5B3LA

C101s mutant of flavodoxin from pseudomonas aeruginosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
150
structure length
150
Chain Sequence
MKVAILSGSVYGTAEEVARHAQKLLSAAGLEASHLPRASLDELKAFAPEAFLVVTSTTGMGELPDNLQPLYYAIRDQLPAWHGLPGGVIGLGDSSYGDTFSGGGEQVRELFGELGVREVLPMLRLDASETVTPETDAEPWLAEFAAALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PA3435
publication title C101S mutant of Flavodoxin from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Electron transport
total genus 55
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b3lA00
3P0RA 1D04A 5LJIA 4YAFA 4F8YA 1ZX1A 5EAIA 1FLAA 1QRDA 1CZLA 4PTYA 3NHFA 3NHYA 3O2NA 4LA4A 1FLNA 1CZOA 1AHNA 3KLBA 3L9WA 1FLDA 2AMJA 1FVXA 1WSWA 4LTMA 1CZKA 1T5BA 1ZWKA 1AKTA 5F4BA 3ESYA 2FZVA 3OX3A 4NULA 4ESEA 5ULLA 4XDHA 1OBVA 3N3BC 2Q62A 4QOIA 5NULA 2MT9A 2X2OA 4OXXA 3FVWA 1T0IA 3GAMA 1FUEA 1I1OA 2M6SA 1F4PA 1QHEA 1CZUA 4U7FA 2M6RA 3F2VA 2OYSA 1WSBA 3NHWA 4Y9UA 1J9GA 1YRHA 3OJXA 2FCRA 4DY4A 2BMVA 5FUQA 2QR2A 4FGKA 1KBOA 4R81A 2MWMA 1H69A 2Z9DA 4QOHA 1B1CA 3NHJA 4BMPB 1XYYA 3F6RA 1YCFA 3NHKA 3OJWA 1YCHA 3NFRA 4ZVMA 1FLVA 1AKUA 4D02A 1H66A 5NLLA 2MTBA 1OFVA 4YALA 2FLVA 2GSWA 1FTGA 2V5UA 3HR4A 1TIKA 1AMOA 5TGZA 4LTDA 1D03A 2QX8A 2FDXA 1AKVA 2KQUA 1CZRA 3NLLA 3FX2A 5LVAA 5LBTA 4ZVKA 4YAOA 3KAQA 2QWXA 2Z98A 2BPOA 1YKGA 2A5LA 3LCMA 2R96A 4U7GA 3NHUA 3S2YA 3GFRA 4PU0A 1RCFA 5LBUA 2HPVA 4LAFA 2OHIA 4N9QA 1J9ZA 2BZSA 3W77A 4C76A 4GR9A 2XOEA 1OBOA 5FX2A 4ICIA 2F1OA 3N39C 4Y7CA 4C0WA 4QOJA 5JROA 5FA6A 1XT6A 3G5MA 5F51A 1RTTA 1J8QA 3OWHA 1DX9A 2X2PA 1BVYF 5BUCA 4S24A 4Y9RA 6NULA 1SG0A 3ZHOA 2ZKIA 3ES9A 1YDGA 1AKWA 5EA2A 3TE7A 1DXOA 3GFQA 3N3AC 5F12A 1QBGA 1RLJA 1YOBA 3B6MA 3GFSA 3W7AA 4YAWA 1NNI1 3QE2A 3K20A 1TLLA 3OWXA 2QX6A 4DIKA 2QX9A 4FGLA 3QFRA 1CZNA 5EMNA 5LLDA 3OX1A 2FOXA 2FX2A 3UXHA 3NHLA 5B3LA 4YAUA 4C14A 3ESZA 3W79A 4NLLA 3HA2A 3F90A 4CETA 5LJLA 3EYWA 2QX4A 4QOEA 2BF4A 2OHJA 1AKRA 4QOFA 3OX2A 3UXEA 1E5DA 3LT5A 4GI5A 3FJOA 1JA1A 1VMEA 1GG5A 2N1MA 4XDGA 2OHHA 4QOGA 1DXQA 3HLYA 2XODA 2FAXA 3FW1A 3NHPA 1AZLA 3KAPA 1XYVA 2R97A 3TEMA 1YCGA 2D5IA 4FGJA 5B3KA 1AKQA 2QMYA 1CZHA 4HS4A 4N65A 2V9CA 2Q9UA 3NHSA 4U7HA 4C0XA 2V5VA 3KEGA 3O73A 3QFCA 1BU5A 1ZWLA 4HEQA 3OVMA 1XI2A 4H2DA 2RG1A 5A4KA 2KLBA 1QR2A 2WC1A 4N82A 3FNIA 4ZVNA 1D4AA 5LMCA 1J9EA 1V4BA 3EDOA 4QODA 2HNAA 4H6PA 4GQIA 3D7NA 2BN4A 2QMZA 2FZ5A 2MOKA 2Z9BA 1C7EA 3K1YA 3W78A 4CF6A 1KBQA 1RLIA 1SQSA 2B3DA 3RPEA 4YQEA 4J8PA 4ZVLA 1C7FA 1X77A 3F6SA 2Z9CA 3B6IA 4BMOB 3NHRA 3SVLA 2ARKA 4M0CA 4DILA 2W5UA 2FVXA 3B6JA 4FX2A 4PTZA 3U7IA 1JA0A 3ESXA 3L9XA 1AG9A 2HNBA 3R6WA 4LTNA 3JSXA 3U7RA 3TZBA 1FX1A 3B6KA
chains in the Genus database with same CATH superfamily
3JATA 4HG2A 4JI0B 5BN5A 3RBAA 1Q3KA 2XCRB 1EUYA 1AO3A 3I12A 1XNRB 1XVAA 1XD8A 4BQPA 3Q1LA 2JA2A 3BMCB 3L7YA 4CIVA 2ZTLA 3D6NB 1VI5A 3PFHA 3UOGA 3UH0A 4ZAGA 1KIAA 1UPBA 1MJHA 3RO7A 2R8BA 4F84A 3CLRC 2ZQZA 3Q7PA 2QLTA 4RK0A 1I3OA 2A9KA 1MRSA 2R87A 2H7XA 3IV6A 1E1YA 4RA9A 4TN5A 2FFJA 4B31A 1B14A 3FFAA 2HV9A 3B2EA 1QE3A 2HPZA 3PHHA 3G1WA 3LQQA 5TQ0B 1JQ5A 1TU4A 2G28A 4XQ0A 1LC3A 1YL6A 1S6YA 4EUSA 4AKHA 1G2PA 1QAQA 1C9DB 2PXAA 4O33A 4PZLA 5BSRA 3JZMA 1N5LA 4WWHA 1GV0A 2FMFA 4M86A 3R4CA 4WOJA 5J4VA 4D3YA 2W37A 3JD3A 1UZLA 2Q27A 1ESMA 1NLMA 3AETB 3VPFA 2AZXA 4H60A 2EU8A 3R7LA 3IDOA 2RJOA 2J7PA 1DUIA 1AM4D 1WY7A 1FU8A 5KYWA 3CX4A 3GMIA 2H3HA 4MI9A 1A2OA 5DCUA 4GMDA 2ECKA 4EQ6B 4LF8B 4LQCA 2WV7A 3CCBA 1E7WA 1T2DA 4OQFA 2XQJA 2B8TA 4J7AA 4Q47A 2MU1A 4X7MA 4E2FA 1CUXA 5C2JB 1AQIA 1A9ZA 1QYXA 4HUQB 4PO9A 1NBMA 3MTEA 3VOSA 4TTRA 2JFQA 2AG6A 3A8TA 1J8YF 2JBAA 3QLUA 1G8HA 3DOEA 4EHDA 4IIGA 3Q7EA 1THMA 4XYEA 2VJLA 5CT9A 3A6HA 1G8MA 4RCZA 1H2YA 5HK9A 2FSUA 2GEFA 2ZM6B 3WAJA 5IC6A 2XE7A 3A4VA 3C6MA 4KP7A 3RYFA 1THZA 4BRUA 2GJ8A 4GOOD 4EY3A 3FMPB 5BRNA 2E9SA 5G4KA 3ZYCA 3IODA 3KBOA 5EIOA 1IM8A 1XD2B 4FKMA 4MGKR 4KIUA 3JQPA 3ND8A 1T9HA 1D5CA 2OQRA 4AM8A 4CRWB 4ZEMA 1N1MA 3UB3A 2CYBA 4X8LA 3WFJA 