL 4JO1H 3TT1L 3S7GA 1U3HB 2E7BA 1YYMH 3MCLL 3TIDA 4ODVH 4AM0A 5FYJL 3BP4B 5KSBE 4OBSA 1NMCC 3TA3B 2BNRD 3QCVH 4OM1L 4O00A 4NRZB 5E8OB 1X9QA 4J6RL 4NZDA 4WV1C 1FZMA 5ADOL 1DQLH 2RQ8A 3OXRA 2VXVL 3IS0X 1JUFA 4MCZB 5HHXL 1C5CH 3FJTA 1FYTD 5FA3A 3I6GA 3HE6D 4ZFFB 5IWLA 1XIWA 2DAVA 4KJQD 4MJIB 4PJAE 4A6YL 4YDJB 5DGQA 2QSCL 3DROA 1QFOA 2YWYA 4LEOA 4JJ5B 4U6VH 3WFBL 5E94B 4X6DF 5JDJA 5LJYH 4OBRA 1ETZA 1X6NA 4TQEH 4JO3H 3ZTJG 4NP4H 2X70B 4WW2F 3VXMD 3KPRA 4UQ3A 5TF0A 3FB6B 4Z76A 5DEGB 1HXMB 3TT3H 3UBXB 1BBDL 4PJDF 4N0CC 1YEIH 2AJUL 1ZT4B 5IT2L 5HHPB 1D5XA 4BKLB 1DR9A 4GMTH 5FA4A 1IC5H 1SM3L 2A73B 3DTXA 5AAWA 2IPTH 5HXMA 4NO0D 1MJUL 4KRPB 4UT9H 5HYJD 4XMKH 4WUUE 4WFED 5ISZE 1MNUH 2ZUUA 5HGAB 1R3HB 3RUGE 3SDCA 4H8WL 4ELKA 4HQQH 4L8CA 1D5IH 5T1LA 5GQBA 1GAFH 4LCWD 3NPSB 1AQDA 2VE6B 1P7QA 4E0RB 5ICYA 5EFIA 1A5FH 4MNGB 3QDME 5SWSD 1CD9B 1A6TB 1IGMH 3HCVB 4GW4B 1MRCH 3O2DH 5GGSA 3ESUF 2AJXH 5EU4B 3GSNB 4HJGB 4N0UA 2C7UB 5FYLD 2NY0D 2NX5E 4KFZC 3KPQB 1TJGH 3HUJB 2AV1A 3IJSB 5BS0A 3NZ8B 1DUZA 5L88L 2V5MA 2E6QA 5D8JL 4RFNC 2HG5B 4LVHC 3V0VB 2BRQA 2WUBL 1K6QL 2APFA 3MREB 4U1JB 4WJ5A 5I1DA 3O9WA 1G9MC 3UJIL 4N9GA 3QUMH 3TF7A 3I9GH 1LD9B 2IBZY 1WFUA 4W68A 4BSVB 5F8QC 3T8XA 1I9JH 4J3WA 3BDYL 4TYUA 1R5VB 1A7QH 4MCYB 2DQEL 3D39E 2H32A 3BH9A 3UYRL 2PTTB 1HQ4B 3LQMA 3I85A 4UDUA 1P7HL 3ULUC 2H3NA 2A1WH 2PO6A 1QNZL 3HRZB 3RGVC 4QOKB 4HS8H 3U82B 1S7UB 5L2JA 4GRMA 5GGRY 1RJLA 4GW1B 4F7MA 1OGTB 3EKCA 3CK0L 2PCPA 4QHNA 4R4FH 5BQ7B 1HEZB 2IPUG 5KVFH 1QHPA 3BPCB 4L3CA 1NEUA 5DI8B 2NR6C 2IADB 3DVGA 4I4WA 4L4TB 5JR1L 4Z7VF 4EIZC 5DK3A 2ZG3A 2H41A 1ADQH 5E6ID 1T04A 4N1CA 2X4UA 1QSFE 1RD6A 5IGXH 1T1YB 5D1QD 1BZQK 1G7LB 3TCXA 2YEZB 3ECBB 