5B38G

Kir3dl1*005 in complex with hla-b*57:01
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
287
structure length
273
Chain Sequence
b'KPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTSYQLSAPSDPLDIVVTGPYEKPSLSAQSVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGGTYRCFGSFRHSPYELSDPSDPLLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Killer cell immunoglobulin-like receptor 3DL1 polymorphism defines distinct hierarchies of HLA class I recognition
pubmed doi rcsb
total genus 54
structure length 273
sequence length 287
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b38G03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b38G02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b38G01
4D8PA 4OM0L 4AENB 5T1MA 5KSBE 3EOBA 5T1KA 3D39B 4WFFD 3TO2B 2A2QT 4PV8B 4ELKB 1OGAD 1XF3B 1S7SA 1HHJA 4LK4A 2VDNL 4KGJA 5TE6H 4KRNA 5DT1L 5KSUA 4I48A 3MLPA 5E1AA 2XQBH 3GMOB 3TH2T 4B0MM 4N0FB 1A6VH 1BM3H 2MHAA 4XP9L 4ONGH 3OKNB 2DQEL 1LEIA 3KPTA 2UWEA 4L8BB 5F9AC 4X0KA 2X89A 1AGBA 3IJSB 1IBGL 4HC1L 1CGSH 5ALCL 3MNWB 5HI3C 5F6IC 2BNQD 4PY8J 5C0IA 4EOWL 5HVHC 3UTSD 4WVRA 4MB4A 4GG6F 5E5UB 3FO1A 4CMMB 1T66C 3IKKA 4ZAKB 4F7TB 3WXVH 4EDWH 2ADJA 2R2HA 5KJRH 1F90H 4KK5C 5IV2A 5FK9A 3GBMH 3B43A 1UXWB 3F62A 3IDNA 4PD4J 5C0BD 2Z4QB 4UT7H 1MCJA 5LCVL 1ZGLM 2V9TA 4IS6A 1FL3B 4NQSA 5IG7B 2UV3A 3O2WH 2FO4A 1MRCH 4HXBH 4XAWH 4PUBL 4YE4H 5FYJD 5IROA 1NGPL 1EEUA 1OP3K 2FEEL 5IFJB 1IM3B 2EE3A 4L4VB 1R6VA 4GAJL 4M62H 3EDFA 2AERT 2YUWA 1MHHB 1PKOA 4LIQL 1X5AA 4J23A 5IB3B 3RUGE 3QQ9C 3SCMD 1VCAA 5T3ZL 3AMLA 5GJSL 3O6FA 4OZ4B 4YQXH 1M6OA 4FZ8H 4L9DA 4KH2A 4TVSa 3EFFA 5I66A 4ZUTA 4KK6C 4HSQA 5TQ2H 4LCYA 4PJHB 1KEMH 3P11H 1TCRB 4QXTA 1I1AA 3B9KA 4APQC 1G9EA 12E8L 1OSPL 3BEVB 3HC0B 1XCTA 3DROB 3G6JF 5GGUA 4HKXA 3MRCB 4JRXB 3TVMA 4UQ3B 1RFDH 5C09D 2EDWA 1S9XA 1CU4L 4HXAL 5DHVA 4F57L 4Y2DC 4YHOL 4BQ8A 4PRHD 3VXOB 3QXAA 5D7JA 1DQMH 1KACB 4HIXH 1S8DA 1KB9J 3FQXA 1BAFL 4R4ND 5DGQA 1T89A 2AK4B 4RFEB 4DW2H 5IWLC 4BELD 4S1DD 1FLRH 3GBNH 4OFKA 4LVOC 2GT9A 4F7CB 1TTFA 4NHCL 3IF1B 4YHNB 2V5SA 4NQVB 1QSFB 5DRXA 3PF2A 2EDQA 5HHNA 3RZCB 5CMAA 1NDMB 3TV3H 4O02H 5GS1B 1FFOB 2WUCL 3G6JB 1ZT4A 3VFRB 1JZ2A 3VWJC 3WNLA 1S9VA 4PRDA 4R26L 2HTLC 3PDDA 5IMOA 4HK0A 1TENA 4I2XE 5E9DB 4MSWA 4WNQA 3KYMA 3BN9C 3I85A 3MV7E 3P0VH 4ORGB 4LP4A 3VWJB 1OAXH 3MACH 1SJXA 2BHZA 4BFBD 5FO7A 2GTZA 2WIMA 5FEBA 2AXFB 3SDXA 1JGLH 5F7LB 4WV1A 1NCBH 1U91A 4ELMB 5BQ7A 4X80L 4Z7QE 2B5IB 1YYMH 2C3GA 4LDEB 1FZJB 3QUML 2AV7B 1J1OL 2FR4A 2DLFL 4G8GB 1SYVA 4NO0A 3CDCA 4LPWA 5DFWH 3MMEA 1TZIB 3BI9X 5EIQA 4NO3B 2G9HB 1GRWA 6FABH 5MERA 1N64H 2DQUH 4XXCC 5DRXB 3D0VA 2UZYB 3QUYC 4ENED 1JHTA 4Z7WE 1YJDL 5FOJA 1DQDH 1T0NA 4YUEL 5EUOA 4OCRH 4RWHA 4TOYL 1NAKL 3SBWC 4PG9B 3SE8H 4GMTH 3SDYH 1INEH 3WJJA 4YBQC 1RJLB 1BVZA 4WFHD 3QUMH 1KCUH 4NWUH 2DBJA 3IF1A 3SQOH 3PP4H 4M5ZL 3TZVD 3RTQB 3ZT7A 5I74B 1EEZB 2E6JA 5LWYL 3IB4A 5DD6A 2CDEB 2VXSL 4G80A 3T4YA 2R1WA 4WY7L 1DLHB 1WT5A 3V8OA 4U3HA 1IGIL 3L5XL 1S7WB 1X4XA 5F7UA 3DIFA 5C0FB 4YHLH 3HUJB 3MACL 3PV7A 2PYEE 1F4WL 1N0LA 4P4KA 1KN2H 5IW6B 4OSUL 3QPXL 1FDLL 1MNUH 3QEQB 4WW2C 2AV7A 1UWEL 2VWEC 3QDMD 2JF1A 2DBLH 2LVCA 2A6DA 2BFVL 2XG5A 4OBSA 5IKCB 2C4FT 3GIVA 3O6KL 3KPSE 3IDGB 1QFUH 5JOFA 2JJVA 4Z78A 4LEOA 2B4CC 2B39A 4W6WB 4G7VL 3VCLA 2V5YA 3RWCB 4LSDA 1JPFB 1JHTB 2ZOKA 4XTRD 3QNXB 2Y1VA 4L4TB 2ADGB 5C0RL 1NC4B 3A67H 1MH5A 1NCCH 1MREH 2A1WH 5AZ2H 5MEND 3R0MA 1INEL 3ALWA 3KXFE 4XNMA 1PX4A 4J3VA 3AREA 4ZTOH 1QPPA 2DRUA 2FB4H 1F4WH 3BP7B 4F80A 3JWOH 4XC3L 4PJEB 1YMHA 4YHLL 2CSPA 3LY6A 4KK5D 3FB6A 3U7YH 3U0WH 5FUZL 2FZ3A 3RY4A 4ZFGL 5M7QA 4PRHE 1FP5A 4KJQD 1CLOL 4LBEA 5INCA 4FXLA 1L0YA 3TEUA 3LRSA 4PP2B 5F1IA 2AAVA 2ZUVA 2WBKA 4NNXA 3T2NL 4CGTA 5B8CC 3CFBA 3ARFB 3HE6C 2CRIA 2R69H 1I3VA 4XPTL 3NZ8A 1I8LC 1QLRB 1MI5E 4KKAC 1VPOL 5DD5H 4FFVD 4UINH 5CEZH 2VDOH 2VKXA 3ZE2E 5GJTH 1CFTA 3LZFL 2YD3A 2ENSA 1E4JA 4RAUB 4RWYL 1Z9MA 2NTFB 4QHNA 3T08A 1JRHI 5HI4C 1ODAA 4KK8C 4JGMA 3QWOA 1T04B 3U7WH 4U6VH 3F5WA 1HDMA 4EQ2A 2EYSA 4ZAKC 5EOQH 4KK9C 5KSVB 3GBML 4K8RC 3NFSH 4QGTA 1IZJA 4ZO9A 2LQRA 2EDJA 4XP5H 2HT3D 2OBGA 4M3JA 1G84A 3TT1H 3MV9D 4X7TB 4N0UE 3MUZ1 3LEYL 1A9EB 4XCCH 2F8XC 1A7OL 3Q3GA 3RWHB 5HHQA 1SJEA 4KUCF 4N0YL 1BQHA 1MWAH 1ZLWK 1T5WA 3MRKB 2X9YA 1KIQA 3VXMA 3CVIL 2G2RB 4RSVA 3TA3D 4KJPC 2HJLA 1IEAB 3T0DA 5F9WB 1JYXA 4XCFH 2C1PA 1RK1A 4OZFG 1G7QA 3BO8A 3HHRB 3CLFH 3VXSB 5KOMC 1HZHH 2C3VA 2HJKB 3H0TA 4Z0XA 3T1FA 5I1CL 2GCYA 4O02L 4YHOH 4NKOB 5JW4Q 1QLFA 3QEUB 1YN6B 3S35L 4M7ZB 3IFOB 1S3KH 1ITBB 3BHBB 2YMXL 3QXDA 4AL8L 1PJ9A 4Z95H 4TSAH 3VGDA 2YEZA 2XG4A 1A14L 3S3SA 4HPYH 2IH1A 3STZB 5HPOA 2CLRA 4I9WE 4KRPC 2B5IC 2VO5A 1CYGA 3ZKMC 4O2FB 4I18B 4JFHD 1UB6B 4XPGH 1HH6A 2NQCA 2V17L 1DBKH 3WNNA 3VD3A 1SY6L 4UQ2B 1QO3A 2GSGA 1R5VA 3EFDH 4MD5A 5E9DA 3LS4L 5F1SA 1IFHH 1U8OB 3VXMB 3ZKQD 4RZCA 2VZSA 4CL7A 2ZCLH 1J0ZA 1MFBH 1SM3L 5DTFB 3O2DA 3OKMB 1ZV5A 1HKFA 2WNGA 5DHYB 5J06A 1DUZA 1JRHL 4JZJB 4XVUC 4WRLA 2IF7A 3S36X 1S7UB 2H9GB 4XBGA 1V3MA 4HT1L 2HN7A 4X7FC 4X4MA 5SWZE 1UT9A 3MRRA 3TBYB 4XWGL 