4DL9A 2BHTA 1Y5RA 3RIYA 4MV6A 1QIGA 1Y1LA 1ECFA 3JR3A 3T1TA 1Y7PA 5EQJB 5T6BA 3TL6A 2UZ1A 1T6NA 3GNQA 1X9HA 1M5UA 1XA4A 4J29A 5IXSA 4AKIA 2R00C 5D86A 4F3YA 1CR1A 1MX3A 3WWPA 4NOMA 3KO8A 1KKMA 1VMDA 3QMVA 1RAGA 1D6MA 1AHHA 1K8ZB 2X6RA 1XJ5A 1RBYA 1YRHA 3OD5A 3DBHB 4FNAA 4MVXA 1XHFA 2HSZA 5D01A 3CT6A 1JJIA 1UWVA 1E1CA 5HF9A 1E99A 1GPUA 2EP7A 2XTJA 3DQZA 3FUWA 4G9BA 5ALPA 5KWSA 1JSCA 2ZR0A 3WL4A 4BFXA 3INTA 4I19A 2UDPA 1H69A 1X1CA 3OECA 1IBLB 2PX5A 3LAWA 1WQ3A 4GD3Q 4BZXA 1XCPA 1VPDA 1WEKA 4KRGA 3IMFA 3ESQA 2WJPA 1U3UA 4YCMA 1L5WA 1BN7A 3W4JA 4AMVA 4JVNA 1ZGZA 2DU8A 2I2XB 3I1YA 3TEFA 1USWA 5IM4F 5CPFA 1M33A 2O8CA 3NFRA 1K3UB 3Q7QA 5E4TA 3WWOA 2XMPA 1B8NA 2RFLA 5HKLA 5T7BA 1WHTA 2WTEA 4ZRNA 1C9YA 2O05A 4DNXA 2BEUB 4GYYA 3N2GA 5FFMA 4CTNA 1KY3A 3ETNA 2H7CA 4ZU1X 3DQPA 1VIVA 3H97A 4G9GA 3BS4A 1DAKA 5CH8A 4BNDA 2IF0A 3AC0A 1MX1A 2ZJ0A 3MGKA 4TUYA 3KUUA 4DT1A 1GN9A 3OCXA 2FDRA 1C7RA 1I7LA 2XBLA 2Q9AA 4FFPA 4E11A 1BDIA 1O9HA 1IRIA 2C9ZA 1BHJA 1W5AA 1G5RA 3KTAA 1E2KA 2ODWA 4PCAA 4YVFA 5ALOA 3UZUA 2IA5A 1JYSA 1QRUA 4CEIA 3GDOA 1SVIA 2JFYA 5KMGA 3VVMA 4BXOB 1O9BA 1ZS9A 3WIEA 3HYCA 3AJ9A 2W9XA 1NUUA 1TX4B 3EIOA 1GKIA 3CB2A 2WD7B 4LY0A 1HDRA 4M7RA 5LBTA 2CXXA 3F9CA 1C81A 2SKCA 3JQDA 3KAQA 1CQZA 3BD6A 3CRNA 5JC8A 4REOA 1LLCA 4YR9A 1IEVA 3B3AA 4M1WA 3ZK9A 1T9CA 3EVDA 3F4KA 3ZWNA 4QM7A 3NETA 4G8DA 4RLFA 1NC1A 1QG6A 3NP7A 4QFCA 2GFHA 5CG2A 1FIUA 4OGWA 2W22A 3ZJVA 4YAIA 5TVKA 2NVUA 1FMJA 3PE6A 3WY9A 4AJHA 2XJ9A 1KY4A 3FFTA 2ZANA 3NV7A 2VWHA 5LB4A 1M6HA 3DONA 1CY0A 4BLOA 3OFND 4TM8A 1U6IA 4MHSA 3BD9A 3AESB 3MTQA 2WMNB 4NMHA 1FYFA 5JH7A 4EG6A 1EDOA 2X1HA 1F0YA 1X87A 1QP4A 4XM1A 4Q24A 1WXXA 5H80A 2V7VA 3UQZA 4NRDA 4O4LB 4JNKA 1KRXA 2WUWE 2OPBA 4WL0A 4CM8A 3LX4A 3GLFA 3C3JA 3HDVA 1UDRA 2GN9A 4GO1A 5DM1A 2PL3A 3NDIA 2UYCA 3O1JC 4GR9A 3FPEA 1OBOA 3CT4A 1JKMA 1E4YA 5EVCA 1Q3HA 1UMBA 2YUIA 3SNHA 3JQAA 1ZM3A 2CLMB 2R48A 4RSGA 4RULA 1SB9A 3TKLA 1EQ2A 1GYRA 3FCUB 4KVZA 3TI9A 4J1TC 2OECA 1AGRA 3BCHA 2X77A 4X85A 3PGMA 3W9YA 3A2MA 1XT6A 5JMPA 4F4DA 1UP6A 2GGSA 3V55A 3ZE6A 1DWOA 4HB0A 2V1XA 4DUYB 1PQWA 2G0NA 5E2AA 3UKDA 5GVRA 1R8XA 1ULBA 4C43A 5JZMA 1A88A 4AJNA 4KMOA 4MR7B 1TO6A 4UEWA 4Z51A 2W6JA 1BMDA 1KZ6A 2BI8A 3GAZA 3HJGA 1QP8A 4ME6A 4C4SA 821PA 5IC4A 1AQ6A 2C0CA 2XDQB 3FAZA 4OB8A 3UGKA 5JJ5A 2P4SA 1SD5A 4Z54A 4E30A 2JGKA 4RY9A 2Y93A 3HHPA 3KKOA 4TYQA 2YRWA 2ZWIA 4OHBA 2FUG1 5ETJA 4BVEA 4CM6A 2OFPA 3ZGOA 1YWGO 3I4CA 4PBSA 4PNPA 4WIAA 4BNYA 1ECLA 2WWHA 3N2LA 5C5EA 5CVVA 3W1EA 1HE3A 2X0NA 4AQ7A 5IJ9A 1DTEA 3DWGA 3MRTA 3G13A 1DVRA 1P1RA 4F4JA 5C32A 2FXVA 3E9QA 5FPTA 4KXWA 3ZNNA 1U8XX 4KI0A 2HQBA 4O1MA 5K5EA 1WD5A 2P27A 2QRLA 2ZAGA 3G8AA 2W2LA 1CULC 4ZMSA 3S99A 5GGYA 1UBTS 2QB5A 2V3VA 3QQPA 2UZ0A 5JBNA 1O3YA 2QUAA 2K2QB 3BJIC 3TOSA 3EIHA 2ZPUA 4QGGA 5G0VA 3ZVLA 2JGIA 2VHVA 2AJDA 4ZP1A 4A8JB 4IOKA 2Z95A 1HYQA 5JYDA 4OGFA 2WOOA 4NEQA 3D5QA 4GBMA 2FEWB 3QX9A 5ALHA 2FN3A 4FUTA 4ZTBA 5FLEX 5IDQA 1KMQA 4N8SA 2V6FA 3UHAA 4E08A 3OBBA 1PWZA 3VAAA 3L0ZA 5IAAA 1PW7A 4BJ5A 4DHEA 5DHQA 4DC0A 1LI5A 1SXGA 3G5LA 1O0BA 4KGZA 1TJYA 2CE2X 3CRRA 3IKLA 4UASA 3LUJA 4DCMA 5DW3A 4ENWA 2LGJA 2OILA 1Z0KA 4JUDX 4YMWA 1CUDA 5CA1A 1K88A 4EGCB 3WYAA 1QFYA 1NY6A 3HYLA 1Y34E 1Q92A 3IBYA 4OIMA 5BPFA 1T26A 5EE1A 1R15A 4IDOA 1JIJA 3EIQA 4IZOA 4BKPA 5EJ5A 3KNZA 1UWCA 1L5SA 5AM2A 3AVYA 2I1LA 4MQFA 3FUUA 2HJ9A 3O03A 1WDLA 3F90A 4MUAA 4NZOA 3SY8A 3GN1A 3GFGA 4E3WA 3IMGA 5LJLA 4UUOA 4DVJA 1NDUA 1S2DA 3GK3A 3IE0A 4BTEA 4DWOA 3IB6A 1L4LA 4B40A 1JQ3A 5A9SA 2Q45A 2XCSB 4AUNA 3QU9A 4JENA 2HHJA 5DCYA 1CR6A 1DWPA 1JTEA 2FEPA 4RUKA 3CX8A 4C4AA 5DHAA 1RRCA 2PUGA 2WWIA 2HA2A 4PZCA 1F3OA 3P9XA 1GP2A 2R2GA 2DE0X 3QMWA 4HMQA 4YI3A 5HIIA 1CLEA 1L5KA 3S2FA 4E4TA 1B3RA 2P5UA 5IM5A 1YH3A 3V2IA 2IJGX 4DCUA 1AO0A 3BWBA 1VCOA 2H2FA 2I6TA 4M38A 2ZXFA 1FYEA 2I54A 5F9MA 4JLDA 3F5MA 1GUDA 2DRIA 4KXLA 3IO3A 1ZQ9A 1VMKA 1XCMA 4QEDA 3SR4A 4ECAA 4H7FA 3PLRA 3FJYA 3D8TA 2C2OA 2FAXA 3I42A 1TYCA 4JT2A 1DJNA 1KKLA 2VRCA 