1SYSB 4PJGB 5MP6H 4JPVL 2QADC 4LEXH 1I3GL 4I2XA 3P4NA 1MREL 4ZODA 3W2DH 1J1OL 3MRJA 5F9JA 4NDMB 4O02L 2L4OA 3D0VB 1OB1B 5E70A 2UWEB 4NGHL 2PW1B 3ARVA 1FVCB 3QI9A 1P6AB 2W65A 4ODUB 3B2VH 4WGVB 1I4FB 3T0EB 3TO2A 2OYPA 5CJOH 3T3PE 4HDIA 2DD8H 4CW1A 4PJHA 1S7WB 3WFEH 2XI9A 3C5ZB 2VN4A 2AJVH 1ITBB 5EORH 4OFYA 4J7RA 4KTDH 5F6IB 5C08D 4I77H 1IEHA 3FQXA 3O8XC 4ZFZA 1TQCC 1VDGA 1WEJL 5HYSG 5FM8A 2EDKA 1XGYH 1DP0A 4QNPF 4KUZH 1XF3B 2Z35B 3WIFA 5B8CA 4Y19E 4AEIH 4PDCE 2DBLL 2EIEA 4QCIA 3ZE2F 4S2SA 4P9HC 4YGAB 3L3OA 3IDGB 1ORQA 1AGCB 1T4KB 1B88A 4HV8B 3D48R 1ZT7A 5I71B 4J3VA 3ARZA 1TVHA 3Q6FA 4O9HH 1CXLA 1A7NH 2VDRL 1REIA 3W81A 4F7TA 1UB6A 1NEZB 4HF5H 1YNLH 4TN9A 5HHQA 1IE5A 1TVBB 4XAWH 4D0DB 2Z8WC 5ETUA 1IAKA 3D3VE 3F7VB 1W2KT 4A2LA 3WJLC 3ZKND 5C0GB 4P2QE 4LLQA 3I2CH 2CGRL 4H20H 4J3UA 2KBGA 2R56H 4RGNC 4XGZB 4U1IA 4DOHB 3C5JA 1BQLH 1JMZA 1J88A 4PRHB 4JPKH 3MRHB 4F7PA 2GSIA 2BRRL 1CBVL 2CKBL 4HZAA 4JFZL 1U6AH 3BQUB 3WLWC 3INUL 4PIRF 4YUEH 5A1AA 2X4TA 3O3EB 4HWNA 2LTQB 3B9KB 4J3OC 3T77A 3T3MF 1XCQB 1PYWB 1T2JA 1SY6A 1GGBH 3JV5A 1RPQA 2Z93B 3IS1X 4U1MB 4LU5L 4ZOBA 3LV3B 3JUZA 3QIWB 4BK5A 3ARSA 2APTA 5EOCL 5IB5B 1IARB 3THMH 3A0OA 5HGGS 1U8HB 5DK0B 4FG6D 5FUOH 5FGBA 2IAMD 3SCMB 2J8HA 1RUKL 2AI0H 1IC4L 4PG9B 1QLFB 3QUZB 2OTPA 3MV7E 4S1DC 3UP1A 1VA9A 5FOJA 1ZGLP 4TVPE 3KXFE 4OZIB 5LWYL 1YEJL 2NXYC 3U9PH 2GJJA 3NFSL 3WO4B 2P1YA 2P43B 1FZKB 4IMLA 1KJ2H 3HE7A 3SKNB 5B38A 3DETD 3VH8G 4XCFL 4UNTA 1XF4A 4LLMA 4GKSA 2XA3A 1RIUL 3RRQA 4TTDC 4Z7UE 3U7WL 3TIEA 3BE1L 4I3SL 1WLHA 2DYPB 2R0KL 3TBSA 4CN4A 3FMGL 1T03L 5B39B 4AEEA 4UU9B 4EXKA 3IDNB 1OGAB 1RK1B 1F4YH 1J5OL 7FABH 5C07D 4QRTA 2XQYK 5SWZD 3W39A 2C1PB 5D5MA 2APWA 1KCVH 