5CJXC 1QP1A 1IC7H 4KVCL 5J11C 1X5XA 3B6SB 2E9BA 4O9HL 4WTWA 1H8OA 2V2XA 5F7EH 3LAFA 4OKVA 4YAQB 2CLVA 3ARGA 3DX6A 2QHRL 2IH1B 3STZA 4ZUVB 3RWDB 4H20H 4JLRB 4FZEL 4NNYB 1QA9A 3FKUS 4PTTA 1WFTA 5CZXC 2KBGA 5DLML 4LPUA 5E99H 5DDHB 4AG4L 1CL7H 1Q0XH 1JL8A 3O9WA 4LMQE 4G9FE 4NHUB 1FVCB 3NBNA 1ZLVK 5L9DH 2EDKA 1MCWM 3HPJB 4LSQL 3L5XH 5KAQG 3D3VD 3UTOA 3ULUL 3U79A 3OXSA 5F3BA 2IFFL 2YPKA 4FQIH 3RL2B 2NX5B 5HYIA 4Z9KB 5T1LA 5DTFA 2JJWA 3CX5J 5E9DD 2FGZA 3KYKL 2JTDA 4GAYA 4Z7UE 1VADB 1WFNA 1NBVH 2D0HA 4XCNB 1IC7L 4KVCH 3STBA 4P5TB 2ZUQB 4R96B 3EJZD 1IM9A 4B41A 4X6FA 3H7BA 5JNYA 3MA7A 4PJGE 2BSSA 3VXUE 5IHUH 5C71A 3IFLH 3MRRB 4RGNB 4X5XB 1IKFH 1N59A 3FB7A 5ISZE 1RD6A 1MY5A 4JRYB 4OZGB 3SY0A 1YY8B 4KHXL 4H20L 3WO4C 3WFCL 4Y4HA 1DVFC 4ZODA 1FNGB 5IVNA 1DQML 3BZ4B 5SWSE 4PTTB 1AI1L 3BPCA 4BH7B 1CD1A 1X5JA 3O3AB 2V2XB 5DVNA 3RJQB 4LEXL 4R97B 2WSKA 4S2SB 5CBEB 2JELL 4OKVB 4M48H 1HXMA 1PW3A 1DDHA 4AM0A 1MREL 2A1WL 4FFZL 3EOYG 4OAWA 5INDB 4G8FB 3I6LD 5C0RH 4HLJA 4XGZB 1V05A 5I15L 2G5BA 1F6LL 2J88H 3CDFA 4HMDA 3G6AA 4GSDH 2A73A 4Q9RH 2HYMA 2E9IA 3FMGH 4JO3L 3TBWA 3PWLA 1VGEL 1JGDA 5EB9A 3QB7C 1BHGA 2Y07L 3QZWA 1LO5A 3WFEH 3CX5K 1YMMB 2YOCA 1M71B 3WMSA 4ZNCD 4X6CE 1IT9L 3VH8A 2YZ1A 2XZAH 4FA8A 1MI5B 4NO3A 3CJJA 2DLHA 3GDBA 5J11B 1MWAB 2YA2A 1N3NA 1XGYL 3UTSB 3C60C 3MUGB 1HHHB 4N68A 4LCCB 4QXUH 3NCJH 3SKUD 1FPTH 4P23D 4PG9A 1IGFL 2NY4D 4Q6YA 1BVKB 5TDOA 1LE5B 2VC2H 2BNRA 3EYUH 1UFUA 4Z7WB 3BP5A 4MA7H 2NTFA 1KCUL 4KMTL 4QHNB 4WHYH 5DMJB 3O41B 1CWVA 2DD8H 5C0DB 4HCRA 4BSJA 4PJXB 1A6TB 2JJSC 2ZSWA 1XGRB 2YPLB 2VZTA 4Z7NE 3LZFH 1WGOA 3T3ME 3N1QC 1S7XB 4L8BA 5EIVA 3VFTA 4OF5A 4U6VL 4LQ1A 3AS0A 3MGOB 1UJ3B 3NAAH 1V5JA 4PGCA 4NT6A 5I17A 5CILL 3M8OH 5I1EL 3MRQB 2DMKA 3AAZB 3C6LD 1II4E 2CRZA 3RWHA 5HHQB 3RIFF 3S88L 2AV1A 2EIZB 5D7LE 5E8DL 2HVKB 3BZEB 3O9WC 2EDTA 3CPLA 1M7IA 2ZP0T 2BP3A 4ZAKA 3UTTA 3QUXD 1T0MA 5IW6A 5D2LF 1KG0B 5HHOE 1Q1JL 2VNCA 4Y16B 2EDRA 1P9MC 3VW3H 4KUZL 3AGVA 2P43B 2AW2A 4UOW0 4WEMB 3W81A 1BD2D 2AEPH 3OGOE 4LSRH 4GOSA 4OF6A 4TULH 3FHAA 4G6KH 4OGAC 3DXAE 1J12A 4D0DA 1ONQA 2R23A 3HZKA 4OFDA 4YXLL 1BX2A 2ZG1A 3FQWB 2QSCH 3PGFH 3C9NA 3QFJE 3LPGA 2YRPA 4PJIF 1HYSC 5C92A 1EMTL 1ZLUK 4Y19D 4FOMA 4OCYH 3VI3F 2DF3A 1A4KA 2AKRB 4S1RL 5IJVA 3HKFA 5EBMB 5DJ2A 3O8XB 4MA3A 5DJDB 5GRVK 1J18A 4YDLB 3QUZD 4Y5VC 2WWKT 3BJLA 4U1KB 1VACA 5DS8A 1CLYH 1FGNH 4P0DA 1TQCC 2P5ED 1C5BL 3S4SA 1WBZA 4R3SA 4OI8A 5LBSL 3SE9L 5GRYA 2AEQH 5FO9A 3ZT6A 1EFXD 5IESH 5IHBA 1A9BB 3KAAA 1MJ8L 4PV9B 2M2DA 1H15A 1IGIH 2HFFA 2CDFA 1WICA 4P9HC 4G6KL 2OTUA 4NGHL 4QXWA 1LO3H 1CI5A 1E4WH 3JWOC 5C0BE 3VXOA 4JN2A 1DQJB 3VDAA 4D0BA 3KHOA 4XXDB 5I1IH 5I8OH 1NEZB 3RVTC 5F7HA 3WUWB 1ZHLA 3G5VB 4ODTH 4OV6F 5C0NC 4KUZH 3IGAA 2JCCB 4FXKA 3DHJA 4GKSA 2PTTB 2VDKL 5FA4A 4LKXB 2W0LA 2EO1A 3BWAA 4NM4H 2NXZC 3TPUB 5C0AB 4L3AA 1U92B 1Y6MR 2CGRL 3T0EE 1FZOA 1F4YH 4AT6A 2AXHA 1AGBB 2V9RA 4IRZL 5CINL 4HWBL 3PHSA 1QKZL 5JOEA 4XI5D 5FCSH 5L0QC 3CDYA 2VLME 1ZT4B 1RUQH 2ZCKH 3PL6D 3V0WL 2Q7NA 3DV6B 1Z5LA 5D93C 1YPZA 3P9WB 3UPRA 4LHUA 5E99L 5C2UB 3B2VH 2DLIA 1WISA 4G6JL 1C08A 2R2EB 3QXVA 4OV5A 1G1YA 4JHAH 4G5ZH 2JB5H 1TVBB 3MO1A 1OWRM 2IAMB 2VDMH 1K5NA 4NUGL 3VGEA 5BVPH 1OAUH 1WZLA 4K23L 3LEYH 4MNQE 4O58H 4NYLA 4DGYH 4HV8B 3O4LE 2VUYA 5I73C 3RDTD 3SBWA 2Z92B 4GJTB 1T21B 1CXEA 3LIZL 1ADQA 1B90A 5KS9B 3NABL 3IFOA 2NY3D 4G5ZL 3QXDB 3EAKA 5IMLB 5ANMB 2DIBA 3WE6A 1I7UB 5D1XB 3V4VL 2XKNB 2J8UB 2O61B 4YHZL 3H42L 2HJKA 1EGJA 2X9XA 4GKZA 4WW1B 3V5HB 1MCOH 5F7DB 2HMID 5IVXF 1Q0YH 1EERB 5I1DB 4LCWB 3GNML 4PP1D 4PBWD 2YPLD 5GZOC 2OTWA 5FF6B 4U1IB 5KSAD 4Y8DC 1UB6A 1QLEL 2F19L 3MA9L 1J1OH 1JMXA 3IFPB 1XCQA 4GW5A 4RGNC 1FH5L 1QHOA 4JO2H 4HDIA 5FB8A 5MENE 1EUUA 3GSVA 3TPUA 3OKOB 3BH9A 2WLYA 2OK0L 1RV6X 5DF0A 5D1ZA 1CGWA 3M07A 3C60D 4ZS6D 4PG2A 2XYCA 1N8ZA 3G6AB 3CSGA 2QQLH 3S37X 1DN0B 3HNTH 4WO4B 3EJYC 2ILLA 3MLRH 3DOSA 1AP2B 1T1WA 2WBJB 1KEML 4PJ7B 4WFFE 1JGEB 4LVHC 4CDHA 1VESA 5C6WH 3UEZA 1FIEA 1LEGB 4DQOL 2VQ1B 4YHPA 5E8PB 1JMZA 3U4AA 4MX7B 1ZEAL 2D9QB 5LJYH 3THMH 4HKJB 2VLJD 4NN7B 3WFEL 3NTCH 1F6FB 2YN3A 4UV4L 4KY1L 5I71C 3BD4A 4AENA 1T1YA 2EXYC 3GIVB 2IQAB 2QKIB 4KJWC 3VA6A 4JHZA 5E6ID 4QRUA 4FQXD 1LO2H 1MWAA 4G7YL 4NM8L 4WI5A 3UTPE 3DSNA 4JPVL 2W60B 3CVIH 1TJHH 5HHNB 5BRZA 9CGTA 3I2CH 3RKDD 5IB5A 5GRJH 2OSLA 3A67L 3P4OB 1PAMA 3OKEA 4RMWA 3U82B 3F8UB 3QULA 2GT9B 1ZEAH 1GZQA 1KPVB 1OB1B 2AJUL 3K1KC 1MUJA 2UWEB 4MDIA 5E5MA 1I8IB 3IDMA 2YPVH 4X0KB 2IAND 5LKNA 3DVIA 4JPKH 3Q6FA 1QFUL 4GG6A 4OTXH 4OM1L 3ARDB 4H5SB 3T0BA 1N8ZB 2A83A 4FFYL 2DBLL 4DCQA 1NMAL 3V52L 1A7QL 5KVGL 4EDWL 1A4JA 2F5AL 4GRWB 4HWZA 3SE4A 4WJ5A 1FL6A 1FO0H 1UZ6E 3BH9B 4LBEB 4FFWD 4L4JA 1RUKH 4ORGA 3DI2B 3GHEL 4WW2B 1FYTB 5EZJA 3OPZH 2D4FA 3VGHA 1X3DA 3VG9B 4I5BB 4U1LA 3DTXA 3CSYA 2CK2A 1NANI 4AQ1B 4X6CB 4ONHA 3VXSA 4LMQI 4QRUB 4MXWL 4Y4HB 3W11C 1QSEA 3FFCE 3LN4B 3ULUE 4CVXB 4M9PA 5BZDA 5C07B 2VITB 5BXFB 4FG6D 5JIPA 5A16A 4JRYA 2R9HD 4GMTL 4JHWH 1BJMA 3E3QC 3QUZC 1BREA 4EN3B 2GJ6D 3NAAL 1A6UL 2ITCB 3FT4B 3LKOA 3MTRA 5BS0A 3MFFA 1GC1H 2J7LA 1EBAA 1F4HA 1EHAA 3JBG7 