3DT6A 1BW9A 1GRNA 5ALJA 3D6FA 4HRXA 1YCGA 1JJBA 1R00A 3AF0A 2WFAA 5AIAA 1O4VA 1G21A 3C43A 3ZV5A 4ZYVA 2AN9A 4HMOA 1XMOB 2QM7A 1U7PA 3ASZA 1XXHA 3M4NA 4FCWA 4FFDA 4RH1A 2HUPA 1D09A 1OT5A 1VI6A 1A7AA 3PPIA 5B3KA 2PU7A 1DAEA 5TSDA 4IINA 1EFDN 2EP5A 1IVNA 3UUEA 2R85A 1C41A 3SM9A 2IU3A 3ED5A 4MWBA 2H8GA 4FNGA 1WW8A 1X1TA 2BWJA 2F67A 3RRZA 4Z9AA 2V98A 4YRAA 4WVLA 3T61A 1T34A 2XTMA 3LC7O 1YQXA 5TXGA 4J1QA 2M6LA 4EUNA 3M2TA 3K73O 4ASUA 1M5RA 3P9YA 4CLDA 5CT6A 1G3MA 1E98A 1OXTA 1V1MA 3K8QA 3N7TA 3ABRB 2H7YA 4AWAA 4C0XA 6PFKA 2BLNA 1N2EA 5ITWA 1TA0A 1MAUA 1OC2A 4LWZA 3TB6A 4M0KA 3ZCTA 1S8AA 2GM3A 1E9EA 1CDDA 1MVLA 1UC8A 1IQRA 3LP5A 3LT4A 1GU7A 4L76A 4CTOA 5SZKB 3RTAA 2AFRA 3GXBA 2BFEA 3CLSD 3HWRA 4XPIA 1BU5A 1ZWLA 4OXQA 5EJ8A 1F6WA 4WMLA 3OUZA 1SBQA 4MZXA 2KHZA 4M9RA 2OZVA 4GL4A 4RYLA 4WJKB 1FFXA 2AG8A 1LPNA 2IDKA 5DP2A 3PPVA 3I01M 1DUVG 1Y0BA 4OUDA 3VSDA 4BVLA 2G4LA 3A14A 3COVA 4AS3A 3WZMA 3HL0A 4BLRA 1G3IA 4NHEA 2Q4BA 4ZVNA 4YMSA 4MP3A 3AHFA 3DZ8A 3DFUA 5E3JA 4AUEA 3TOZA 1W36B 4XXHA 3ZN2A 3BM5A 3P8ZA 3UMJA 3PHBE 1AF4A 3NIFB 2IYPA 3A25A 4RV9A 4H15A 4IV5A 2AQ8A 1QSGA 2YN4A 3ZYZA 5CJ2A 2RE8A 1SKYE 4ND8A 2BP7B 4P80A 1GQOA 1T4CA 4AMZA 3CVXA 2LE0A 2WM3A 3HEAA 2UXCB 5EHIA 4RZSA 2QMZA 1PBNA 4P7FA 3OKFA 4Z4EA 1UQUA 2YC4C 4HZUA 1QPBA 1NQTA 2F43B 3HC7A 1A9TA 3GZNB 3AI3A 1HFWA 4HVLA 4DRYA 1QQBA 1XKXA 2VDUE 3LF1A 5HOQA 2IHBA 3FNBA 1ZO8A 4INZA 4UBMA 4CMJA 4UVHA 4DNOA 1YQWA 1IVYA 4PN7A 3GGCA 3GNLA 4OFBA 1X1BA 1K7FB 1E61A 3M7IA 4TS1A 3PSAA 1OAOC 2NIPA 3LT1A 3A36A 2ZRJA 2YV3A 1Z6AA 4C03A 4CUKA 4QPZA 4GX1A 1MMFB 3ANXA 1HRKA 4LXYA 5AVWA 4RC9A 1PW5A 3NBYC 2VF8A 3H5NA 1RFGE 2B8NA 1LQTA 2PV7A 2Z9CA 2ZOSA 3KS9A 4OHRA 3W5UA 5JNLA 1GUBA 3OESA 4HDRB 4ROTA 2GO7A 5H83A 1XDGA 1I1NA 4CIYA 2WWYA 4ZTZB 1J5EB 1QQ7A 5B6IA 1X7ZB 1X3SA 4MO9A 1RP1A 5LKRA 5L40A 1HURA 5BSUA 4RVNA 4PY2A 5DN6A 1W5SA 3NH6A 1J56A 4C6TB 3OZSA 5EIFA 1SKUA 2YCBA 3FMIA 4HWKA 1L4YA 2A5JA 4X44A 3SF8B 1YOVA 3GJRA 1IDN1 5LPNA 1WCIB 2ROQA 4G5RA 4HFJA 3RM3A 1XZGA 4OP3A 1RACA 1EVIA 3MD9A 1GCIA 3NYRA 4HDMA 3C5VA 4P3PA 3ESXA 4WFKA 2DQSA 4ZOEA 3OQMA 3UBTA 2H9IA 2FQYA 1GTVA 2Q9BA 3RSFA 1EQAA 1LLQA 3PD7A 4I66A 1M72A 4AUMA 5ARDA 2JATA 3LS2A 2BMWA 1YZLA 1Z68A 1U6KA 3CEPB 4B0OA 3LGSA 5AK6A 5H59A 2Q1XA 2WE7A 1E59A 3ESRA 4PAGA 3U7RA 1RZRD 3FCSB 2C88A 4DLYA 3N70A 4W9NC 5BUZA 2XNSA 2C7RA 2WI8A 4N7BA 2XRZA 1NQ5A 2PUTA 2YVKA 2CWDA 2OBXA 4Q82A 3UOWA 4FJ2A 4I6EA 3W5JA 1UFQA 5KPJA 5GZ3A 4IFEA 1K98A 2JD2A 3CN9A 3GYGA 3NBMA 4G3XA 4YROA 4ZEOA 3R5XA 4AO8A 2P9CA 1IFXA 3PJFA 4IYJA 3LQFA 4WN3A 3UHJA 4QLBA 2V54A 2FPKA 2WF6A 5BWNA 3L2OB 3E53A 4RGQA 5A5GA 4UBJA 4XIIA 3VTZA 4IEEA 3A0UA 5DB4A 2FSHA 1UXOA 4EF5A 2XKBA 4UJ5A 3K5WA 2CNWA 3BHIA 3OCYA 5KWVA 3ZJUA 3JAWA 4PYMA 1PG0A 2UXDB 4CT5A 3L0DA 1C0PA 3OZWA 4EY4A 1MGPA 4HP8A 1X7HA 2QTMA 2ZYUX 1MAHA 2PBRA 4GP7A 2X0FA 3WLAA 3VGPA 3IP5A 3GH3A 2F8LA 2ZSJA 1YL5A 2R8PA 5AOVA 3FGZA 2BV3A 4ALNA 1XE3A 4H7JA 1E63A 4XUEA 1EPUA 4ZYYA 1IBRA 4J3FA 4LZPA 3RRMA 4IKEA 1G5IA 3IIIA 4N1AA 3BULA 1I13A 4INOA 1N7JA 3ABIA 4PLGA 1RYFA 3G9TA 4JAVC 1QU3A 3HDQA 2JHGA 4QRDA 4FB5A 2PMWB 3CLTD 3IQZA 3LXRA 3IS3A 2OMEA 5FLYA 2Q5JA 4HX2A 4YJGA 5JEDA 4XJTA 4IILA 3QEMA 2RJNA 3PR1A 3LNTA 4W6QA 5CTAA 1TTQB 2RHLA 4B3SB 4ZAFA 3P9NA 2PLRA 1YBMA 3DUFA 3ITNA 2NXEA 4OM8A 4YDQA 5JFTA 4NAVA 1C9EA 4AU1A 1U7UA 2EWMA 1QHEA 2NO9A 1NR7A 3HG7A 1RWKA 4MJ3A 5JCJA 3O4FA 3SBEA 1C1DA 1K7CA 3G5UA 3ZCVA 2PKQO 4L7VA 1OZGA 5J5CA 4B5LA 2XVYA 2Y0CA 1U7TA 1LJLA 3BXFA 1R5OA 4YUXA 1L7PA 2IYTA 4MWTA 2EJUA 4RMJA 1WUTA 4M0PA 2FMIA 3NYQA 4FINA 3AVWA 3AEQB 4QQNA 4M8LA 2HJHA 2OLJA 3F2VA 4HSGA 4TSRA 3SS8A 3WI7A 2Y1KA 4FE4A 4OQDA 4YUYA 5JDCA 5K0LA 3ELDA 3B36A 2CJPA 1Z6PA 3FRJA 3QVKA 5T4BA 1H65A 2FEKA 3D6HA 1AVTA 3UK7A 2NX2A 3W0LB 4JLPA 2AC2A 2RGRA 3EOBI 1XQVA 1V1RB 2ECPA 3C3EA 5A4DA 5CB8A 2JIDA 3QPVA 4F96A 1DOZA 1F9EA 3ZGXA 4WACA 2GI4A 3WGOA 3QKTA 2O3JA 1NWHA 4GSKA 4N03A 1GARA 1PX2A 2WIDA 1Q7RA 3CF4A 3DE7X 3LC0A 4WFIA 5L3SB 2Z1MA 1VJDA 2FMXA 1XC7A 