3W0WD 3MOBL 1MWAB 4L9LA 4PRIB 4G80A 3SKOB 4Q9RH 1J18A 2VDLL 4AYFA 4ZXBD 4ZUUB 3R8QA 4B41A 5D70L 1JHLH 1A1OB 3W9DA 3X3FL 3S8WA 4NQCB 1HI6A 2P5EA 4OF5A 2AERT 1YEHH 1CDCA 3K81A 4ZD3H 4G6KL 4IRSC 4MSWA 2F54A 1J1PH 2HT3C 2MPAL 2IC2A 3IF1A 3CD4A 1ORSB 3LZFH 4YQXL 4WGWB 3QJHA 4LARH 3MA7A 1F13A 3FT2B 1RHHB 5GS0H 3NFNA 2NYYC 5JZ7C 2FX7H 1AGFA 4MA8H 1FNSH 3PP3K 4JVPA 3KYNA 3SE4A 1LILA 3MJ8A 4JFFE 5KN5B 4R90H 3MLSH 4JM2C 5FK9B 5F9OL 2E9JA 5I30L 4A6YB 1S8DA 4KPHL 3CDGA 5E7FA 4RGOL 1IAOA 4WIQA 5TE4L 4LCCA 1EO5A 5E7BA 5BXFB 4JM4H 4D9QD 1RUAH 4ONOA 5HD8C 5IFAL 1DE4A 3OTTA 4LVNB 2FJHA 4M48H 3BP4A 1E4XH 4LVEA 2W91A 1GGTA 1ZLUH 1HXYB 2CLZB 1H5BC 5CZKA 5E8DH 4S1SL 3RZCD 2VMFA 1IFHL 3GMMA 5BV7H 4V3DB 1NCAH 3JWDL 2YPLD 4KTEL 1CFSA 4PGZA 4H88H 1WC7B 4XH2A 2HKFH 4ZFFA 1RZGB 1F4WH 2AK4E 3CSGA 4IRJA 4OQTL 4YDJA 3IFLH 1ZHLB 2Q86B 1U3HC 4RA3A 5J1TC 4K3JL 5KZCD 1MFDH 3TV3H 2MTPA 1K9TA 2CJUL 4JCMA 2AV7B 3Q48A 3TA3C 5IB3B 5CEYA 2PYEB 4FQCH 5BCAA 2X4OB 2YBRA 5BO1H 2MKWA 2XKNA 1E4WH 2BSSB 4P2OB 3PQYB 5DEGA 5AG9A 5F21B 4DGVL 1U95A 5HYIA 5HHPA 1BMGA 4U6YB 1I1FB 2ZG2A 3FHQA 4NZJA 1KTLB 4KI5C 2F5AL 4FQXB 1NUNB 2WNGA 2OR8A 5JHDB 1F4XL 4Q6IA 2I9TA 4YX2H 2AEPL 1EK3A 3V0WL 4G43A 1J1XH 2CK0H 5CLWA 2IQAB 2VE6A 2GW5A 2MHAA 4HX1B 5ICXB 4E0RA 2ENSA 5HHMB 4PJIB 5IK3B 3O4LE 4HC1L 1NKRA 1INDL 4PGDA 3RX8A 3HCVA 1NBYB 1A7RH 3L5XL 4GS7C 4QWWC 3WS3A 4ZPVB 4POUB 1PFCA 1KJ3H 5DHYB 3MRDA 4YFDB 4PGEA 3F58L 3BX7C 2YA1A 1WIPA 1MCOH 1A3RH 3DURA 3EO0A 2HLAA 4RFEB 3SY0A 1EZVY 4ZUWB 5HPMA 4LFHD 5FO8A 2LE9A 3DVNB 4RMTA 2HG5A 1KTDA 1OM3L 3NPSC 4GRLD 5ENWA 5EUOB 4KWUA 2WMPA 3DXAB 4QXWA 3FQRA 5IJKA 2WIIB 3ARDC 1HNFA 4HEME 5LKNA 3TZVA 5LBSL 3O81A 1IKFH 3QFJE 4BSVA 