1ZVYA 3NIGF 1G7IB 5DJYA 2CLRB 3ZZ1A 4N0RA 5KTEL 3OF6A 3NZHL 1CD1B 3C09C 4GLRI 4GXVL 3MUJA 4WJ5B 4HK3J 3BWUC 4NRZA 4QOKD 4Z7VE 5L2KD 3STLA 1BBDL 4XBEH 4H1LG 1RUKL 3JUYA 5HTSA 3HMXL 3HG1A 4ZXBD 1YN7B 3WKML 4OZGE 2VLRE 4LQFH 5F88A 4O5LL 2ORBH 3DO7B 2VDRH 4NOBA 2NTSP 3FO1B 3KJ4B 2OZ4L 3KHQA 3P0YL 1A6ZA 2IQ9L 1KIRA 2ZPKL 4PJGB 1BLNA 3OKDB 4OT1L 1WBXB 2ZOLA 1B4JH 1NL0H 3FQXB 2VITA 3BH8B 4N8VB 2F53A 1C5DA 1Y6NR 2VAAB 3O3EA 2OR9H 2XWBA 5E2WL 1BVLB 4XI5C 4Z8FL 4ONHB 2VR5A 4UT9L 1F45A 4P2CG 2I27N 4FQPA 3QCVL 2RQ8A 3VDCA 4CN6A 4OF8A 4Z0XB 3VU2A 2SEBA 4HX1B 4PJAB 1G7IA 1IGCL 3P4LA 4NGHH 5DK0B 4ONFH 5D1QA 4NHCH 4RAHA 3HLAB 4TSCL 1K8IA 2ZPKH 2I9TA 1U8PA 1DVFA 2VSCA 1QYGH 3P2TA 1MCHA 1MFEH 1FN4A 4HBQA 4KRMB 2AJVL 1HIML 3OXRA 1JF1B 2A6KB 1RUML 2XQYK 1T83C 4MWFB 1MWAL 2FJFA 4F7MB 4NUJB 2AEQL 3LSOB 3C5ZB 1FFPA 3MRPA 4YC2C 1UYWH 3I6LE 4KKBC 3T1WA 3UTPD 3WIFB 1Y0LA 5F1IB 3EW3B 1S5IH 3MR9A 4PJEA 3N9GL 5CP3H 1WK0A 3FT2A 1I85A 3QNZB 2A6IA 2H3NB 3G08A 3A6CL 5IVXB 1W8OA 1MAKA 4GKOA 2X4NB 2R29L 2FSEA 4NJ9H 1SVCP 2OS7A 1OSZB 1IMHC 3OKDA 3N50A 5KOVC 4PJ8D 1UADC 1QUNA 5EULV 4G6MH 1YQVL 2HMIC 5EU3A 4HEME 4G8GA 3MYJB 2H26B 4PP1C 1FG2A 4PJBA 3CX2A 4YWGL 5KSAC 2XIDA 1P4BH 3D25A 1S5HA 5ESQA 5EU4A 1E4KC 2VSDA 1IEBB 2PR4H 1QPXA 2P24A 1P7QB 2W0KA 3T3MF 3CDGA 3T3PF 4JFEE 3BZ4A 2WP3T 3TJHC 4LCIL 5I1KH 5I19L 4POZD 4NQDB 1AR2A 3LOWA 1BZ9A 1UCTA 4KAQL 2XKNA 3KGRA 5JW3L 2V7NB 4KROC 2VN7A 4MA1C 1WZ1H 5F44A 3UAJC 3WIIH 1NCDH 1QNZL 1ZTXL 1DLHA 2AQ1A 3ARBD 1Y0LB 1YEDB 4QRSB 4WEBL 5EWIH 1NC2A 2XI9A 3JUZA 1I1RA 1G1CA 1EK3A 3G6JA 2MHAB 4Y5XB 3JWNC 5DQDH 1G9MH 1ZS8A 5TFSH 1K3IA 4HDIB 4LASH 5HHPB 1TZGL 2CQVA 4OLYH 3WXVL 3JV6B 5D7LD 5E6IC 32C2A 5GQBA 3S6CA 2WINA 4HUUB 4W4OA 5GS2D 1NUDA 4HUVB 4EDXA 5BOZG 2A6DB 2DL9A 5I8KH 1RUPH 2F8OA 5ANME 1REIA 4N5EC 4G6FD 5HVHB 1H8NA 1KBGL 1DFBL 3LEVL 4JR9H 4Z0BH 1R3LB 5TE4H 5LXGH 4C55A 5DQJA 3TBVA 3MJ8A 1E27A 1QTYT 2V9QA 3FOMB 3EO0A 2BVEA 1Z0NA 5BVJB 4PJHF 1FYHB 1QOKA 4WGVB 1INDH 4WTZA 1YY8A 1UZ8A 2QBWA 4FQ2H 3V4UH 4QXUL 5MERB 1UWXK 4PRHA 1GAFH 4E0RA 4OF0A 2AK4E 3MZTA 3ZE0E 3E0GA 3H2WA 2Y5TB 4FFWC 3QIWB 1M6OB 2NW2A 4M8QB 1KPRB 5DR5H 1RIHH 5KG9B 2IPUG 3DV6A 1QG3A 5IHUL 4MJIA 3CCHA 3BGFC 3BKJL 4KJQC 5JHDB 5T3ZH 2CH8A 2J1KA 5D7SH 2LTQB 4UI2A 4JKPL 3EO1A 1RZGA 1I9IL 2GFBA 4GSDL 1CD0A 3JTSA 2BNQB 5L7XL 3W9DA 4JKLA 4PIRF 5CJOL 3A6BL 4FG6C 2XRAL 5JMRA 2R9HC 4ODSL 4HF5L 1SJVA 3QEGL 1J1PH 1EZVX 5ESAA 1UC6A 5CGYC 1FL6B 1TZGH 3WDHA 3LH2L 2BFVH 3NZ8B 5EBWB 4NP4L 2HH0L 3DJ9A 2D7TH 4FFVC 3OR6A 4E5XA 4YDJB 1CFVH 3FFDA 4X8JA 5GZND 4KMQA 1CGTA 3OKYA 5AWNL 5HDLA 1FDLH 2ESVD 2RCSH 4CN4A 3HC3H 1BFOA 1I7UA 1KB5L 1BIIB 5I75C 5KVEH 1P6AB 4JRWA 1DSFH 1WTLA 1K8DA 1ORSA 2O5YH 4RAUA 5F1KC 4AK1A 3VW3L 2QHRH 1WWBX 4W4NA 5FA3B 5JIHA 1OL0A 3UTSA 1HHJB 2Y36H 4YLQT 3DETD 2Q76A 1OT1A 2H32A 4DGIL 5T3XH 4Q0XH 5HGAA 3FOMA 3C87A 2H2PD 4IDLA 3NACH 5CGTA 5LAXB 4K94C 1H3UA 3BP5B 5TQ0H 3AY4A 4XNMB 1A6UH 2J2ZA 1RZJC 2MQ3A 4GKZB 3RWDA 4IM8A 4NKMB 3BGMB 3REWA 2OQJA 1GGTA 5CMAB 3B8YA 4PJ9B 1CN4A 3O2DL 2R8SH 5ERWB 1WWCA 1MHCB 4YO0B 1IC5H 3SOBL 4PRAB 5CZVL 2ZUQC 3DUUB 3GRWL 3SKMA 4AJ0A 1FCCA 2BOBA 5FYLE 1RQ5A 2KL6A 4MJ5A 3I9GH 3RI5K 5IFAH 4WNQB 3GIZH 5D9SA 2BSSB 4IRJC 4PB9H 3VXQB 3RBGA 2XV6B 4I1NB 4RIRA 1MQKH 1F6AB 3EYUL 4XPGL 1BQLL 3ZSSA 3O2VL 3W9DB 4NM4L 4GAYB 4MNQD 3VXRE 1ZSDB 1YQ2A 2KKQA 5GGTL 1XR9A 2NY6D 2W65A 1SBSH 1GGIL 3T2NH 4JN2B 5DMIH 4L5FL 5HBBA 4NKOA 3EO9L 5KSBA 4ORZC 1QYGL 2VLKE 1LO3L 3WNMA 3IGAB 3SDDC 3VI4F 1FV1A 3SY0B 4QHKI 4L3CB 4U1HB 5DRNA 1B2WH 5B38B 4LEXH 1SYSA 1BIIA 1N6VA 4OZFH 3C60A 4K2UH 1IGMH 1HXMB 5FUOH 1DBBH 4JE4B 4HWEH 4NO5B 2SEBB 1ONQB 1OP5H 3FN9A 3TA3B 1JVKA 4QF1B 3Q2CA 4FQCH 5E2WH 1OAYH 3GSOA 3HNVH 4KKCD 4OFYD 1HILB 4NKQB 2AJVH 4K7PX 1NFDF 1RZJH 1P4LB 4Q9RL 4KTDH 2C3WA 4UDTA 5GRUH 3Q6GH 3TM6A 1A3QA 4P2YA 2R0KH 1OB1A 1TITA 3VXNA 2PXYB 4ONFL 4P2OB 3VFUB 2OP4H 5EU6A 2DN7A 3FN3A 1AY1H 1KJ3L 1I1AB 2H45A 1B9ZA 3U0TA 3GO1L 5GS0D 4N0YH 2BSTB 4J8RA 4WW2A 5K93A 1VEMA 1SY6H 4I5BA 1LO0H 4ALAL 5A3IC 1U36A 5DD3H 4YFLF 4YXHH 5E8EB 2MMXA 5D5MA 5JW4M 3TWCH 3RA7H 2I9LB 2C7UB 5KSBF 5GSRB 1ZVSA 1A22B 4YXLH 3ZHLA 3IDIA 4ZPVB 5D7JB 4ELME 1PQZB 5EDXA 4U6HA 3D48R 4M6MH 2MKLC 1YEGL 5CCKL 4KQ3L 4U7MA 1K85A 1RZIB 5DJXB 4JFXA 1DBBL 4Z77A 3E6HB 3OKKA 2EIEA 2F8VA 2XN9D 1U93A 1UVQA 4MHHG 3MRDB 3O4LD 1P53A 2OLDA 5H35A 3H9YA 5EO1B 4BFIA 1CT8B 4ZYKA 2CUHA 4L29A 1FL5A 3NGBB 4ZSOB 2F53D 1NBVL 3BAEL 1UZ6F 4R7NB 4WCYH 3NZHH 2DI9A 5DHVH 3U4EA 3GSRB 3TZVB 3MV9B 3S36H 4DKAA 2NCMA 1LQSR 4L3EB 2X4RA 2XICA 3VRIA 3G5XB 2AJ3A 4I77H 3F58L 5FYKE 4O2FA 1YN7A 5FM4A 2EEAA 5F88B 1S7VA 1ZOXA 1AO7E 1AC0A 1TJGL 1AP2A 5CD3A 1YEKH 3QNYA 5FV2A 1S9WB 3L7FB 4GBXC 3O2DH 4P3DB 2R8SL 5DEFB 4OQTH 1PKQB 1NGWB 2JB5L 2VZOA 1Q9LB 5EU5A 1E0OB 2GYSA 1YYML 4QRQB 5MP6L 5LGJB 1I8KA 4KUCD 4HAGA 3MRDA 3SJVB 4FXGB 3FB8B 3HZVB 1A6ZB 4H26A 4L8DB 3OJDA 1KLUA 1S7SB 3BT2H 4N8PA 4X4XA 2R15A 3IU3B 5CJ5A 2XPGA 2VLRB 3V6OE 2F5AH 1JF5A 1E4KA 2OYPA 3FQWA 3V52H 3D39E 4N0CC 2VLJE 2HAZA 1J0IA 1CD8A 1HHIB 1X7QA 1TJHL 5JLZB 5E2TL 1G9MC 2ZCLL 3MLXH 1NBYB 1RIVL 4I4WA 