3EDYA 2IEAA 5TVGA 4D6PA 3U1TA 2HZBA 3O4IA 1LJ8A 1WQ1R 4EFNA 4X94A 4CN9A 3L8ZA 3GJ4A 1DIHA 1BOFA 2ZTMA 3LQYA 4RPLA 4WECA 3LG2A 3DE4X 4H0FA 3NAZA 1PIWA 1TFUA 4AS2A 4OKIA 3K8ZA 1CRZA 1C80A 1F2UA 3BICA 1U5AA 2YWCA 4L9RA 2LRHA 4Q9NA 1R50A 4R7ZA 4LFAB 2O5CA 1SB8A 1U3FA 5G0SA 3I0MA 1WHSB 2OM6A 2QN7A 4WADA 1IOVA 2ZRBA 3BC1A 1FTGA 4HWTA 5DX1A 3GN2A 1SKYB 1ADJA 2VWGA 3IHTA 1CUJA 1Q84A 1WXHA 1ZEMA 3E0QA 3ZGNA 2W11A 1PKEA 1DXHA 2G9QA 5IKEA 4KRXA 1Z4MA 1Z5GA 2R6AA 5C8YF 4LBZA 3CXRA 3W3AA 4Q1VA 3FM9A 2AJ8A 2ONZA 2A7QA 4G1FA 3PEYA 5CDYA 2KMLA 2JJ8A 1VJ5A 1X7YA 1QAMA 2P68A 4U00A 5JVDB 2E18A 5LR6A 2NXWA 5JS1A 1CZRA 3W4IA 5K09A 1J5PA 1LDEA 2CUTA 3FD8A 3S81A 2C97A 1OC4A 1KDRA 1LS1A 3KZCA 3R5HA 1DB3A 3BL6A 3EHEA 4FVTA 1C3LA 4HO1X 4G0MA 2ZCVA 2P6UA 3BOSA 3N0RA 3PP8A 4DEYA 2BPOA 2AB0A 3IEUA 1AUVA 1RYBA 1YAJA 3O5AA 1H4TA 2P6PA 3G7SA 1SO8A 2XUGA 3AIMA 5ALDA 2PRJA 4GXRA 4HWPA 3LA6A 4WY2A 3C87A 2JI4A 3ZJYA 2PH7A 1RQPA 3DWFA 5B3JA 2GK7A 2VA9A 2CFTA 2C99A 3LCUA 3FPHA 4HDNB 4Q4JB 4E2XA 4ILKA 1E2LA 4KR0A 2G4VA 3MRSA 4XIGS 3RF6A 2RMKA 1CEXA 4L8GA 1PK8A 1PO7A 2BCGY 2GZMA 3BF8A 2HXGA 2C98A 2I4MA 2VP9A 3UWPA 1MBZA 2J3HA 4IMJB 4DLWA 5EHXA 4L4SA 1YT5A 2YWEA 2WVHA 4TV9F 2VRWA 4X8HA 1JSZA 2D54A 3IP9A 1P3JA 1A7KA 1FYDA 3DTVD 2Y71A 5EUBA 3ROGA 1K9SA 3SLRA 2X0RA 1XA0A 2WBLC 3I1IA 4J4BA 2ILTA 4Q9AA 4B84A 3FDZB 5KTMA 3H42B 2IXEA 5JTUA 3FFWA 1PBTA 1VCNA 1ECPA 1IJFA 1G8KA 4ICIA 3QI7A 3T5TA 1HDIA 2ILVA 3H6HA 2RARA 1DX4A 1YBAA 3A3OA 1VSVA 5H1YA 3DOFA 5CA0A 3ZVRA 3ORRA 5CTJA 3TLKA 5BV0A 5DYTA 1FW8A 4ZARA 3PLAE 1YKSA 4IV0A 3UAYA 4M1ZA 1CY8A 1TMKA 1U9IC 3AIOA 5KINB 2C2ZA 1M66A 4U2FA 2E6KA 2YMQA 3KE8A 2XW6A 3TQTA 4EHFA 1KTIA 1XU9A 3IAFA 2O52A 5I9TA 3LE8A 1LPBB 4QQFA 4XE5A 3HCPA 5DWVA 5DJ5A 3UMSA 1TOAA 1RDFA 3AKYA 3OEEA 4WCFC 4W5QA 3NVKI 3P45A 1N33B 4YDSA 1INLA 1GQFA 3HCFA 1II8A 4GEKA 4M1KA 5JLAA 5ALWA 4BEVA 3IVAA 4ETIA 3AL3A 1IXZA 1XQXA 2OXCA 2VJMA 2XE6A 4KE6A 2QI9F 3TLMA 1YZGA 1YDGA 3KSMA 3CLHA 4E51A 3HVKA 5EWJA 1LPSA 4CUZA 1SKAA 3R7AA 4ZHQB 1E5VA 3DMFA 3EZGA 4LC9A 2Z6VA 5KOJA 2MSDB 3JZDA 4EI2A 1TYZA 4JXJA 2YY5A 1A7JA 5B2ZA 2TMDA 4IKOA 2ZYWX 4YV2A 1XCBA 1BD4A 3P9RA 1J7KA 2WM2A 2QT9A 2WU0A 3A26A 2X1LA 4TMWA 2FZGA 5SYAA 3VO1A 2EF0A 4A8JA 4CCSA 1ID8A 4KOEC 5DBFA 5IZ4A 4H1UA 1UXGA 1LH0A 4YT2A 3D59A 4UM8B 1CP3A 2JFWA 2C0PA 3NS7A 3R5FA 4EENA 3B6MA 4PBTA 1YHNA 1JRLA 4C3VA 2EQ5A 2HF7A 5EWMB 1DQRA 3IP3A 4K46A 5EZYB 2X9QA 3RJMA 3BH6A 1J7JA 3ZGLA 3WB9A 3PB3A 2V6BA 4RORA 1PVDA 4PSKA 4PPFA 2EKDA 3LQ4A 4Q7KA 1YDEA 3T5PA 3W5DA 2H1FA 2JAHA 3L1KA 4EY8A 2BHRA 3UJCA 4EBFA 3TIGA 4NF2A 3E4CA 1PZEA 3I8OA 2GASA 3VNBA 1U1GA 2DY1A 2I2WA 2VJAA 4NP6A 4RW0A 4UMDA 1CRPA 3A06A 4DXDA 2VLBA 2M1XA 3PVCA 3FSJX 3K6JA 1YR7A 5LQRA 4LXTA 1KH2A 1NL3A 3PG5A 3D0KA 1XXLA 1FP2A 2JG3A 1E69A 1GGFA 2EFEB 2DJ5A 2GEVA 3BWMA 3IQWA 4WKGA 1PDVA 1EKXA 1HL3A 1I4DD 3FLAA 4IM7A 3OZRA 5E3HA 4ZI7F 4CWAA 1ISMA 4ZAVA 2Q4OA 3IT0A 3QX3A 2IUSA 4PZEA 4XFKA 1KO4A 3CUEF 4KAXA 2BIFA 3HA2A 4GC5A 1I2CA 2H0AA 2GZSA 3GLVA 3QLUC 5BT9A 4NV0A 3BK7A 1Q22A 1UBEA 4GLBA 4OKNA 2QD2A 3GPDG 4MYTA 1ONSA 2L42A 2ZI7A 3OOSA 4KR9A 3NBKA 3IESA 4FEAA 3MELA 2OFOA 5D87A 2FJPA 1V5EA 4CLRB 4CW7A 4FNOA 4X61A 5E8RA 5IG2A 1KEUA 2VKTA 1CQIA 1H3EA 2QRJA 3O4RA 1LNQA 2X5JO 4PR0A 4KGDA 2BR5A 1YB1A 1IG0A 3HV0A 3KB8A 5KNLA 4CKEA 4J0CA 3V4FA 5EKSA 4QSHA 4A2WA 1II9A 3JQ7A 3S8YA 5KDLA 4GPTA 5HA5A 1DXQA 3E7WA 2Q3FA 3U3RA 5JATA 1U8ZA 4KV7A 4MS4B 3KWFA 1K8QA 4MR9A 4M1QA 4HMPA 1XEXA 4XM2A 4WA8A 1W93A 1TVCA 2VF2A 5ALMA 3ELWA 4E2WA 8LDHA 5LNK1 1ZINA 3TZKA 2W48A 4FNMA 4EP1A 2CNDA 5KNDH 1VHQA 4Y2JA 1FFEA 2NO0A 4WZBE 5BYKA 1GGVA 3O8RA 2B21A 2C84A 2D5IA 4TMKA 3I04A 2AN4A 2QRUA 1XV5A 3RG2A 3UCFA 2ZRPA 2IDZA 3JQFA 3N1UA 3VSAA 1EJ6A 1B7GO 4MVJH 3WGYA 4CE6A 4D9KA 1Z38A 4MRAA 3MW8A 5CH5A 3FDXA 3ZNOA 4MAMA 1PS0A 1UXHA 3EG5A 2ODBA 2PX6A 4JASB 2VDWA 1G1AA 1SXJC 3A6ZA 3VVLA 3MXOA 5IUJC 3ZVKA 1JHDA 3EGDA 5JECA 2DFNA 1PR9A 1ENOA 2RK4A 1K97A 2VDNB 3CMMA 3M6AA 5P8WA 3V33A 4BS9A 1RPNA 3D3QA 