1EEYB 1JZ7A 1I85A 1MH5B 2P5WE 4MCYA 1AHWA 4LNVA 5K9JH 3GBML 5IHUL 1VHPA 1LEIA 1XZ0B 4P2RB 3UJJL 2VZSA 3TO4B 1GGCL 1XGUB 3U83A 4K3DL 3H0TB 4P46C 4LF3B 4RAUB 5DT1L 4DVBA 5IQ9B 1HDMB 3B43A 2N1KA 3BWAA 3ZMRA 3SJVA 1QFWL 3AREC 4JHBA 1ACYL 3TPUE 5KJRL 5BQ7A 1WZMA 4AT6B 2CSPA 2GFBB 5ITBH 1F5WA 4K3HA 2IADA 3QG6B 3LIZL 5GGUA 4OZFG 3MGTA 3OAZH 3TH3T 4TVPH 5DGRA 3UTZA 1Y18B 4U3HA 4PFEA 1G0YR 2N56A 1G7LA 2VQ1A 3OG4B 4Y2OA 4U7SA 5BOPA 1RZJL 1SYSA 2VB5A 3BPOB 3WHE0 3LRGA 1P7KB 2I60L 4LBEB 2Z31B 2RCSL 4MJ5A 2CO6B 1FVDB 4KROC 1I7UB 3ARFD 5F9AC 4WI4A 3D0VA 2PW1A 2VIRA 5D6DC 4DJMA 1N8ZB 3WSQH 3WUWA 1ES0B 3L7FB 4HH9A 3KYKH 5L8LB 1V3JA 4RMWA 2HVJA 3FQUB 3UJTL 1I4FA 1Q0XL 2NY7L 5JA9A 1Q1JL 1U8QA 4D3CL 1W72A 4X0KA 1G9MH 3ZT6A 3N1FC 1AR1C 3DUUB 4XP9L 3RVVD 2NW3B 2EECA 3EIFA 3WIHA 5DUBA 2VYRE 43C9B 3IJYB 2Z35A 4JFYB 5IVXE 3ROLB 5D2NA 2VJXA 4HPOL 4DKFH 4MS8D 4QRRB 3SKJH 1BEYL 3LQAL 1J12A 1AGCA 1T4KA 2LV4A 3T0EC 5AZ2H 4NN6B 2XYCA 2UZIL 5HBBA 3VFTB 4BA8A 2A0LC 4V1DB 1G7JA 5IQ7L 1GGIH 4Y1AB 3C5ZC 3H9HB 1DBAL 1JNLL 3O0RL 1YY8B 4UQ2B 3MYJB 3L7EB 1MAMH 1AO7B 3MFFB 4KKLC 4YC2B 4C56D 4ENEC 5C2BL 2D31B 1P5VA 4F15B 4I48A 2H1PH 3HC0B 2XWTA 2DDQH 1MPAH 1HOCA 2H26A 3LPGA 3V9FA 4JANA 3GKZA 4S0SD 5IHZA 3O41A 5DYOB 2Z4QB 3NGBC 3GSOB 1R3IH 1QQDB 5I1KH 5A3IC 4AENA 1LO5A 3KYOB 2VUYA 3QUYB 4PPTA 2X9YA 2DQGH 5F44A 3R0MA 2WLYA 3ULVF 4OCLC 5JUEH 2W92A 3BN3B 5C09B 2FIRT 5I71C 4GXUM 3BQUA 4HIHA 4MVBC 2V7NA 1KACB 1A0QH 2B0SH 1NC2D 3O3EA 1PY4A 3RY5A 1T5WA 3QQ9C 4EUPB 2EYTA 5I8OH 1XCQA 3CSYB 3WDIA 4X9GA 4YXLL 3GJFH 5T3ZL 1BQHB 1EXUB 3TVMB 1WCBA 3QIWA 4K7FB 3QEQA 3QZWG 3GMPB 1T22A 5CBEA 5IB5A 1H3TA 3G04B 1IZJA 5T3XE 1DFBH 4KI5E 4C57C 1U8NB 4MJIE 4XC1H 