2NY3B 1GSMA 1BMGA 1AGCB 3IJSA 4ODBD 3KXFD 3AVEA 3K2MC 1O7SA 4Y5YC 4DUVA 1MFDH 2DIJA 5D7JC 1EA9C 4P2RE 3ISWA 1S7QB 4LPVA 4P46B 3GI9H 1PEZA 4JREC 4QRRA 3HUJA 1I85C 2BNQE 2X5PA 5I15H 5CJOH 3DECA 4HWUA 1KC5H 1I9IH 1F3DJ 4APQA 3QJFA 5DUPH 5C09A 3H3BC 1JUFA 1MFNA 3MR9B 5I1JH 4BSVB 4Y4KB 4C4KO 5GIRA 4UV7L 4EEEA 4ZFFA 5I2IA 3L1OL 3QUMA 4QRQA 3WCYA 3FFCB 5H8DA 1H8SA 2FBJL 3MXWL 4F7TA 1UACL 4IIQA 5JO5A 3W2DH 4UT6L 1NEUA 2NLJB 3RZCC 3TO4D 1A9BA 2BY1A 1BFVH 1CFNA 3PHOA 4TUOB 4XNUL 2NXYD 5CUSL 3RPKA 1R5WA 1G7MA 2FYYB 3L95B 3OHXA 2FIRT 1E28B 4OQ1A 5JLZA 4PRPE 2ZWLT 2NZ9D 3HPLA 3KLSA 3WFDH 1NBQA 2I5YH 3QDME 1RPQA 4U31A 5FA3A 4OGYL 1I7ZA 2QQNH 1KLGA 3BVNA 3V4PH 3V6ZB 5BRZB 3MLXL 1CZ8L 3AREB 5AG9A 3LQAL 1KXTB 5I18H 3RKDC 3HAEA 5ACZA 1TJIH 1FVEA 2BMKB 4Q6IA 1OAKH 3O6FB 1UJTA 4FQXB 5EORL 5D2NA 2EH8H 4XXCA 3P9MB 2P5WA 4OLUL 4XMKL 1F3RB 3GHBH 4L4VA 3X3FH 1BWMA 4ZS7H 3JWDH 3W0WA 1A7PL 3RHWF 5E5MB 2L0DA 5SWSD 4OLWL 1I1YA 1M4KA 4X9IA 2DYPA 1WFUA 2FHCA 3SOBH 3MLUL 4D3CL 2RJMA 5ERWA 1H3WM 1JWSB 3D3VA 4Q2ZB 5DQ9A 1I7RA 4IOIA 4HH8A 1Q1JH 4PJAE 3FN0L 3GEWB 5FCUL 5HYJE 1EBPA 3LN5A 5CJBA 5T1DL 1W72B 3QUXC 4IIQB 3SE4C 2OM5A 1EV2E 3NCYP 3TT1L 3OB0K 4J1UB 4PFEA 1XF4B 4KKLD 4ZUWB 3BUTA 1N5YH 4BZYA 4R0LC 2BY0A 4XX1G 4KKCC 2DI7A 3QAZB 3IXTB 5DMGC 2AI0H 2OX5A 4N8CH 3QUZA 3BQUB 1MF2H 4MAUL 2X44D 2J6EH 3QRGH 1U2HA 5F7DA 5JHLL 4I0KA 4J3UA 1B0RA 4CVXA 2JIXD 3HMWL 1F8TL 5D1QD 3MV8E 3TBVB 5A16B 3HZKB 2YBRA 5HJ3A 5GS0C 3X3FL 2NY7H 4TUOA 3O9WB 4PJAF 5EC1B 1BF8A 3VE0A 5EORH 1HYSD 1UEYA 2R2CA 1P4BL 1MVUB 4JFFA 2DQEH 4FQQB 2VC2L 5JW5B 3ETBF 4ZUVA 3P30L 1I8MB 4OZGF 4MS8C 1YQVH 5DJDA 2XN9A 1TPXC 5JOPD 2LU4A 4YFDB 1RZGB 2C4FU 2VLJB 2VDKH 1DQLL 3QO0B 1F42A 4MNGB 2A6IB 4UDTB 3RY5A 1ERNA 4NN6C 1CK0L 1BJ8A 1EDQA 4KK8D 5GS0L 3NCFB 4MJIB 1WAAA 1CXIA 2EZ0D 2J8UE 4PJ7A 1HYRC 5FO9B 3P9LA 1KIQB 3F7RA 3VI3E 3CXDL 2DJ4A 3L3KB 4JQIL 4KK9D 1WF5A 3SKNA 4LAQL 4TSAL 2ATKA 4Y4FB 3GGWA 3CC5B 5TH2B 1U58A 5CKGA 5DO2D 1IAKB 1A1OB 1YDPA 1G9NL 1KCVH 4PLKC 4X6DA 2ZOLB 4UTBL 1CF8L 2GCYB 2FATH 3FQUA 2FR4B 4HKJA 2PW2A 3S34L 4U1GC 4HUXB 4TQEH 3ESVF 5D2LA 3IDNB 3VE0B 1RZ8A 1UH2A 3S5LA 4JVWA 4Z7QF 1CXHA 3KPSB 1LNUA 3T0EC 1UM4H 1UACH 4PJFA 4D0DB 3WHE0 1RUPL 2MJWA 2PO6A 5IBLD 5ADPH 1GJIA 4GBXD 5ECJE 1ZHBB 2Z0BA 2C1OB 2DJUA 2O93L 1IILE 4V2CB 5I6XB 3JZ7A 4XVSH 2VXVH 5HHPA 3DLQR 3GSNH 5TE7L 3EHBC 2XQYG 4TULL 1HI6A 5FUCE 4KKBD 3IJHA 3QFJD 4YX2H 2APXA 3ROLB 1EJOL 4OD1H 4U1KA 1U95B 4YQXL 4JRXA 4GMSL 3RP1A 1AQKH 4P5KB 3IRZA 1EEQA 4LL9A 4A6YA 1F58H 2PCPA 2ESVA 4Y7MA 3TBYA 3QNXA 3D1MC 3I50L 4L4TA 5KS9A 4YDVB 3GMLA 1NCWH 4OCSH 5IW1B 4EN3A 5D7JD 5IKCA 5DEZA 3F7VA 1D9KA 3FQTB 4I3RH 4AY0A 5DHVB 1LNUB 4QRTA 3RGHA 2VMFA 1MEXL 1QBBA 4LHQB 3WNPA 4IOFC 3V6FA 4M61B 3LQMA 4JFDD 1AGDB 3RWGA 4X80H 4GXUN 4ISVA 1QD0A 3PHQB 4G6ML 2JCCA 4FXKB 4GKSB 1Q38A 3KPQA 1P4LA 2X70B 4OJFH 2VJXA 3LPFA 2BVPA 4N8CL 3TO4A 3UBXA 1YUHA 5CEXA 5MEQB 2F74A 5CJQL 1G6RB 1Q9KA 2DD8L 4WIQA 2D31A 1Q72L 1NLDL 2X9WA 3IYLW 1KYOJ 3REVB 1NAML 4GRLB 3C5SA 3B3IB 1GYAA 3MLSH 4XCNA 3SDXB 3ZL4L 3TCLB 3S5LG 1VFAB 4G43A 1CDYA 2GQHA 3DGGA 5T5FH 2FIKA 5EU6B 4DAGL 1R3IH 3JWOL 1U9KA 4OIIL 4XC3H 3GB7B 3VWJA 1GIGH 2YRLA 3ROLA 1CFQB 4I3SL 4HFWA 4LSSH 4ZFZA 4U1NA 1JPGB 3F7VB 3OR7A 4D2NA 4AIXA 4KJWD 5A2JH 2CK0L 1QRNE 5D7LB 1UA6H 5JO5B 2W60A 4F33A 1F3JA 2PTVA 2VIRB 5J56B 5CSBA 5F3HB 1LP9F 4YPGA 5B3NA 5BV7L 2IWGA 4XH2A 1HNGA 3NPSB 5F97E 3O3AA 5C2BL 5HI3D 2Z93B 4YHYC 5HGHA 1MHEA 1A4KB 3K7UA 3G6DL 4QXGH 1Q9WA 3ZL4H 2RB8A 4BFIB 3F7YB 3WN5A 5JXEC 1T2XA 5C86A 3OWEA 1DVFB 3ARVA 3QIBC 4EJ1C 1LEKB 4JQXA 1YC8A 3WO4B 1CU4H 1NLDH 3KJ4C 1KYOK 3BIKA 1A4JB 4LPYA 8FABA 2AKRA 1U8IA 2CIKA 5DD6B 4M3KB 2IALA 1JPSL 5HYQA 4CVZA 2R1WB 2FH6A 2XTLA 3UPAA 2HJLB 4F8TA 1QSFE 4FMFA 3NFPB 4YHZH 1D5BB 1RZJL 5I1HH 2R0LH 3O6FC 2CR6A 4OIIH 4U1JB 1S7VB 4TVPH 2QHLA 3CFJA 3EYQD 2Q20A 4POUB 4HQQH 5C0CA 5J1TC 3SGDI 4LCWE 2Q86B 3ARSA 5EN2B 2JIXA 3SDAB 2V2TA 3P77B 1N5YL 3ARDD 1XF4A 5FUCC 2YD7A 2V7HA 1CFQA 3AB0C 3OGCB 5EU5B 4PJBB 1QFWI 4GAJH 4M62L 2IBGA 3ET9F 3QFDB 5SWZD 2CMRH 2IMMA 3WEXB 3ULUH 3UMTA 3RL1A 4U0RC 4UNTA 4L9LB 3VFOB 3DETC 5DMKA 4LLAA 1OT2A 3LKSA 5J12C 1R0AH 5HJ3B 3HG1E 2ZUTA 4OZIE 1G7JB 3KJ6H 1JGLL 3MUY1 4GT7A 4QY8A 1I7TB 4Q0XL 1M05B 1N5AB 1CGYA 3NA9L 2B1AL 4UB0H 1Z6JT 3MREB 1IGTA 3MCKA 1A7QH 3OQ3B 4NNPH 3EYFB 5DO2C 2PKDA 4J8RB 4HS6A 4NUGH 4JG1H 2P46B 2Z9TA 2O5YL 3AAZA 3NFPA 4BSVA 3V0VB 3MOQA 4UINL 3TN0B 5I0ZA 4QTIL 3RU8H 4DTGH 1SEQL 2HFGH 4PJ8A 1MFAH 4LSUH 1JWUA 1ROWA 4G42B 3LD8B 4MZ2A 3TP4A 8FABB 4V1DA 5TQ0L 3FCTA 4JO1H 1I3RB 4IRJD 4YNYA 5KBNC 3P77A 1C8PA 2HA1A 1U8MA 4RIRB 4R7DB 2R0ZH 4BSWB 4U1LB 1DBJH 4QHLA 1AGFA 2ATKB 4JFXB 1CF8H 4HKZA 5AYUH 5D7IE 1XGTB 1PG7H 5FO8A 2O61A 3DHMA 4DUWA 3VGGA 1FGVL 3WJLC 3RL1B 1T04A 5BZDB 3BESR 43CAB 1G6VK 1AJ7H 3IAQA 3HTLX 3SDDD 2QSQA 2XWTA 3ARFC 4LLYB 4AMKH 3DV4A 2EKSB 5C8JA 1I7TA 4PJIB 4UBDC 4JG0H 3S3JA 1DBJL 2BRQA 3NFNB 5GS0H 3PWUA 3ARRA 2VOTA 4OD3H 4MA3B 3S34H 3V2AR 4M6OH 4L9LA 3VFOA 3PV6A 2OTWB 5FF6A 4IDJL 1OTUC 2F54D 4QYOB 5ADOH 2HFTA 3BE1H 4JREB 3S35H 2Z31C 3GKZA 4ELMF 2EYRB 3ULVE 