3U49A 1GNPA 1QX3A 3EXEA 1KNQA 3KZNA 2FXIA 1MN6A 1VIMA 4NWIA 3JQ8A 3PXBA 1IHUA 3EQZA 1WCV1 2IHYA 1LNSA 3GUHA 1XKTA 4AYWA 5GPBA 3TSCA 3A9RA 3O95A 1MJGA 2C9DA 5FO1A 2A0FA 3G17A 2V7GA 4RVCA 1AX9A 2BFBB 3DMPA 4AG5A 3LF2A 2WD8A 1IEWA 1ARZA 3OLXA 5EPUA 1T9GS 2QTZA 5CNJA 4ZALA 3UJPA 1BWQA 2QD3A 4M98A 1RYEA 3GDWA 3QOYA 4S1OA 2PN1A 3FPJA 1QR2A 5KYYB 4JP3A 3K32A 2UYOA 1ZSVA 3H2KA 1I24A 5HKKD 1GILA 3HNPA 3WRXA 5KNDD 2HRQA 1W76A 1QHIA 3KDSE 4N18A 3SQWA 1G2OA 3NMUF 1MAVA 2XIQA 3I5MA 1LQUA 3WHPA 1CNFA 1ODTC 3F0TA 2REQA 5M04A 5A71A 2JH8A 4MDHA 1GTZA 1KO5A 2AXNA 4MVJD 3L1VA 4ZANA 4BVKA 1VL8A 3F47A 3PNPA 4QUDA 3TX6A 4JHXA 1DE0A 4KXNA 5CBKA 2FFQA 1ZOSA 2QQEA 4OCZA 2I87A 3RBVA 1M0TA 1DBWA 4ZOLB 5DOZA 4BC0A 1EB9A 1JLRA 2GPTA 3ANNA 4UULA 3F9IA 4ZVPA 4B43A 1ZD5A 5C4MA 5K3FB 4JBNA 4CV1A 2FZCA 3IVCA 5ITZA 4RK6A 4U7JA 5JI2E 3LDHA 5J43A 4PYRA 1E3LA 1IY8A 1CDEA 1JZQA 1PD0A 1TZ2A 2HIMA 1PJLA 1SK9A 1XPJA 3PNOA 2YZGA 3RPEA 3BCUA 4EPXA 4JI5B 5FLKA 3G79A 2PGJA 4RD2A 3PE3A 1JT9A 2V7PA 3ZZ0A 2OZLB 4RIHA 4ESVA 1EA7A 2G80A 3MG9A 4MIYA 1GADO 2JGFA 5K8VA 3OFNA 2FW1A 2IHUA 1LS6A 4WA7A 5IKMA 1QVAA 2IYZA 3GJSA 3GJ5A 4TWJA 3HKBA 1YCDA 5JS8A 3GT0A 3RK1A 3WNQA 4D8YA 1C4KA 2BBOA 2EX1A 3C5CA 4Z4CA 4JBYA 3WZLA 4E09A 5KEIA 1G18A 2JS7A 4MPTA 5AVZA 1YB7A 1JDBC 4DG5A 2WVAA 1H8ED 4Y6RA 4CQLB 4XCXA 1E2FA 2HY7A 3IPAA 3AJ8A 3H84A 3RS8A 1PFQA 1RWOA 4FBLA 4GPIB 4MOWA 4OREX 1IWBB 1T4DA 1DJOA 3IAXA 2QI9C 2C83A 1OA1A 4JWTA 2DR3A 1T2NA 2OORC 4NZYA 4Y67A 4H6WA 3MJ4A 2FEOA 3FFBA 1ZR4A 2IBTA 2H2IA 2R5FA 1Q1ZA 3Q8WA 3L82B 1LVGA 3PNSA 1Y7TA 4Q3EA 4UM9D 4NFSA 4NNPA 5DXAA 5ESDA 3U44B 4KYIB 3LDAA 1AV6A 4IUCS 3V1KA 3B8HA 3S2IA 4BO1A 2CHGA 3VV3A 1RJ9A 2WUDA 4L5CA 1EK5A 3T1HB 5DM60 1K6EA 1G63A 1MP0A 1ZK1A 2WA2A 2YDXA 3KT8A 3UFBA 4C3ZA 4EJFA 2CT8A 2JLSA 3WNZA 1DFGA 1G6Q1 1ZMXA 3F5FA 3UV3A 3HKDB 2I91A 3LXMA 5TT1A 1D7OA 3P19A 3ZDAA 3ETCA 4FZJA 5EJAA 2QLFA 4KWTA 4W1RA 1VLLA 2FB9A 3DHYA 4TSFD 4PZZA 1TL7C 2IY9A 3O2QB 3QQ5A 4KKVA 4TTVA 3TLEA 1N7HA 1HG1A 3GGDA 2AC7A 2QX7A 1C4WA 4K6FA 1QB7A 4A8PA 1AHNA 1DADA 3HVIA 3SC3A 5L3QA 1J0CA 2WHPA 1UOPA 1YASA 5ESRA 5I9SA 2ZJOA 3R3YA 2HZ7A 4BNZA 1LV7A 1P0FA 3WGQA 1WUJS 3JQCA 2BKUA 1HYHA 1JZSA 2AZ4A 4FOSA 1W0KD 2P6NA 3I5UA 5DHUA 3FNRA 3Q72A 5ALXA 5IAGA 2VKQA 1JQDA 3IIEA 1KZ4A 2IT1A 3ND5A 4KO4S 4YH1A 5BRJA 5LP6F 4PX2A 5DGCA 3LKDA 1AUOA 1Z82A 1FYXA 4RFSA 4BKUA 4X62B 1V9CA 3OJEA 3RAPR 5I9LA 3VI3B 1FFYA 1Y1PA 2D3TA 3ODPA 4NTZA 3DMHA 3A37A 3CVYA 1PJQA 2DTEA 2QRKA 1U6JA 4M0DA 4QXRA 4MW9A 3DLBA 2PKRA 4R2WA 2Q28A 3KD3A 1XN4A 5L3ZA 2REBA 3W2HA 4DEVA 4CMCA 1WDKA 4UPVA 4WFJA 4XGRA 4S1TA 1WY5A 3AX6A 2CYCA 1NA5A 1N8KA 1P9LA 2WF8A 3Q11A 1E3SA 3DWIA 4B4VA 5EXTA 4BNIA 1U1IA 1FDSA 2WJWA 3D2LA 4LSMA 5LZ9A 4COOA 3B5JA 2IDMA 1E4OA 1SOVA 4XCQA 2H0RA 1HO3A 4P4SA 5E95A 4QGBA 1WBDA 4UQOA 3C6QA 1N0UA 1OX4B 4DIUA 2ZATA 4C06A 5FUXA 1KAMA 1TQ8A 2ZBPA 4HOYA 4UDXX 5T41A 4ZIRB 1O5IA 2WA1A 2DCUA 1UMCB 2BISA 2M6RA 2Z6AA 4KODA 3JD0A 1EVJA 2WNHA 3WMWA 2PKEA 3BQMB 1L5ZA 2QRZA 2LDBA 1X15A 3GMDA 3M4XA 2C5SA 3UT5B 1M3SA 1RYHA 2FMUA 4OU5A 5E2BA 5IWCA 4EY7A 5CD1A 1RS0A 2LKDA 3DAOA 1KEPA 4LJ4A 2EJTA 4M49A 1XTPA 1XDDA 4C4ZA 4PWYA 1J0AA 3BHNA 1RI2A 5BN3B 1E3IA 2JFVA 1KHHA 4IWNA 1EFVA 2ENUA 5AFSA 3TR0A 5D7NA 4J6FA 4X97A 3HFGA 4HFNA 1G1MA 2AR9A 2FWPA 2HJSA 1JIKA 1XMVA 2CVOA 1OWOA 3OZCA 3QXCA 3CKLA 3L7CA 4I8IA 4MR8B 1ZW6A 4BRSA 2W0SA 5FB3A 4M1TA 1MAWA 5AXBA 3W2FA 4O2BB 4RK4A 4ER3A 3FIJA 4FEGA 1FBTA 4JLKA 3THYB 1HYGA 5BW5A 1LK0A 3N59A 3LXUX 1YCHA 1V47A 1VIYA 4DR3B 4FLMA 1NQUA 3EOAI 5A9TA 2I4IA 3FPAA 5JAQA 4ETMA 3FGNA 1N2CB 1U7OA 2ZB3A 4D3DA 3O7WA 5B1DA 4EKDA 5BXQC 3UPTA 3FSGD 2ZI6A 1BU8A 1H66A 3FG9A 1OFVA 5JTTA 5KSOA 1TUIA 4KWHA 4XZ3A 2QYOA 5L9AA 1OTHA 4QDXA 5D2CA 3WKCA 1L5QA 2Q9CA 3HR4A 4Z2YA 1IZ9A 1M6VA 1MB0A 5JANA 2XYPA 1VDZA 3EXG1 3O38A 4FS8A 2OGUA 3C1TA 4IHKA 2GBFA 1YJXA 4P3OA 4R40A 2BE7A 2XA9A 1V7PC 3QK7A 4RQAA 4KAJA 2Z30A 5H3LA 3BIOA 4P34A 3IHLA 4EB6B 2MJLA 2AOUB 3ID6C 4Y6GB 1Z18A 1J2YA 1PRYA 2QPTA 