1GC1C 1ZSDB 2VZ3A 4JFPB 5GGQH 3WS6C 4KK5C 2YR3A 1EBAA 5D7JD 4D9LH 2H2SC 4O5LH 4ZAKD 1OP9A 2SEBB 4QRQA 5EA0H 2W9LA 4OZIA 3C6SB 5EU3B 3LKNB 4XPGH 3B9KC 3FB5A 2GHWB 1GH7A 5CHNB 3H42L 3M07A 3WJJA 3BN9C 5K9QG 1KB5H 4HWZA 1FZKA 1NUDA 3GFUA 4N5EA 1LVEA 4ZUTB 4G6JH 4P9HH 5KW9H 4HXBL 4FZEL 1NAMH 32C2A 1J8HA 2ARJA 35C8H 4I1NB 5JQ6H 1WK0A 1BREA 4LRIC 3SDXB 4HWEH 1T20A 3LEVH 5DMYA 5F6HJ 4MDIB 2R0LL 4CAGA 2B20A 4UU9A 3SCMC 4APQD 3QUZC 4L8SB 5JHLH 3C08L 4PV8B 1T66D 3BI9X 2A9NH 3WV0A 4GW5B 4Z7NF 3B6SB 3DX9A 3WO4C 1WGOA 2X1XR 4PRIA 4WUUD 1WQVT 3SKOA 2CIKB 5ISZD 4N5UA 4MNGE 3GIZL 4RQQA 1CL7I 3CVIH 5FCUL 4XWOC 1IQDA 4J1UB 5TDOA 1U8IB 2W0KA 4OT1H 4X8JA 5ID1B 4OGXL 2X4SA 3QDMD 1RZKC 2P24A 5CSBA 1NC4B 3AS0A 5AZEH 3CPLB 5LVEA 3P11H 1UACL 3HUJE 5JPNA 3U2SB 4O51A 1ORSA 4P4RB 25C8L 3LD8C 4PJEA 1IAII 2Z8RA 3RWDA 3QHFH 2DQIH 4B7IA 2NX5D 2CMRL 4YDIL 1RHHA 2AK1L 4C58B 4JN1H 5IROC 2FO4A 1TFHA 5CZXD 5C0NC 4I5BA 4XCYA 1A14H 3EUUA 3HNTL 1KT2B 1WV7T 4NKIH 5DD0L 1F8TL 4PJ8A 4A6YA 1P53A 2JJTA 5DRXB 5GS0D 5KVGH 1CWVA 5E99L 3AMKA 4WEBH 3HI5L 4MQSB 5EZLA 5C0CE 2ITCA 4JQIH 1FGVL 2EZ0C 4QOKE 1SY6H 3D39D 2CLZA 9CGTA 2ZCLL 2BNQA 2MCG1 4QXUH 3FRPA 3RPIA 3PGCB 1T1XB 1AKJB 2EKSB 4NCC1 1YNTB 1KFAL 4ZS7L 4J3TA 4PTTA 1NMBH 1YEEH 2OR9L 3EZJB 5FXCH 1X5AA 2VABA 3O6KL 3FOLB 4TNVF 4L4TE 1WC7A 2FR4B 3AAZA 1QVOB 5IMOA 5JW4M 1FDLL 4JGJA 3B5GA 5H2BB 5DVMA 2XZAH 5F1IB 2KZWA 4U7KA 1C5BH 5LGHH 1ZHLA 2JELH 2R9HD 4L9DA 2YD6A 3RA7H 4Z9KB 4DWHA 4EXPX 2ZNXA 1CFQA 4MA3B 2BMKA 3PWNA 4JKLA 4LVNC 3KLSA 4WWKD 4WCYL 5EBLB 4PG2C 4G7YH 4WO4A 4MZ3A 4PJGE 2NMSA 1MELA 3Q5TA 5IIEB 3GSVA 1LK2B 1QSFD 4GOSA 1YUHB 1G6RL 2GUOB 3QEUB 4OF7A 4MXQC 5DJ6B 3JZ7A 2MQ3A 1E4KC 2EKJA 1JZ5A 