4X6BA 5DRZA 5JNYB 3H9ZA 1YNKH 4Y19A 3OR6B 4NQCE 3X12B 3X14B 4PJ8C 4FQHB 1T03H 2OZ4H 3CFCH 4Z7NF 3LHPL 1QEWA 3DYMA 1AXTH 4RMTA 3QJHA 1JGUH 2CDFB 5D5MB 3HMWH 3L3JB 4XCFL 3KLAA 3QFJB 4M1DH 1D3CA 2MNUA 5GRUL 4P5TD 5IT2H 4M43H 2FLBT 4QNPE 4D9LL 3RTQC 4IS6B 4NQSB 3WIHL 3B5TA 4DZ8B 4HCRH 3RWFA 4I0PD 3O0RH 4YNYB 3TH4T 3UPCA 3LRGA 1R3KA 2PYFA 4BH7A 4PJXF 1MJUL 4Z7OF 1FFNB 3MUHL 1T7ZA 1IL1A 1FSKC 1TQBB 5DJAA 2V7NA 4IRSA 1HH9A 4FTVB 4AEIH 4PJGF 1W72L 4M7LT 1F4AA 3VFWA 1JWMA 3T0WA 3FZUC 1XR8B 3SEPA 3BDXA 4U05A 5EUOB 1U8PB 3NIDF 3D2UB 4MNGA 5AD0A 4QRRB 4TTDD 1TIUA 3VFMA 2F74B 1GPOH 4XBPB 4AEHL 4P2OC 2FWOA 4PJ5E 2N7AA 4QNPF 3SGEH 1I8MA 5DRWB 2F5BL 2WW8A 4JB9H 5L6YH 1G9ML 4HLZG 4F9LA 1LK3H 3A6OA 3DROA 2ZUWA 3CSYB 3SKNB 5CIPH 2H2SD 4OCSL 5F6IB 4X4YA 2B4CL 4N5ED 4OGYH 2V2WB 4UQ2A 5EO0A 3T3PE 2X4NA 1G7HA 5ID1A 5DT1H 3MUGA 1HIMH 4ONOA 3DMMD 4JFQB 2R1YA 4R4FL 1RVFL 3H9SB 3BKJH 3O3DB 3MYZA 3S98A 5BV7B 5TDOB 1TMCB 2VN4A 1T83A 4NRXA 3VXPB 3SGJC 4L9LC 3RUGF 1IT9H 5DR5L 3GM0A 3KPSA 2H9GA 3INUH 1MCWW 2IANA 4QHMA 5AZ2L 1U8KA 2BVQA 4NQTA 2CK0H 2IPUK 1TETL 2WWKO 1OTTC 5GSVB 3U0WL 4N0CD 4YPJA 3U7YL 3E3QE 3GSXB 2ICWB 5J13B 1XCQB 4P99A 5E7FA 4P9ML 3TPKA 4LSSL 3GJFK 2R0WH 5DC4B 4NJ9L 2Q8AH 1AGCA 3HE6D 4O2CB 1I1YB 4WI2A 1KV3A 3QI9C 4WUUA 5D6CB 2YS4A 3V6OC 3WS6C 1OAYL 3U9PL 2HH0H 3GMPB 3WKMH 1QBMH 3AB0B 4OZFA 3W9EB 1NJ9A 4FABH 2QV2A 1ZS8B 5A2FA 1A1MB 2C4XA 4XMPL 2RAMA 4DQOH 5CP7B 2ATPA 1MJJA 2VLLA 1OOAA 1AFVL 5T3ZE 2CUIA 2DQFA 2AQ2A 2YRZA 1EVTC 1KTLA 1FZMB 3KPNB 3MJ7B 1G7PA 1PSKL 5C6PB 4JG0L 4DOHB 1NMCC 5TQ2L 3R06B 3CK0H 1WWAX 4NQUA 1BBDH 4XBEL 1OHQA 5JHDD 1CBVL 3KYAA 3TO4C 1MQKL 1V3KA 1I75A 3BH8A 4N8VA 3FQRA 5K9OA 1RVFH 2YBRB 5ITFA 1AD0B 2X09A 4OCXL 3SGDH 4NZDA 3IJYA 4NRXB 3GSRA 3KPLA 1KSRA 4JDZA 4PRHB 3QO1A 3S3PA 3GMQA 1I7ZB 1P4IH 1U6AL 4FQLH 3VRIB 3RJDA 5E8NA 4FNLH 5D6DC 4NC0B 4B5EA 3ZO0A 5C07E 2B1AH 3SDAC 1UXSB 5T1LD 4HQQL 3SE8L 5E08H 4Z7UB 3VXRA 4E41E 3QISA 1WBZB 3N1FC 4R3SB 4IRJA 4CW1B 1INQB 1LEIB 2HRPH 3WFBL 4V1DD 1MCLA 5KW9L 3LSOA 1RURH 2D7OA 3P9LB 5GGVY 5KVGH 4OQTL 1PSKH 3D3VB 5I1GH 1F6AA 2I25N 5K9QI 1L9NA 1FZMA 4GFTB 2QQQA 2CKBL 3REVA 2ADIB 1JNHB 1JFQH 2J5LB 4WI9A 3OKLA 2P5EB 2AJXL 2AJZA 3ARFD 1TJGH 3S96B 1UQSB 3LKRA 5JPNB 4PGBB 5JORB 3OJDB 3AY4C 1MJJB 4K3JH 3RIAF 4Y1AB 3KPRB 4WW2F 5J89A 4R7DA 1I9RL 2X4TB 3GKWH 3HI5H 4U1GB 3VFGH 4JQXC 2FJHB 3T8XB 5DSCA 1FG2B 1IARB 5HGDB 2UWEE 5BRZE 1HHGB 3BMVA 2FGWH 1AGEA 1LP9A 5HVGB 5JXEA 2PUQT 3HR5B 3QDMB 4NWTH 3HRPA 3T0EA 3T1FB 4N0UB 2XZCH 5DJYB 5TF1H 4UILH 4OB5H 1I8LA 3DO3A 3LD8C 1ZHBA 4A2LA 1T7XA 5JQ6L 3THML 2XWTB 2VYRE 3UTQB 1XF2A 1X5FA 4LKXA 1QQDA 2IEPA 3KS0J 3TV3L 2WUBH 2HG5A 4NFCA 1KEGL 2GJ6A 1G7LB 2P8MB 3VFNB 3LRSB 4PP2A 1J11A 3RIAK 3STLB 2YUZA 1ACZA 2CKBB 5BW7A 2GI7A 4P2QD 2PF6A 4X98B 4GXUM 3LS4H 5ENWA 1KF9B 4BH8B 1IAOB 4ETYA 5F71A 2ZNWA 1NFDE 1DBKL 1H3XA 2EZ0C 3P4MA 4LSPL 1UCBH 5ICZA 4AMKL 1KG0A 2VDQH 3QIUC 2LAAA 1ND0B 1CG9A 2YC1B 4APQD 5I1LB 3C09B 1ZA3B 3HAEG 4Y5XC 3LB6D 5GRZA 2OL3B 3BXNA 2B1HH 3E2HC 3KPPB 3QFDA 4X9BA 1MFEL 3JVGC 5HHVH 3GFUA 3BKML 3BQUC 3VG0L 2YXFA 4ZFOL 3EDJA 3UZVB 2OXGA 4Y4FD 1Z3GH 4MD0B 1IC4L 4TPRH 1L7IL 4NZUL 5DJ6B 5JR1L 3B6SA 3PG2A 4Q9QH 3MLSL 5D7IB 1A7RH 2DAVA 3DMMA 5T1MB 4PPTA 1P7HL 1DQQA 4OI9A 2NY4B 1B2WL 1IC1A 1Q0YL 4QTIH 2RR3A 2X41A 4JJ5A 4Y0GA 3T0EB 4LVEA 3KDMA 2XKSA 1H3GA 3G5YA 3C08H 3O3UN 1N4XH 3HCVB 1KPUB 3M17A 5DJZA 4YR6A 2IFFH 3Q3GB 4QRPB 2ITDA 4NPYA 2EO9A 3TCLA 1Y18A 3O4LB 5CD3B 4JPIA 1IGTB 3MCKB 4JM4L 3EYFA 3BSZH 4LOUD 2FDBP 3FFDB 3OJVC 5JA9A 2GTZB 1RK1B 5BZWB 1DN0A 4U1NB 3IXTA 4BUHA 4P5TA 4BJLA 2C7UA 2V2WA 5EO0B 3C08L 1CGVA 4L3EE 4A6YB 3QUKA 4QTHB 3OJ2C 4YBHA 4R97C 2A0LC 4PRPD 4Z5RA 5CP3A 3ES6B 3CSBA 1L4IA 2ERJB 4P2RA 2X89D 4R8WL 5A2KH 2MCPL 1AGFB 5IFJA 2BXZA 4LFHD 1K3ZA 2FLRT 3MBEC 3HUJE 2J12B 4YX2L 2BDNL 3EDEA 3GMMB 3MPCA 2FH8A 5J12B 3ILPA 4U49A 4ENEC 3IVKA 2WV3A 4MJID 1NEZA 3O6ML 4GG6E 4JPVH 5EC2B 3X13B 4M03A 3MBEB 1MELA 4UV7H 2ADFL 2GSGB 5DD0L 1KCKA 4UOW1 1WFOA 4IIQC 2E7LC 3ZTNH 2OR7A 3N85H 5INCB 5TDPA 3MRLA 3KDMB 4PD4K 4DWHA 1NC2D 5EZIL 5ICYA 4KROD 3LMJH 5C08E 3KLAB 5E8OB 2DJSA 4LLMB 3C8DA 3PNWB 1EAJA 1OTSD 1Y18B 4S1RH 5SV3A 3DI3B 3C5JB 1A64A 1YMMA 3BX7C 3X12A 2Y9RT 4P3DA 5DFVD 1I9JH 1K5NB 1JPTH 1HHKA 1XGUA 2NXYC 3BGAA 4AH2B 2YHGA 5D1XA 1MRDH 1EJ6A 5H94B 2AABL 1RU9L 3P4NB 4O4YH 5GGQL 2QADD 2DB8A 5D7LA 3LMJL 3WIHA 2Q8AL 1N6QL 4MYWB 1LDPL 1KN2L 1CICC 3CZFB 3MGTB 4PRBA 3I3BA 4MNHB 3TJEH 3Q48A 1YNLL 3GSUA 3H42H 4X9HA 2P5WD 2R2BB 2YPLE 4NHUA 2AI0L 1VB9A 3HI1A 4GXVH 2CJUL 4NRZB 3BPLB 3G6JE 5CEZD 1W0VB 3VFSA 2CKNA 5JXED 1H3PH 3VD4A 4PG2C 5IEKB 5JQHC 2IGFH 5FKPB 2QJDA 2XA8L 5HDQL 4XP5L 4K3EL 2PETA 3V5KB 3RAJH 4GBXA 3OSKA 2LU7A 5EBWA 3BKCL 4ZDHA 1ZT7A 3MV8A 4CNIB 4X8JB 3ZHKA 2BSRA 4G6AD 5GRVL 1NEZG 3F12A 4RBPK 4ETQB 1U95A 2VLRD 1P5UA 3KWWB 4L4VD 1GH7A 3DX9A 2EKJA 5HSFA 5IROC 1IKNA 4MJ6A 4F7PB 3VXMD 4MCYB 5HHOA 3VWKB 3KR3L 3RUGA 2FO4B 3WL9B 1DQDL 4K3HA 1BQSA 2JB6A 4GS7B 3TIEA 4FRWA 3GRWH 1IRAY 4P23B 3B4NA 2HKHH 2J6EL 2OJZH 2ICWA 1A6AA 1BD2A 1GOHA 4U1MA 3OX8B 2CLZA 2E8ZA 2WBJC 2IANB 3QP3A 