2ZKLA 1NIJA 1PD1A 4OHMA 4PS0A 1PT8A 2BKEA 5H70A 4BHTA 5K03A 4YHHB 3HA5A 4LE0A 3R3WA 2O5VA 2IWHA 1JE1A 4HRVA 1NXXA 5CXXA 4AN0A 2YHSA 3HRHA 3ESBA 3ISJA 3MS2A 3JATB 3OCUA 5CEEA 2Z98A 5BN5B 1P7ZA 1ORRA 3TW0A 5HYVA 3CISA 3LCMA 3Q4GA 3B2QA 4A2QA 1J5XA 1K6MA 4MUEA 4WXHA 1L4GA 3IRVA 3WNVA 1EA5A 4EHJA 5EOVA 4AJ9A 1GDDA 5C52B 5EQFA 2J5BA 1GPWB 1X8XA 3JV7A 1VSUA 1R27A 4A36A 4RA9B 2Q3BA 4GI2A 1RQ2A 4DSNA 3MOGA 4MP8A 2X86A 5K8LA 5LBUA 2IIQA 3F6PA 2VPZA 3I9FA 4MUFA 5HJ2A 4BMXA 1U28C 2IYYA 2ERCA 2WUGA 3JX9A 2AVNA 1NNLA 3IJRA 2FWMX 2KYRA 1DWUA 3O75A 1P1CA 4K81B 4L5IA 4DV6B 3NNNA 3CW9A 2Q3LA 2IPAB 5JD5A 4Z4QA 4N5MA 4CTJA 4FLEA 2ZUTA 5JLJA 3P9SA 3F5DA 2R7LA 1HEYA 3C3PA 3TTXA 3JQ9C 4BKMA 3GEMA 5KYWB 2W6MA 3IP1A 4U3JA 2I2DA 2TSYB 3DTTA 3HB7A 5TEWA 4N0DA 5JMWA 5H9VA 3DOUA 2QY9A 5I7OA 2FP3A 4ZGBA 1NR5A 2FV8A 3JD1A 3E3OA 1Q91A 4J7UA 3QRWA 1F8UA 2C9OA 3LLSA 2X5NA 2P5YA 1G60A 4MQEA 3WIVA 4BJ6A 3HVRA 1HDEA 3PDIA 1ZI9A 1MH9A 3DKPA 4KEAA 2HMVA 4B4UA 2JBAB 3EH2A 1Z5VA 2GJ4A 1E3DA 3QH4A 2JJYA 1TAGA 4LPSA 1B41A 4BWGA 1KETA 3WNDA 4IJQA 3WNBA 1CR4A 1SG0A 2ZT5A 3V4LA 4KPUA 3ES9A 1K6IA 2AFIA 1E7SA 3ZE0B 1QG2A 3RSZA 3RYFB 2QL6A 1UM8A 4RABA 4X3OA 3JD2A 1AN9A 1KO8A 2XEDA 2ZRIA 3EG9A 3JCZA 3OU2A 4TPKA 3AUTA 3THOA 4BO4A 2IU4A 1QYDA 2XSZD 3O7MA 3OEHD 5FEMA 4BPBA 2VTBA 1NDQA 2FSGA 4LHSA 4TLEA 3GOQA 1O03A 2FP4A 2HX1A 4OLFA 3L0CA 3V8NA 5C53B 1C0IA 1R9GA 5B7QA 1KPIA 3KQPA 1QCYA 1UKBA 2AI3A 2UZ1B 4LJSA 1NUSA 3HDYA 1ORDA 3NRCA 1CK4A 2DG2A 2SECE 2HRBA 2OWEA 2HMUA 2XMDA 3LY7A 4XGNA 1ELOA 3DYBA 3E7XA 2XUDA 1W30A 3IEXA 2OR3A 3TK1A 5CDUA 5IH7A 1Q0HA 5CB4A 4EHLA 2RCNA 4PRZA 2HK9A 1LZLA 3UJ9A 1E6EA 3NWJA 4AD8A 1WZ2A 1VGRA 3VO9A 4RTQA 1RZRA 3OIWA 4FYHA 5BV2P 4C5CA 4LOKA 3K35A 1YZKA 1W4CA 3FWZA 3GH1A 3KLMX 3IQFA 2FF5A 1LKZA 1EDEA 1V6AA 3PYXA 3L6CA 4CGZA 3JVIA 1I3CA 2RGBA 1JL3A 3FAKA 5DX8A 3I53A 3G89A 3TZEA 3PGLA 3W04A 4C05A 4R1LA 3JWIA 1ND5A 3K70C 3NXKA 5B1EA 1V96A 4D9CA 4HT3B 4KCGA 1M2KA 2ODQA 2OHOA 4FT2A 4CVNA 1S3SA 2WU8A 2O8CB 3LL4A 5JXGA 3OX1A 2P9HA 1DOHA 3GLHA 3N7UA 3WK6A 4M8IA 3TIFA 4DDTA 3N2GB 2JVKA 3JPYA 4XYBA 5IXJA 2WKSA 3LT0A 2Y0PA 3BZBA 3EISA 5H3HA 1G21E 3RRJA 3SZUA 1XKLA 4BNDB 1QANA 1W46A 2Z2KA 4TUYB 4DT1B 1RXUA 1N2OA 1SZPA 1XXHE 4DCCA 3P4XA 2YWRA 3K9GA 3PIRA 4NV1A 1XWIA 3PNQA 3VKWA 3ZE8A 2GNOA 4W8HA 1W19A 1N8SA 3KTAB 1KEKA 4CEIB 3I61A 1BX0A 2WTXA 4O3MA 1A5ZA 1GIAA 2WJZB 4NENA 1FQKA 2P8SA 3ADOA 3MUFA 5KMGB 4AI6A 2J4CA 1SBHA 2RAPA 1NJ2A 1SHZA 2ZLBA 3BE8A 5FNZA 2MSKA 3O0TA 2BMAA 3IXMA 5IKPA 3HR8A 2QE7D 4LMAA 5KZMB 3UY4A 1JVSA 1ZIOA 3LY9A 3R9XA 3E81A 3AONB 4Z0PA 4RM3A 1VMEA 1FA9A 2Q46A 1YFKA 4JKYA 4OQYA 4C7BA 1EEXB 1G0OA 3KPWA 3F49S 4EO7A 3NTVA 1JQBA 3WGKA 4YCJA 1IEQA 5JDCC 3PQ3A 4BNJA 2DHEA 2H48A 1U3DA 4BAUA 1NF2A 2NVUB 3TXYA 2LCIA 3WNCA 4Z7NB 5KDDA 4RDIA 3TGWA 4GS5A 2FMHA 2VJQA 1JG7A 4QYTA 5SZJA 3TEMA 3IJEB 4CDNA 5JH7B 1I2ZA 1I9GA 3A1WA 1PFWA 2C1XA 2VSFA 3BJRA 3HLTA 4H35A 4HGYA 4RWZA 3D8BA 3WQSB 4DRXA 7MDHA 2NTNA 1PNTA 1YDFA 1TAQA 2TECE 3ZDEA 3BWYA 2W93A 2VPXA 4MPDA 4CM8B 3GLFB 4WLFA 3BXGA 1DC3A 2E48A 4X92A 4H27A 4IJUA 4OK5A 1RHMA 2XITA 2LXNA 4OSOA 4ISCA 1M7HA 5GONA 4CXMA 2W2MA 1T1IA 2D6FA 1CUWA 3OFVA 1VCMA 3E3MA 1IPEA 3HPQA 5ALLA 1XHLA 2OCIA 3JQAB 2XT9A 2ISQA 3J7AC 1CP2A 1ITZA 3CTMA 4Z0HO 4ZA2A 3EUFA 5DXFA 4YLGA 4A23A 4BOYA 2C0QA 1A5SB 4OJMX 3U48A 2ZU6A 3AP3A 3SVTA 4EZBA 4Q3BA 4E03A 1DO0A 5IN5A 1FX0A 2YVLA 1Q0QA 4XYLA 3OFJA 4ZFNA 1JDBB 2DSTA 3MLEA 4M7OA 3SKVA 2NN3C 3ZU2A 1E8NA 1QCDA 3PHCA 2N9UA 1T9DA 1OXXK 3QA9A 3TH5A 5L4NA 3MJDA 2G0TA 2O2HA 3DVAA 2AJLI 3QBVA 5LYJA 3UENA 2Y77A 3KM0A 1T5HX 3EVFA 1N32B 3A0RB 1YZFA 3H5WA 4QFDA 1RI3A 3JVUA 3QZUA 3B5EA 2ZRGA 2RCYA 3SFTA 3WLHA 2QZPA 5HCUA 2RH9B 5JARA 2RGUA 2YYYA 1PR1A 4N82A 3SQOA 4EPRA 1ND6A 2V7TA 1CUCA 3CPJB 5AXDA 3R3ZA 4L0MA 2IYAA 5LYYA 4ZDJA 1ZH6A 2CLHB 2J3DA 3TE6A 3WLFA 4CODB 5JSZA 3T5BA 4CFSA 1SZCA 1YO6A 4DWVA 1BXKA 1E2EA 2JC3A 1Y9AA 2ZSKA 4MKRA 5IJ9B 1DJQA 4FYYA 4EJSA 4BDTA 1YRLA 4H6PA 4WGFA 5B4TA 3A58B 1T2AA 3OKPA 