2UWEE 4HFWB 4X98A 3TBVB 2DLFH 3QXAB 3WCYA 4MXWH 1J7VR 1I1FA 2AXFA 3BUYB 4O2FB 3MRPB 4LP5A 5JLZB 3T0EE 2H6PA 5JHDA 4XPTL 4H8WC 2XZCH 3WNMA 4NJ9L 3MGOB 2UY6A 5FIEA 5H37G 1RURL 4YHLL 3L5WA 1EHLH 4MLIA 4JFQB 2VDKL 3BZFB 5DO2D 3ILQC 2RB8A 4WTXA 4IOFC 5AG8A 5IK3A 4JFXA 4YK4C 1NLBL 1EAPB 1T0PB 5DJCB 2DB8A 1IAMA 3OB8A 3SDDD 5IG7A 2CLVB 2JIXD 2R2BB 4DUVA 4JCLA 2J7LA 5I1AB 3RWCB 4JY5L 2AKRA 1FAIH 4FQXC 1D5ZB 1U91A 2AJSH 1JWMB 5DFVC 4ZUWA 4Y19D 4GRWE 2FZ3A 3GEWB 3U9UB 4U6TA 1NGZA 4P5MB 3NCEB 2X4QB 1MOEA 3QR2A 2AEQL 3O2VH 4JAMB 3K0WA 1DTUA 1QRKA 3QUXD 2XPGA 4GG6B 4NT6B 1JN6A 1KCUL 1JRHI 3DO7A 3D2UB 4HWBA 5C3TA 3VW3L 3NZHH 4NHCL 4F57H 5T1KD 5DMGC 3RVUC 3PGFH 5HYSB 4DOHE 2ATPB 4P2RA 1ZLSH 3D3VD 3D0LA 2GJ6B 4PRHE 2HFGH 1F3JB 2PNDA 1MHEA 4P2QD 4R4BA 5DJYA 4P4KB 3WDHA 3VWJB 4HIXL 1HDMA 5ICZA 3RJQB 2BP3A 2NXZD 2ADIB 3HMWH 5DMIH 2CD0A 3VD9A 3IDXH 1VFMA 1NQBA 3LN5B 4YHKH 1QPPA 5DMJB 1A6AB 5JDSA 3EOTL 3AROA 5A2LH 5DJ8A 4CVWA 3CDFA 2CDFB 5DJZB 3TO4C 3KHQA 4YHPB 4N0CD 1NFDA 3L3IB 5B3JF 2E6PA 3BSZH 2FD6H 1L6XA 2NY4B 1B2WH 1OAUH 4O58H 2C4XA 4NZTL 2W0FB 4ERSH 1YN7B 2G75B 1P7KA 4LBEA 3MV7D 2JJWA 4R7DB 3EW3B 1FVDA 5T5NG 4TVPD 4GMSH 3KXFD 1G7IB 4W70A 4X4XA 3WE6B 1EX0A 4OD2A 1ES0A 1J0HA 3C8KB 1FLRL 2VDOH 1RZ8A 2B2XH 1OGAE 3KLHC 3NA9H 1F3DJ 1TZIB 1K8IB 4NCDA 1TZGL 2A74A 3HKFA 4DZBA 3VFPA 3CX2A 5I1CL 5DDHB 2R1XB 3EYFA 3DUUA 4X4YA 5L7XL 4RMSA 4URTB 4XNQA 4LL9A 2PW2B 5CIPA 4F9LA 1CFTA 4Y7MA 2Z31C 4ONFH 3GSNH 4YGVA 2NQCA 4NNPL 3IJYA 4NQCE 4JFYA 5BRZB 1ZHBB 1PSKL 5F7WC 3RAJH 1UH4A 3VH8B 1KV3A 4MYWB 1OAQH 4XB8A 1D5MB 1KJMA 5IR1A 3O3UN 3VFTA 1P9MC 1LHZA 1BHGA 4ZFOA 2BC4B 4Z7WF 2JF1A 3B5HA 5JNYB 4JO2L 3H9HA 3IRZA 3ZDZE 1DBMH 4R96B 5GRWA 