1QR1B 3SDXE 4QHMB 2CMRL 3RVVD 2Z8SA 3REWB 3SN6N 3W2DL 2I60L 3NACL 5L8JB 2EYSB 3PP3K 2HRLA 5F7YC 4GRLA 1HNFA 3L5IA 1FN4B 4MVBC 1WEJL 1G0XA 2ARJA 1J0HA 3SE3A 5IEHA 2A6KA 4NKIH 4CRPA 2BRRH 2CJUH 2XOTA 1JGDB 3B5GA 1I8IA 1KB9K 1S9WA 3IDMB 5EBMA 1T20B 4P2QE 3MV7B 5KANG 5ADOL 3B9KB 3MV8B 1QSZA 3WFDL 3ZTJG 1D5MA 1IAOA 3KYNB 1R3JB 4FABL 1HSAA 2XWJA 1ZSDA 5FOBB 3GMNB 4HUWB 3QXTA 2CXGA 2FIKB 5T5FL 1LK2A 4N9GB 4FQCL 5IR1B 1UGNA 3GI8L 2P24B 3R8BB 2LAGB 4X8XA 4R4NC 2EC8A 1ZT7B 3SCMA 4A2MA 1QSFD 1H3TA 4HXAH 4RRPA 4CMHB 5DVLA 5EU3B 4NQEA 1YEJH 2VDQL 1IGML 2YUVA 2X1QA 5TGBB 5L7XH 1G9NH 4U1HA 4UMGA 5DRNB 1A6AB 1BD2B 4U1MB 1KJ2H 4LP5A 1GVIA 3BQUA 4QHKJ 4OGZA 5EO9B 2HT4D 2EYTA 1XGYH 4PJCA 5IG7A 4UOJA 4O5LH 4ODTL 3WN5B 2Y6SD 3VWKA 1VKXA 5IBLC 1M1SA 2X1PA 4IMKC 3IFNL 3TIEB 5J13C 4Y5XA 4LRNL 1B6UA 1EUTA 4NBYB 3UXFA 4NQDD 2VL4A 1RULL 5DYOB 1INQA 1A0QL 3VFMB 3JV4B 3GRWA 1NBYA 5I73B 1U8QB 3MGOA 4FQ1H 5E8NB 4JANB 5C09B 3KYKH 3WFHA 4G9DA 3LKPB 3VXUB 4XRCB 5E8EA 1JNHA 2NY0D 1BGXH 4K94L 2ORBL 4HXBL 4XAWL 4B7LA 3IFLL 5DRZB 5GGVL 4ODHL 1WZMA 4KRLB 2NX5E 5BO1H 1VFBB 1NKOA 5I8KL 1C5DB 1WAAF 5IQ7H 3MRFA 4HKXB 3OKMA 1A5FL 1J88A 5BRZD 3EYVB 1R3JA 4HS8H 2VERN 1HXYA 3BAEH 3SJVD 3PGCA 1C7SA 1KIRB 3RTQD 3S35X 1GZPA 2V5MA 2LABA 2P4AB 3MLVH 1WBXA 2NR6C 1UB5B 1U8KB 4RA0C 2Y5TA 2P42B 2AK4A 4RFEA 1YEKL 4YHYB 1W72H 1BX2B 2GUOB 3K1DA 4AEEA 4GW1B 2P5WB 4J3XA 2DTMH 5TGBA 4R4BB 5ADPL 4LHUG 3GSQB 4FTVE 2AEPL 3QSKB 5MEQA 3QQ4A 4PJFB 3F58H 4MJIE 5ETUA 2YWZA 2GJ6B 2VDPL 5SX5K 4O2CA 3HFML 1PY4A 2GSIA 1JZ8A 4F37K 2UVFA 3OMZA 4M43L 4K94H 3QG7H 3BEWA 3P0VL 3IU4L 1ACYL 4OCWH 4E41D 2BVOA 4LCIH 4U1SA 2D3VA 3K4DA 4XWGH 3BKYH 1A5FH 5E94A 3MREA 4MAYA 4F7EB 5IVXE 4WI3A 3J8F7 1AQKL 1H5BC 2P8LB 4NQXB 1ZHKB 5I1IL 2VRAA 5I8OL 2JJSA 5JZ7C 5IP4A 4E42B 1HCFX 1AD9A 5FIEA 4G3YL 3RWEA 1TLKA 4KZEL 4LLQA 1BGXL 3SO3B 1FBIL 5CIPB 1OPGL 5LQBH 4HMCA 3VCLB 1SMOA 4WUKH 5C2BH 3RHWK 1RK0B 1QFWH 3ULSB 2WAHA 3BPNC 4F2MA 2NZIA 1EFXB 1BZ9B 3U4BH 3SPVA 1A7BA 3V5DB 3WD5L 4X9FA 5C0AA 3CH8A 3H0TB 4XCEB 1T1ZB 5KVDH 3O41A 3QYCA 3RPIB 2QL1A 5FYJE 1AGDA 1QSEE 1EH9A 1IC4H 4M93C 1CDHA 3K81A 1DBMH 3NN8B 3SDDA 2X4SB 4YGVA 3TNNB 1DCLA 3GMRA 3MV9E 3QEQD 1QO3B 3VD9A 5HPMA 1IVLA 2HLFD 1P1ZA 5INDA 32C2B 1YNTB 4D9RE 4GKNA 1MLCA 3O8XC 4Y89A 4PGDA 1D5BA 3EYOA 4HZLA 3BEWB 3FO0H 5GGRB 4LPXA 5FYLL 4M7LH 2VZ1A 5FM5M 1U58B 1CFBA 2X4QB 4BK5A 3QZWB 3PWPA 5HDOA 3L3KA 5DVMA 2IAMA 4DGVH 4Z7VA 3OAYK 4OZHE 1XCTB 3RVUD 4P59H 2XACC 4F9PC 1J0KA 1CIDA 1R5WB 2WUBL 2Y7QB 4K2UL 1PD6A 4PYHA 3UYOD 2NY5C 1N3NB 2APFA 3RGVC 4TUKH 5C0JA 4ZS7L 4FZEH 3QPQC 2I60H 1ADQL 4OLUH 2Q7YA 4JZOA 2AJYH 3C6LB 3UTTD 5CAYB 3WBDA 5I8EB 1ZVHA 3IKCB 4OFPA 5EA0L 3UTZA 3QA3A 3WE6B 1WVZA 5HGGS 3OX8A 3D0LA 1QQDB 1J1XL 2HKFL 2OJEA 3U48A 1AKJA 3W39A 4XCEA 3NIFF 3O2VH 1XGQA 5DUBB 3TA3A 3QDGA 1GGBH 4HS6B 3IJHB 4J3TA 3S97C 3KR3H 2GFBB 1CGSL 5ALCH 2FL5B 1LEKA 3IAGC 2EEDA 2OMNA 4NKDB 4HJJL 4WTXA 3ARBB 1IQDB 3HE6A 1IAII 2IADA 1FE8H 2PW1A 1UKSA 1IM9B 3CCHB 1D5XA 1GC1C 1IGFH 5I1GL 2LVEA 4FQIL 4KXZH 2R69L 4KJPD 4PRIB 5FYKH 5T1LB 1ED3A 2H41A 1AXSA 2BNRE 5K9JL 2EE2A 1W0WA 2RFXA 1HKLH 4N1CA 25C8H 2RCSL 4ZTOL 2J8HA 2DS4A 3B2VL 1NQBA 4LSTL 1QBAA 2EDBA 1F2XK 3UZEA 5ID1B 1LHZA 2GAZB 3FT3B 1GGYA 1YEGH 1PX3A 4CADB 1MCBA 3GSUB 4BK4A 1RZIA 4LLYA 2CGRH 4IMKA 1FSKB 1L7TL 1J05B 3D18B 1K2DB 3RTQA 4BZ1H 3P4NA 4YXKH 1U42A 3ZHDA 2CDEA 4FQJH 2D7NA 3ZKSD 1OGAB 1AO7B 4KKLC 3RNKB 1S7TA 2DQHL 4IDJH 4NQCA 4NC1C 2A9MH 5DEGA 5D6CA 3MBXH 3WUZA 2ZSVA 3VFPB 4LAQH 4H5SA 3IT8D 1YEIL 3C6LA 4M6OL 4WENB 3K46A 1OTUD 1OP3H 5AAWA 4WI4A 5BMFL 3IDYC 5ABDE 5IJKC 1MUJB 5JMOC 3UCRA 1Z9OA 3WSQH 4AM0B 3MXWH 3QCUH 2Z31A 2CD0A 1ES0B 2X4OB 1ETZA 3VFSB 2Z91B 5FFLA 5EZJB 1IFHL 3CH1A 3HZYB 4XNXH 1RFDL 4FQ1L 3TFKC 4W6YB 3FT2B 5GGUB 4YZFE 3D85D 4PRNB 1JGVL 2FX7H 3KNBA 4UQ3A 2X4UB 4D94A 2DOCA 4Z18A 5ISZD 1OP9A 3VFVB 3V7AE 3TBWB 1CLYL 1AE6L 2FNBA 5FYJU 1FQ9C 1K4CA 1HHHA 4I0PC 3VXQA 3LRHA 4ZO7A 5E2JA 5F3HA 5FAAA 3MRMB 5HHMD 4GRLC 4L5FH 2DWEA 3BO8B 4RMVA 3O6LH 1V7NL 4P9HL 1MHEB 3NFSL 1WCBB 3WJLA 2DQHH 4OCYL 2NYYC 1B4RA 4DTGL 4JZNB 4Y4HC 5FHBL 4PJ5A 4HGWA 3FZUD 4EKXA 1MFCL 4OLEA 4YEFA 1EAPB 2UUDH 5DQDL 3WO3B 3VXRB 2DICA 3U0PB 1YYLL 4TTDC 4U33A 4GG8A 2OL3L 4AIZB 3NH7H 4NC2B 4JFDA 4OIBA 4PLKD 4XBPA 5K59F 3RWIB 4MZ3A 1FZOB 4HAFA 5JXAH 3C5ZD 2PYEA 3BJ91 4KHTL 2V5RA 2VH5H 4IBLT 3N06B 2DQUL 4Y88A 5KSAA 1UENA 4I18C 2GKIA 1VDGA 3LEXB 3RX7A 4YIQB 1X5HA 4RGOH 1TPXB 2ED7A 2VL5A 1DBAL 4KXZI 4BQCA 4KZDL 4JPIB 3B2UD 5JW4R 1JHLL 2IBZX 2IPTH 3LKQB 2IALB 1DZBA 2DL2A 4NWUL 5E8PA 2R1YB 1PBYA 1ZTXH 3HZYA 3HMXA 3MRNB 2HTLD 4ZFGH 5F7MC 4YUEH 1NFIB 1D9KB 3GSNA 1T6WA 3BN9D 4JY5H 4PGEB 3H6JA 4JZNA 5HYEA 2Y25A 5ICXB 2XZQL 5EN2A 3S36L 4KQ4L 2H8PB 4GRMA 5DQJB 3RAJL 1WV7T 2F53B 1ZHNB 3MRMA 2V7HB 2AABH 4EVNA 1OTTD 2DLFH 4PRIE 5DSCB 4UDUB 3ZKXB 1YNKL 1NGQL 4UIKL 5I1AA 2E5EA 4S2SA 1HH9B 1OAKL 3TZVA 5KVDL 2HG5B 2AXJA 2VDNH 3W0WE 4FHBD 4OAWB 4GG6B 2I5YL 3WFHB 5KVFH 4X7TA 4Q9BA 5C7XL 4J12A 1S7WA 4YGVB 3O6KH 4PYGA 2IPKA 4K3DH 4X5WA 3DIFB 1LE9A 4IOFD 3A6CH 3ZDYE 3MRKA 5GPRA 5E6YA 1N26A 2IGFL 3GB7A 