5HF8A 1REQB 1TF5A 3MCZA 5H16A 3IIJA 2O1XA 5HIMA 4KR2A 1OLUA 1L8QA 1RJFA 3AP2A 1MC4A 2OC4A 3HDJA 1NF9A 4EATA 1KKUA 3LQKA 3HCCA 4I9FA 1GWNA 2GILA 2O8FA 3HR7A 1C7EA 2XWQA 5DRTA 4MYDA 2AI1A 1YVEI 3DDNA 1KBQA 3I1FA 5AW3A 4FC7A 5WRFA 4BQEA 1VDMA 2ZE7A 2H4HA 2VP0A 3C0KA 4LCJA 3AXSA 4H7DA 1WV1A 1NUHA 3AMVA 1XEWY 5MGBA 3GGPA 2WMOB 2CEAA 3UAVA 2MHCA 3EOZA 1H94A 4K9RA 1CUSA 1PJBA 2OWDA 2VYFA 2CZQA 3MYRA 1GCGA 5FQNA 1CF2O 4M9QA 4DW8A 2BUAA 4ECEA 4JX8A 5T3UA 5C4IA 1TZJA 2JRLA 3BBPA 2QTCA 4OHFA 2ZIEA 4L15A 1OLXA 2A33A 3O92A 4L51A 2BM0A 1DINA 4OFZA 4PG4A 4RHXA 4MGEA 2IVZA 1R4ZA 5CA1B 3JAMA 4C2UA 2PT5A 2Q3HA 2H08A 2PUJA 3MJTA 3PDWA 5DKFA 5ERYA 3QWHA 3DTVA 3D31A 2D13A 4KRYA 2PRYA 1M2HA 5IJXA 1E3MA 3M34A 4J2TA 5D3QA 1Q1GA 1XQYA 3H18A 2B7CA 3O94A 1BE8A 4PGHA 1U2TA 2VXCA 3B1ZA 3KCQA 1C7IA 1H9AA 4MQFB 2W2NA 5SY6A 3WYFA 4DJEC 4OEHA 2WHQA 3AM3A 2GFQA 1D0SA 1EG7A 1JA0A 1MO4A 1BQ3A 2J6BA 2VPPA 3HP7A 3L9XA 3NNDA 4MMZB 3P71T 4P9NA 4E13A 3B51X 3HQ4O 3RYTC 2BGLA 5A9SB 4WQMA 5E0OA 1SULA 4EOGA 5EE9A 1HLDA 3CO0S 4TMFA 1C30A 1VP3A 4ND4A 1YRWA 1I0LA 1L8OA 1NVUQ 3MJFA 4RAQA 1JWLA 4KBGA 4KFTA 2FRVA 1S9HA 3P94A 4Q03A 4MKXA 1PNOA 4U6SA 2I4RA 4DCSA 3WDLA 1HKHA 4RF4A 2BFOA 3FOAA 5CW2A 1RP7A 3OCCA 3QU2A 5TC4A 4UNPA 2I8CA 5B2EA 1YR2A 2BW0A 1QH0A 2ZAYA 4H3HB 2PLWA 4RF3A 1Y89A 1KEVA 3R9IA 4ER0A 1YB6A 1AHIA 3IX7A 4D45A 4RYDA 5KX5F 1R16A 1YV9A 3BK2A 4AJ1A 1CUFA 2QQFA 3B3GA 3NIBA 1BW9B 1QO7A 5IYZF 3RH0A 4IFIA 3B1JA 5LIRA 2GZ2A 3H4MA 2GTHA 2V4UA 4RK7A 5KU1A 2ZB8A 3FMFA 3H9QA 1HFEL 1G21B 2XY4A 4TROA 4WK6A 1TTPB 4W1PA 3VKVA 1UEIA 4MLPA 4C0SA 3WKDA 1SOUA 4D98A 2YJGA 4M9ZA 1XXHB 3BJEA 3NG1A 4IL5A 3H3JA 1KDVA 2PBLA 1S89A 3R7BA 3UUWA 1KPGA 1OXMA 1ZVQA 2DUJA 3K5HA 5LP1A 4FWTA 5KTPA 5FNVF 1C4XA 3PX7A 3OSUA 5F5XA 1Z74A 3I04M 3HEMA 1HLFA 3CO5A 3ZY6A 6CHYA 3KYJB 2OXFA 3OA2A 3RTEA 3RFVA 5AVQA 5GM1A 1W59A 2NV0A 4NI5A 1QNFA 2CUNA 1XZEA 4K6KA 2Q5EA 1U1FA 3BE4A 3PITA 1V1MB 5ULLA 4K8OA 3RAJA 1ULUA 5LD2C 4YNBA 3N3BC 1HRDA 1NYTA 2O2CA 1ZGCA 4OK3A 4PYLA 1V2HE 1RPAA 1WOYA 1ZFNA 3F67A 1AS2A 2H8KA 4MB6A 4MYHA 3QSGA 3SX4A 4B35A 4DR1B 3DOIA 5DO9A 1SEPA 1Y8RA 2BFEB 1IXSB 4JA2A 4XPIB 2BBSA 4ZT3A 3U37A 4BWVA 1QJ4A 3DNFA 2XLBA 4E21A 2H4XA 3HFRA 2VJOA 4Y6LA 2OLEA 2CXOA 4BECA 4MICA 1ZGHA 4QWWA 5L3VA 3UT0A 1FFXB 3MQFA 2HRRA 1MJGM 2YXPX 1VG9B 3D7RA 5IU6A 2BDTA 4HB3A 2LV8A 4OUDB 5DSXA 4OBWA 3ODGA 1GNVA 5F7ZA 2OGTA 4RZXA 2ZUBA 5K0EA 2OHFA 4FFBA 3QY0A 3RF7A 3SBOA 4AJJA 4RIFA 4WINA 4B87A 1HLPA 2NW6A 3JYQA 4AJEA 4JL8A 3YASA 1ZJWA 2Z1DA 2OSBA 4AMBA 4F38A 5FUYA 3G82C 3NJ4A 2PANA 3LECA 5LXTA 5F5NA 5JYBA 3BTSA 4CQNA 3DOCA 3MM4A 2HKIA 4ALIA 3S8EA 1EM6A 2HHLA 3BRSA 3PC3A 2OBYA 2HC9A 1M2JA 4ND8B 4R3WA 3HN6A 2JKZA 4I08A 2O8DA 1OYWA 3I2YX 5KQPA 4OI4A 5EVJA 4Z3DA 4KI7A 3I39X 1BOOA 2F9LA 1RNLA 4I1IA 4HZUB 4J7XA 4CFZA 1JFLA 4V03A 4LGYA 3C3WA 4RCVA 1HGXA 2O9JA 4ESOA 2XVAA 1WB6A 3L0OA 3QJGA 4S1VA 2R1UA 4XARA 3PHLA 1T4BA 4QDZA 3WGTA 3ENQA 1JTFA 1Q7GA 1YULA 3H5TA 5JNRA 1KJQA 3QE0A 5FP0A 1H6CA 3E7DA 4MA4A 1IB0A 1K75A 4NAUA 1SELA 1QTNA 4H7EA 1WKCA 2V45A 4RS4A 5JAPA 1EK2A 5ISMA 1NJ5A 3ZHRA 1ZGBA 8ATCA 3NGXA 4FK8A 4ZDWA 1QP7A 5KKNB 2JJ1D 4JT8A 5BORA 4W99A 3H9GA 1N6OA 1AGNA 1QX4A 2J9RA 1JB9A 2NVBA 2IPMA 2MTBA 1VCHA 2H1WA 1E9SA 3D6MA 3NVMB 5JXJA 2CNLA 4O4JA 5B7GA 1UC4B 4KQGA 1FJGB 3SEQA 1EVKA 1J0DA 1RPJA 1WLSA 1YOVB 5AI0A 2AMYA 2I67A 4YQFA 5BSVA 3U60B 3NC0C 4JJFA 5CXSA 3W2IA 4HDMB 5DTMA 4TWZA 1XN1A 1MIOA 3VKHA 1UFKA 3PRJA 3GT4A 3KB6A 4GMHA 3HADA 3T95A 5HKBA 5J2UA 5LA6A 1V5FA 3O0DA 2AEJA 2C3OA 4UCWA 4PX9A 1MIHA 2PVPA 2DFPA 4MARA 1E7RA 1PL8A 1LSSA 1UBLS 2WJAA 1VPEA 2XB6A 4E5VA 2QRGA 2QVLA 4EMBA 2QU8A 4FKBA 4GI7A 4M7PA 2ZBVA 3REQA 3J81k 5I9NA 1VLVA 4MWOA 4WBNB 3OICA 4HATA 4WEQA 1I33A 4PYJA 1VPWA 5C5DA 3QXJA 1YKGA 4TS3A 5E8JA 4Y2YA 3VVCA 2AWNA 5LZ2A 5IARA 4BMCA 4O2RA 2Z56A 4L4UA 4HDSA 1KF0A 2WF5A 1DKQA 3FWYA 7GPBA 1UAAA 3DZGA 3ENWA 1QF9A 3MMZA 3R3UA 5CJJA 4N76A 2Z04A 1WTCA 1BNCA 2EEZA 4Z7QB 2DHQA 3I05A 1FFCA 2XJ4A 3MD0A 2HLDD 