3A6OA 4OIIL 1JZ8A 2PTVA 1TXKA 1ZXQA 5DD6A 2MMXA 4OZHB 3BHBB 3EJZC 4AK1A 4NZUL 1ONQB 1INQB 2WBJD 3GHEL 2EE2A 4P3DB 3MRLB 2Z4QA 3GSOA 1FN4B 1QQDA 1R3JB 3TWCH 4XVTH 2D7TH 2EDFA 1T7VA 2HFEB 4JFFD 4WVRA 4M43H 4OM0L 4NQVB 2FATL 3QT2A 4X99A 2FGZA 3OF6D 1FRGL 5FEBA 1MLBB 4BFIB 3AC0A 2PR4L 4GXUN 5I1GL 3DVFA 5L2KB 1TJIL 1TTUA 1I1RA 4RBPK 2EH7L 1S7SB 3CSYA 1K5NB 5E2UH 2GTWA 4FQIH 4F15C 1EXUA 1T80A 2DQDL 4XI5C 4XBGA 4YAQA 1KC5H 2DWDB 3OPZH 3TPKA 2QADD 4KMQA 3O6FA 3IRPX 4XVUC 3G04A 3T09A 4F7CB 1SBSL 1QBML 1U8NA 2EYRA 4Z0BL 1AXSA 3BZEA 3KJ6L 1CE6B 4HCRH 3GUTA 4F37F 4F7EA 1ZGLB 2A6JB 1HHIB 1CXKA 4DW2H 2AK4D 1MUJB 4TSAL 3WFCL 2VC2L 3LKRA 4D9RE 2PYEE 4HS3A 1FJ1B 1AE6L 1C7SA 3S36X 4NSKB 5GGVL 5F6HI 3VXUA 4JZOB 3VFGL 1EEZB 3F7YA 3J8F7 2QHRH 3TVMC 3PQYE 3P9MB 2JJUA 3IKCB 1OT1A 3ZTNL 5BW7C 2BJMH 4NJAH 1A2YA 5GISH 4M6OL 4HUVA 2GCYB 3VFOB 4PB0H 4MDIA 5DWUL 5ANMA 4J4PA 4HS6A 2MWCA 5B3NA 4JE4B 3BKJH 3S34L 4K8RH 4TSBH 5D7SH 4OKDA 4PV8A 3C60B 4KQ3H 4Y4KC 4P5TB 1XEDA 4ELMB 1PX4A 5KSUA 5HHME 4XNMA 2J6EA 4PJIE 3EDDA 3ZKSD 5HPOA 4GG8A 5GIRA 3O2WL 3QHZH 5MHSE 1CT8B 4OFYD 4UV7L 1G9EA 3GSRB 5MEOA 2I07A 5ID1A 1EH9A 1T5XA 4BFGA 5TF1L 3GI9H 4M1CC 3O4LD 4F9PA 4U49A 3RGVA 3QH3B 4GAGL 4EZMA 3DX6A 3U2SA 3B2UD 2JJSC 5DMKB 4X7SH 4L8SC 4YFLF 2E9WA 4HBQA 3C2AH 4QY8B 4PRNB 5EUOE 1JGUH 4OZGA 3DXAE 2VZTA 1CXIA 4ODHH 3FT3A 4WEUD 3PL6D 3WLWD 2QQNL 1N5YH 4PRAB 3VXRB 3V6ZB 2VLKA 1QHOA 1A6ZB 3RY4A 2G5BA 4Y16C 5MEPA 3DGCR 4DN4H 1IGCH 2VXQH 4K2UH 2B39A 5BVPH 3EDJA 1Q94B 2MJWA 4GBXC 3QFJD 1NCCL 1NBZA 4NC0B 4V2CB 4X6DB 5J3HC 4LIQE 2P5WD 3QG7L 3MLXL 4Q2ZA 4WW2B 3EO9H 4L8BA 2Q3ZA 3LEYL 1G6RB 1DEDA 4S1DD 3L3HB 1RVFL 5AYQA 1EJ6A 1BVLB 4MAYA 4PJDB 2ZUYA 4M93B</