4KWUA 3JWDL 5DRWA 4ERSH 5JHDE 3WIFA 1NLBL 3L6FB 4XMKH 5I76A 1AKJD 3ZTNL 4V2BA 5FK9B 3FO0L 4IOIB 4X98A 2D03H 2I07B 3KPNA 5DD0H 1JZ5A 4PY7B 4DZBB 3NCCB 3ARYA 1XGTA 2DQGH 3Q5YA 3LQAH 5F89B 2C3VB 1S5HB 2OR8A 4YXKL 5D1ZC 1U3JA 1KJ3H 1QFOA 2AGJL 3V79C 5KTEH 1LO4H 2VQ1A 4YHPB 4D9RD 1M7XA 3R1GH 4ZNEE 1VHPA 1FORH 4OLXH 4ZUWA 1KJVB 2UY6A 4WDIB 2WM0A 3NCEB 5L2JB 5GS2H 4IJ3B 3HMXH 4HLZH 5GGSA 4Z7WA 4WFEE 2NY7L 3BW9B 3P73A 2WWMC 4UT7L 3I3DA 3N85L 1RIVH 1AJ7L 1OAQL 4MNQA 2AK1L 4G8EB 3PDGA 1MF2L 2VZVA 3IKCA 4HIHA 4DGIH 3X11A 3U6RA 3QG7L 1YMMD 5I30L 2FHFA 1JN6B 4PJIA 1KJ2A 3E6FA 4ZQKB 3WFZA 4JFOB 5FM5O 4BKLA 4C83A 1MIML 5CWSB 3U2SB 2FJGB 1U3HC 1LGVA 3FONB 3JV6A 1R24A 2P5EE 4X6CF 2R4RL 3X14A 2Y23A 1YJDC 1KB5H 5KVEL 5IBTH 1XZ0B 3MOBL 2IFGA 1ZHKA 5K9JH 4WGWB 3W9EA 1BEYH 3MLTA 3H9SD 3O45A 2VABA 4FFYH 5E00A 4QOKA 4OLVH 3GUTB 4M6NH 1B0GB 4TNVK 4X4ZA 4K9EC 1X5IA 1M71A 1JYVA 1KTLB 1PZ5A 2VDOL 4HMEA 3WS3B 1CDGA 5BZWA 2NNAA 2GHWB 1KJMA 3K2UL 5EOCL 2NW3A 3CC5A 3QDJE 2YUXA 2EH8L 3DX9B 4U7SA 4WEUD 1MPAL 4MQ7B 1MIEL 1AQDA 5CBAB 4MGXA 4QTHA 3ZYJA 5E95B 4JLRA 1OCWH 4MDJA 3I75B 1S8DB 1FFQA 3V4PL 3O6FD 2R23B 5KSUB 4Q6IB 1NGXA 1FORL 1HSBA 2R4RH 2A9NH 1U6AH 3L5WB 3D2UA 4JM2B 4OD2B 3SDDB 4EI6A 1VSCA 5D2LB 2GY5A 4MXWH 4KROB 4F7CA 1BM3L 3OXRB 3QWRD 1VA9A 2R29H 4ZQKA 1C16B 2XQBL 2FJGA 4M8VA 4DVBA 1T1ZA 4HS3B 4WV1C 1FVDA 1IGJA 3MRJA 4M7LL 4I2XA 3RVVC 5CHNB 5F6HJ 1XGRA 5HDBF 1JWSA 3VI4E 4PGDB 5M95B 4JFED 3CFEB 3QUXB 1CLZH 5F8QC 3NCBB 1A2YA 3L9RA 1CD9B 3MLRL 4DEPB 4JN1H 5EZOL 3TLRA 4MXVE 4LCWD 2X4QA 3GSVB 1TNNA 4NCDA 4PGCB 4MXQD 4TQEL 1ETZB 4LLDB 2ID5A 4GKNB 5FECA 4KTDL 2K1MA 5FGBC 5KVFL 4U3XA 1KNOB 2APTA 4XP1H 1X5YA 5AEAA 2JK5A 3HNVL 15C8L 3BDBA 1G7QB 3KYNA 2IBZY 3DO7A 4LRIA 5EZLB 2DKSA 1A6WL 3PNWA 1FJ1A 1X4YA 3H7BB 4DN4H 3BZFB 1SMAA 5TFSL 3TH3T 3QWRA 2R0KL 3ESUF 4OCMC 1MLBA 2VE6B 5JPMA 1JI2A 4ODXB 3D0LB 2DQIL 3QQ4B 4Y2DA 4XVJL 3F7QA 1XF1A 5C0JB 1CLZL 3IS1X 1WZKA 5HYFA 3FOLB 4LVNB 3VXSE 5BV7C 2X05A 3PL6C 3UTQA 1XF2B 1AXIB 4HK3N 3SJVE 3UBXB 3K8MA 1DEEB 3VMNA 1I1AC 2FEDC 4GH7B 4KZDH 3E8UL 4XPFH 5CLTA 1G7LA 1KN4H 4DKEH 1PKQE 2DLGA 4PJ9A 2E7CA 2ZG3A 3ZE2F 4WI6A 1C12A 4H0HB 2O5XL 3L9RB 4Y5VB 3ARBA 1UG9A 2HLAB 3MLYH 1FAIH 2NY0C 3O3BA 2DQJH 1N2RA 4JO2L 4JCMA 4JY5L 4OBRA 3SE3C 4NRYB 2RGSA 4LCYB 1FJ1B 4H8WH 1MCIA 3LIZH 4CU6A 2F19H 1J10A 5GHWH 1YDPB 4QXTB 5IFAL 3FB5A 3KLDA 1RUAH 4Z76A 3WJJC 2WANA 1TQCB 1SVZA 2VWEE 3FO9A 1MCOL 3RNQB 1KNOA 2NY3C 2XXMB 1PZUB 4JGUA 4Z7VF 3C2AL 3PWPD 4OKDA 2F54E 4KI1A 1GPOL 1OQOA 2GK2A 4WCYL 4M9OA 5HGBA 4IRSB 4XMLL 3GK8H 3PGCB 4NQVA 1DEDA 2OZ4A 4QGYA 3ORJA 3RPIA 1K9TA 2VLRA 2BVUA 3IVKB 3FOLA 4XP4H 1HOCB 4NBZB 5BO1L 3FB6B 2ZZUT 2DDQH 5EBLB 4ODUB 3BN3B 1CXLA 3PJSA 3VXNB 1YECH 5B22A 4HG4J 4Y2DB 2XFXA 1CDJA 1CQKA 2DM7A 5D1ZB 3HUJF 5IOPB 3PIQA 5F7KC 3A6BH 1MCFA 4OQTA 1J7VR 3G5YB 3MLYL 1FNLA 2H1PH 5L88L 1KGCD 3EOTH 5DA0B 1I9JL 3ZKNC 2HRPL 4BA8A 4YHML 4HIJA 2DKUA 4PLJD 4P5KA 2AP2A 2ZUYA 5SWZA 1LDPH 1LK2B 1A1NA 5GS1C 5BS0E 1D6EB 4HUUA 2PYED 1DL7L 5DFVC 5D8JH 5C09E 2P49B 4IRZH 4HF5H 5D2NC 4YHIB 1MRDL 3QIWD 2NY2C 1FCGA 5K9KB 1E6JH 2A6JA 4Q6IC 4R90H 3WS6A 3MMEB 4QHUA 2EXYD 2FBJH 5J1SC 1LP9B 2L7JA 4FQXC 3EOTL 2VAJA 2QADC 5HHME 4P4KD 3NTCL 1CICA 4JDTL 4M61A 2XT1B 1PQZA 4ZSOA 1DLFH 1RZ7H 4R2GC 5HGAB 3JXAA 2EXWD 1SQ2N 1T89C 4WDIA 4NSKB 5D1XC 2D9CA 3EOAB 2GK0B 4MDIB 4DN4L 4X99A 1HKLL 1NUNB 4NZTL 1ZANL 1DANT 5I1DA 3WLBB 5EUOE 1E4XH 2XA3A 3TVMC 4BZ2L 1XGPA 1SBSL 2CO7B 4N1EA 4G7VH 4H1LH 4CJ1A 1MCRA 2A83B 4PS4L 3AC0A 4PJ5D 4RX4D 1T2JA 2YA0A 1L0QA 5D96B 2BY3A 4GRWF 1T5WB 2HLFC 3LKNB 4V1DB 4XP6H 1B0WA 1H5BB 3PWNB 1CG9B 2YC1A 3EIFA 1U8MB 1WTGT 2I26N 3I3EA 4MMXC 4PRPB 4YK4B 4UTAL 1A7NH 3V0VA 3DTXB 2FHBA 3T77A 1WC7B 3QH3B 4UUJB 4YDLC 4WUUD 1JCKA 4U6XA 1Q94B 3AU1B 2JKXA 3S7GA 3KG5A 2F9BT 3W11D 5JOFB 5SWSA 1Z2KA 4J1UA 5IBUG 3WUWA 3DRTB 5EUOF 5IV2B 4ZTPH 2YZ8A 4XPAL 1WEJH 4JRYD 2B8OT 5ITFB 3RVUC 4Z7UF 3VA2C 5KJRL 2IANE 1W0YT 2W9DH 3EYVA 3NIFE 2W38A 1J9CT 3L3DA 1MSPA 3L3IA 5IMKB 3QZWG 5FO8B 3UDWC 3D69A 1HEZB 4MJ4A 1RUAL 3UC0H 4EOWH 2VXQH 5CFHA 2AEIT 2ICWJ 3H3PH 3KPOA 3QRFM 4ZUSB 1EX0A 3K80A 4GAGH 4MNHA 4MXQC 4J3SA 3P4OA 4DGVL 1FAIL 1H0DA 2XTJB 3CUPB 4RQQB 3GZKA 5I1HL 3TN0C 4OLYL 3CFIC 4I4WB 4JJ5B 1W2KT 1T03L 3WYRA 4FQHA 4YDIL 5D2NE 4BFGA 1BQUA 4I0PA 5I76B 3T0VA 1BZ7B 3DX8B 4EDXB 2E9JA 1A2YB 1T7YA 4N90E 4RISL 3H3KA 3H7LA 3OPZL 4X7EC 4M02A 2J8OA 3JV0A 2BOBB 5CEZL 3LKRB 3DVGB 1U8IB 1CFSA 2CIKB 3UP1A 1ZXQA 2R0LL 4UU9B 3SDAD 2EE9A 4EN3D 5CCKH 2QLVB 3AXLA 3MJ8B 1F11A 3TJEL 3EYSL 5HYJD 4PJEE 5BVJA 5HXMA 1NAMA 1IL1B 2APWA 3L3JA 5C3LD 4KVNH 4Y4FA 1KGCE 4JZJA 5HGDA 3P40A 4J4PD 2J8UF 3OAUL 3CFCL 1JPST 2HT4C 4XPAH 3NGBC 1I1AD 3L3GA 4HGWB 3E2HB 1RZKH 3GSWA 2JIXB 3IXAA 4Z8FH 2MWCA 3F5WB 3FRPG 1FVEB 2BMKA 5I18L 1QFWL 1QLEH 35C8H 4L4TE 3O9WD 2ICEB 2K7PA 5TF1L 4HUMB 3HPLB 1XF5A 5HHVL 2X4RB 4X5LA 3D9AH 1U8HB 2DWDB 1KUMA 1KEGH 2M26A 3BISA 1X5GA 3HAEB 4S1SH 5ACZB 4PJXE 3HE7A 5ICYB 3Q1SH 5LGHL 1FFOA 2A9ML 2VLKD 3WHXA 1KIUA 3D2UD 3QXWA 1H0DB 1KXVC 4I9WD 2ARJB 1UYWL 5FB8B 3CUPA 5ESAB 4XAKE 3ZE1E 1QACA 3T04D 4XX1E 1LEGA 4QEGA 1TTUA 3QUYD 1T3FA 3EJJX 2HFFB 4HJ0D 5HY9B 3HZMB 5A2IH 3ZDXF 4HJGB 1B3JA 4WU7B 1Q9OB 2N1KA 4CU8A 3B9EA 4FXGA 1FIGH 4X6FB 5DLMH 2BZDA 1TZHA 3FCTB 3HB3C 1MFDL 3CU7A 2G2RA 3VXTB 4I13B 3IS0X 1MCPH 3H9SA 1NGQH 3VD5A 5F72S 5C0AD 1U3HB 5K59E 3O81A 3MLVL 3BKYL 1O7VA 3HI1B 1NCWL 3HE7D 5E8DH 1JNLH 1ACYH 3I50H 4OJFL 1XGQB 5DUBA 2NY1D 3QWQB 3QDGB 2VQTA 5HHXL 3SQOL 4NN5C 1AIFB 2EDLA 5I1EH 1HOCA 2Y4SA 4PRAA 3RGVA 3I6GB 4MQXC 2VDPH 2Y5EA 1JBJA 5CJXA 4PRID 3ZDXE 4Q97A 2HFEB 3RQ3A 1FO0L 5I0DA 4X6BB 5DZOA 4K3JL 3IDYB 3VGAC 3R1GL 5I9QB 2WINB 2BVTA 4Y16C 1OF2B 4K55A 4DGYL 4XB8A 1I9EA 3GJEA 4XTRC 3RIFK 1YECL 4X6CA 5TE6L 1XH3A 2EXWC 4JPKL 2DDQL 5E9DE 4KHTH 5TPWL 4PJDA 1BOGA 3Q0HA 4XBGB 1CL7L 4PLNC 1A0QH 1ZWIB 3EGSB 1OAQH 1AO7D 3A0OA 3B83A 3QEQA 3VXTA 2WIIB 4H25A 2IC2A 1FPTL 4TSBL 2W07A 3NVQA 4JHWL 1KT2A 4FS0A 4P46D 5KS9F 1CDCA 5EU6E 2VISA 2X7LA 4WU7A 1MCSA 3AREC 1Z0MA 4JFYB 5BV7H 1F4XL 1T22A 3GMQB 1NPUA 3ALPA 4LDLB 3IU3A 3CDGB 1PY9A 3FL7A 1XR8A 4TRPH 4LU5H 2DMBA 5DVKA 2MPAL 5D2NB 3DXAD 4LLWB 1QFPA 5C0GB 4R9HA 1J05A 2R1XB 3TNMB 3VFUA 7FABL 1UWEH 5B39G 1TVHA 1QFWM 2BNUB 5F3BB 5DURB 5TDPB 3QPXH 4WO4D 5CJ8A 1YEDA 2QQLL 5TDNB 4KKAD 1OW0C 5IVZA 1BBJA 4AQOA 3JTSB 1RJCA 3DVNA 3ARDC 1MJ7L 1JV5A 4X7DC 1OM3H 3ROOA 5I6XC 1FYTD 1UQSA 3DURB 5JPNA 2F54B 3QQ3B 5MEPB 2ZG2A 1JK8B 2W9LA 1RZKL 1S7RA 3CAFA 4Y1AA 2ZJSL 1UKTA 3WSQL 3SKOA 3V6OA 3QCTH 1UA6L 4NFDA 2B4CH 2MQ0A 3INUL 3D87B 5FHAL 3G04B 2WQRA 4NQEB 4AIOA 2BSED 3KNBB 3RWEB 4ZPTA 4HKBB 4C56A 2AXFA 2I9LA 2JJTC 1HQ4A 4CUCA 3VFVA 3R8QA 4K8RD 3D9AL 4NWTL 1DQLH 5SWSB 4G3YH 3FQNA 2MQCA 3MJGX 1R3LA 1OP5K 1FNGA 3KPRD 1FL5B 1K8IB 4PRBB 3IAPA 1CFNB 3PHOB 3VXME 3EO0B 1EO5A 5I8EA 2H2PC 2FYYA 1WUNT 2OI9B 4NO0B 4JZJC 3E6HA 5D72L 1JYNA 5EPMB 2DYPD 3HR5A 1SEBB 1DDHB 1VFUA 1EEZA 2XZCL 4PV8A 4ELKA 3TYFA 4Z6AT 1FFPB 2DQCL 3W0WD 5DD5L 4EN3C 3NN8A 3ABZA 5DMIL 4ZTPL 3C5SB 4RGOL 4HHAB 4P49A 2H6PA 5IM7A 3ARUA 1HQRB 5E6IA 5SX4H 3WIHH 4GBXB 4WWKD 2F58H 4WWKA 2XFXB 5C6TH 3SGKA 2OJZL 4J4PC 5IBTL 3SKOB 2E8YA 3OG6B 5ICZB 1BQLH 4TNVF 2XA8H 4M4RA 1C1EL 2XZAL 4OZIF 4YHIA 3IDJA 4RWYH 1H3PL 5IVZB 1D5ZB 3PWVA 3QNZA 4UIMB 5K9QG 4RCAA 1G0DA 4XVSL 1T80A 2RFXB 5LGJA 3QHZL 5C1MB 3RVXC 1JWUB 4G42A 1T66D 3FTGA 3GUTA 3PWLB 5C0BA 1GHFH 3V8CA 4DKDC 1SHMA 3WFBH 5IQ7L 3U7WL 1FZKB 2WBWB 3RDTA 5IHLB 4NQDA 2D2OA 2OL3A 3UYRH 1CFVL 1KULA 4OUUA 2WMPA 2YD6A 4R4BA 3DMMB 5C9KA 5B38A 4J7RA 2ITCA 3FT4A 2NW3B 2EDFA 2KZWA 4JO4L 5BS0B 1MI5A 4HC1H 2LV4A 3QO1B 5FV1L 2GK0A 3FB8A 4L8DA 4LLVB 2Z31D 4KMTH 4EI5B 4WHTA 1A6TA 2MOVA 2ZSWB 5K9OB 2B7DT 2Y36L 4BZ1L 3CXHJ 4YR6B 5DJZB 2EKSA 4NIKB 4UV4H 4B53A 3BIKB 1K6QL 1JNNH 3BP6A 5C08D 1RJYB 1ZLSH 1ZGLB 4KI5E 1EJOH 4OD1L 1ES0A 4ERSL 4O51B 1ITCA 4TSCH 5IMMA 3TFKD 3OB8A 5I71B 4Y4KA 3VXUD 1RMFL 3GSNL 3QO0A 3BUYB 5TE7H 4NKDA 3O11A 1HK6A 1QKZH 1FO0A 4HPYL 3H9HA 2PW1B 3LHPH 2XWJB 4QRPD 3B9KC 3FFCA 3AU1A 4FZ8L 3O4LA 3PXJA 3F6IA 1L6XA 5EU7C 5J8OA 5GJSH 1KJ2L 4EIGB 3HE7C 4P57A 2PXYC 1FGVH 2YMXH 1EMTH 1EIBA 4NT6B 5I17B 4LIQH 3QJFB 3P30H 4P2RB 1B4JL 1NL0L 4GRLD 2VAAA 1HINH 3T8XA 3MROA 2WK2A 5LGHH 1E28A 1RAMA 2KZ1B 1DFBH 5HYSB 3FQTA 3HAEH 3Q5OA 3ARFA 4JFDE 1V8HA 4M1GH 5B3JF 4JN1L 5ACMA 2B0SL 4QRTB 4Y4HD 1FNAA 3D0VB 4OCRL 5GISH 2D0GA 3ARQA 3BZFA 5E56A 4I48B 2HVJB 2DQDL 4YHKH 1RK0A 1KCVL 4GW4A 1JZ4A 2RBLA 5EOTA 5MP6H 5DMYA 3U6RB 4L8SB 3PDOB 2Q3AA 3EOBB 5EOCJ 2H2SC 2J8UA 3ARGB 1IM9D 4NO5A 4PY8I 4NUJA 4NN7C 1AR1C 5DK2B 4G8EA 1PLGL 4Z7OE 3IETB 4GRWH 3PP4L 4M5ZH 4R90L 3RGVB 3BT2L 3WXWH 1DR9A 3LEXA 2GTWA 4HIHB 2R0ZL 3KPMA 4G9FA 1IGYB 1JN6A 5C0FA 2AS5M 1T1WB 1WZ1L 1Z9LA 3EHBD 5IJVB 3KYMB 2MCPH 3ARED 4WFHE 3G5ZB 1DVFD 3MRNA 4FP8L 3TN0A 3PQYA 5ENWB 1ZT1A 1BFOB 1VADA 1OVZA 3LQZB 2QKIA 1KN4L 4PREB 1MOEA 3TT3H 5IK3A 2F5BH 5ESQB 5EU4B 3C8HA 4WWID 4AEIL 1X44A 4X6EA 1DQJA 4E5XB 3RWCA 4YWGH 1F3JB 1F8TH 1CCZA 2XY2A 1KCSL 1PG7X 2XZQH 4PV9A 1IEAA 2DQJL 2DWEB 2ICEA 1PDKA 3WLWC 3TYGL 1N64L 5EU7E 4NSKA 1J1XH 2G9HA 3EDDA 1U93B 1UVQB 4KQ3H 1A3RL 5C0CD 1ZGLP 4KDVA 1FVDB 1IGJB 3L3GB 4XPFL 4PJBF 3BGMA 2AJYL 5DK2A 3HE7B 1ZHLB 3G5VA 3PHQA 2NMSA 4DOHE 4XNYH 1V7MH 1JGVH 2FX7L 2AQ3A 1RHHA 4PJHA 4XT1C 4PJFF 1D5XB 5DFTA 4DVBB 3AS2A 3T4YB 3FMGL 5F6HI 2X40A 2P8LA 4XGZA 4DVRL 4OZIB 4ODWB 2FL5A 2Z35A 5F9JA 2I07A 1MY7A 3T77B 1MCEA 1WIUA 5DURD 1VGKB 3U1SH 2W9EL 3LQZA 5B8CB 1IGYA 3RWJB 3WKNA 4JQVC 2AXGB 2EYRA 5CS7A 3LN4A 4JFEA 2Z92A 4G8GE 3WN5C 4PJBE 3G5ZA 3RZCD 4W68A 3UTTE 4JO3H 3B9AA 3QCTL 5K9KA 3MJ7A 1CXFA 4JGJA 15C8H 4OLZH 1X5ZA 5D4QA 3NCJL 1QR4A 3GSNB 5DJ0B 1HCVA 2CRMA 1OM3L 4XVJH 4CMHC 5CSZA 4Z78B 5CUSH 4WW1A 4U2ZA 1DBML 4FFZH 4GAFB 3V5HA 1JPFA 4RA3A 4DAGH 3L5JA 5JZ7D 3FQRB 3LKSB 4J3WA 4OCLC 4XH2B 1EFQA 4FQXA 1G7JA 4H88H 2G60H 5IMLA 1NAMH 4QRPE 5I1AB 4PRDB 4Q9CA 3CVHB 1DLFL 1RZ7L 3S5LB 2CLZB 3HR6A 3SDCB 1TDQA 2GJZB 5E70A 3K0WA 4UIKH 1VGEH 5EIIA 2P8PA 3HC4L 3MA9H 3K2UH 2BSTA 3ILPB 2Z91A 4C54A 1J8HA 5GS1A 3U1SL 2A74A 1YMHB 1J8HD 2UUDK 4KQ4H 5SWQB 1I7RB 2VR9A 1IAIL 4QLRA 5C0IB 1E6JL 1S78D 4HH9A 1L9MA 3IFPA 2HLAA 3O3BB 4M7JL 5AD0B 4OCNC 2WLZA 4HK0B 4D9QD 4HIEA 4PUBH 1F58L 4LSQH 1A21A 1QRKA 4M00A