2XBMA 1DRUA 2QVXX 5LU8A 4Z1MD 2C1ZA 5HKKA 4H4CA 3G6WA 1AK9A 1G5QA 3B85A 4NQZA 1NVAA 4PGGA 5L3RA 3LK7A 4JVLA 4UE3S 2RGXA 5KNDA 4J90A 1V35A 4IIJA 4CL3A 2OCYC 1JSLA 5FA8A 2HBYA 3JAWB 3LP6A 1VJTA 4X71A 5EZSA 1GRCA 1TPZA 4MVJA 4UUNA 3DDCA 5KSPA 3IUMA 3K70B 1M6EX 1JWBB 2XHEA 3GIWA 2FG6C 2Q5QA 3ZX4A 1R6XA 3PVSA 5JSUA 1DHTA 1MENA 3R1IA 4AMUA 2I03A 3BUSA 4K2HA 4XSVA 1XQ1A 4Y0AA 2CHFA 1EM8A 5BNTA 4RJKA 3T4PA 1UH5A 3IRUA 1P4JA 1YI0A 4DCGA 3VDNB 5FRDA 5BT8A 1I3KA 1DIBA 1UXIA 4YRDA 5BNIA 1YDHA 2VOEA 3LA8A 4RD0A 4R8LA 4YQZA 3AHJA 1RWXA 3GEHA 1GQ2A 1ZSYA 4ID3A 3TW4A 1PFKA 5DYWA 3U9LA 2Q1UA 1UWKA 2ZSIA 1YDMA 1NP3A 3L1HA 3N75A 4B3CA 4YJGB 2JLUA 3HJFA 4CM1A 3QEMB 5J2TF 3DE3X 1MO3A 2APJA 4FMDB 4N5IX 4DIOA 5BUCA 1F6BA 6GPBA 1DBSA 4BQOA 2WSYB 2WZQA 1Q6ZA 3H99A 3DUFB 3ZHOA 3LZDA 3ZD7A 4ERXA 4I4CA 2J32A 3E3NA 5EA2A 2OV3A 3PDJA 2P9ZA 1C50A 2CW5A 2Q3JA 2R8EA 1IC6A 2WG1A 3F4LA 3FMOB 3SEZA 5L95A 1OHHD 4B8WA 1SU6A 1ZGJA 2JAWA 5EKUA 3VOAA 1C1DB 1X92A 4TTJA 3RG8A 1G3UA 4K2AA 3ICPA 2FGJA 4PGMA 2IL1A 1XZ8A 1PVOA 5TB5A 1Z6XA 1H8EA 2GEBA 4NYJR 2IOQA 3AYZB 2B5OA 4JODA 4RD1A 3TVTA 2R5WA 5C80A 1Z6ZA 1YF3A 1DC8A 3N3AC 4QDOA 3UK2A 2ZZNA 1QBGA 4JLMA 1IU9A 5BW4A 4D9MA 3QUAA 2EBUA 1PWEA 4IO0A 3ICCA 1ULZA 4D4MA 3KQTA 5F9HA 5IVDA 4DJFC 5JWRA 2WE8A 2HFJA 3RRNA 1PJSA 1ZUWA 2XWBF 2LTAA 1DQNA 2CB0A 3PR3A 4R7GA 1Q12A 1ZD3A 1VA5A 2VNKA 2P9GA 1OX5A 2PK3A 4WRRA 1E2HA 4KZKA 1S01A 5HG0A 1HL7A 3DC7A 3WJAA 4FDLA 4NSNA 5B37A 3EZXA 3QHQA 1Q7BA 1WO8A 4QPNA 5ES3A 3PHIA 2Q3DA 4D97A 1ZVJA 1UDWA 1XNHA 1OBFO 2JIZD 5LBIA 4UVEA 1FFBA 1XJWA 4TV8A 3NGLA 1V4VA 2QA5A 4RXMA 4WNYA 1BN6A 4OXYA 5JDIC 4YB8A 4GPBA 4JI1B 4A2PA 1CVIA 1IWOA 2ZVPX 3NT2A 4HNRA 4TSFA 2G3YA 4UU8A 5E9WA 5LA6F 1AHPA 3MOSA 4HWOA 3IPRA 2IKQA 1QMPA 1F2UB 5KQGA 1FW6A 1DAPA 4HAZA 3NYIA 2UUOA 2VXOA 4MLZA 3NHLA 4FFOA 3COSA 1SCBA 1GNLA 5FOVA 1L0BA 1XCLA 4C14A 1H0SA 4YAUA 4N7JA 3SHOA 1Z3IX 1T8YA 1OB5A 3OP4A 1W0KA 2P11A 2MYNA 2C20A 3W5SA 4F46A 1EESA 1GZHB 2UYHA 3EYWA 3FYTA 4HDKA 4KE8A 3ZVNA 4FHFA 5CM8B 1Q74A 3N2NA 4V3CA 5BSEA 1X7YB 1NW9B 4R1NA 2GDZA 4LYFA 3TGLA 2AJBA 2B7LA 3EWAA 4I50F 1ATIA 2WHYA 2CNKA 1A5BB 5E9QA 4FSDA 3SDZA 3NUGA 1G2QA 4LXUA 4O29A 4BU1A 5H4GA 3HJRA 2QG9A 1GT91 3MILA 4RD4A 4Q9IA 1P17A 3N05A 1Y1KE 4IH4A 4BLSA 2PG3A 2XQFA 2DC1A 3KZXA 4CF4A 2Q5HA 4TTAA 2J0EA 4P1ZA 1MV5A 2NLOA 1TGYA 2PKXA 2LUOA 2O3UA 4I46A 3NHPA 3OKAA 4C3OB 5EMJA 3KPYA 2O7NA 3L7AA 7AT1A 4MUKA 3EY4A 3BD8A 2OV2A 1MXFA 4JYPA 1QORA 3DLCA 3HY3A 4RZ2A 4C0HA 3G88A 5G1OA 2J59A 3MNFA 2ONCA 3LW8A 2BDUA 2BEVA 1GPAA 1XLTA 1VZ3A 1BCSA 3C3CA 3LX8A 3EIUA 4JMLA 3L7NA 2VR1A 4WD3A 4AYXA 1GAQA 4DDKA 1VYUA 5C1BA 4LRXA 4WUTA 3E18A 4P3KA 3NAQA 2FHSA 3O84A 4ER5A 1Z63A 3K30A 2E5FA 4OK6A 2FQ1A 3SXPA 5AM4A 2G4CA 2X0EA 3OQ1A 4BX8A 5A5EA 1TXGA 2QGZA 1ISIA 1Q7EA 4XWWA 2FDCA 3GARA 5IRCD 1M73E 3EGXA 4UU1A 5ADWA 1GGHA 3RJZA 3KVRA 5J1SB 3FTPA 3W5HA 2ZQ5A 3KUCA 1CWUA 2QW8A 2XZTA 4LI3X 3K4HA 1OZFA 2JEOA 2CV0A 4G8BA 4NYIR 3TTSA 3T3IA 3DCJA 4TKMA 1NQVA 5FL7D 3K8YA 3QKRA 2GEJA 2J6IA 1VC2A 5DK4A 4IDCA 3LT2A 3RSHA 2VWPA 1XLVA 4XGIA 1II8B 2Z0MA 4WUVA 1RU3A 2WTAA 5DV9A 2CLIB 5JSHA 2VJMB 4Z4FA 3UWDA 1YTUA 1EAMA 2I3BA 2KLBA 1MVNA 1PK7A 2YV5A 4I8DA 1WXFA 5EWJB 3RIHA 4BLWA 4CMKA 3FSGA 4D96A 5HNKA 1NVFA 4GZ5A 4K9MA 4LQ4A 4DCNA 2B8WA 4P84A 4PPQA 4E5PA 5KOJB 2F62A 3VO2A 4HDCA 3W5AA 1LI7A 5FPQA 4EGSA 4KUGA 2CLDX 1DUSA 1FDTA 3ZWXA 1VZ2A 4MAFA 4LV6A 1BIFA 4EEXA 3FTDA 5DNCA 4IQ0A 3CLSC 1R0LA 3QVXA 4RHCA 4D9GA 3FHOA 4CQMD 2QRQA 4P33A 2GOYA 3UIEA 4LOIA 3RV4A 1KI7A 1LUAA 2IV7A 4B2IA 2JZNA 1XTSA 4C7JA 2D1SA 1WUHS 2FWJA 5K3CA 2AEEA 4OQEA 5KTNA 5FDFA 2V55B 4DIBA 5A1TA 4ENPA 1N0VC 4G56A 2R4UA 1NJ1A 2FZ5A 2MOKA 2R751 3K0BA 4OHVA 2BAGA 2DVMA 1DQPA 3UJAA 1FDOA 1F51E 1QIHA 1SN7A 4B33A 1RI1A 3M6MD 3LWDA 3QVOA 4JBLA 2PGOA 3K6KA 1SQSA 2V97A 2PSEA 3CE9A 3GV0A 3E9NA 3COZA 3H16A 3K92A 4K0KB 4GHWA 1I5EA 3KZKA 1KR2A 2VDKB 2B35A 1ZKDA 1BS1A 4DREA 4GOJA 5EXPA 1I14A 1EGQA 1Q2UA 4TXLA 1Y48E 2FSVA 1X77A 4JXZA 3KALA 5L51A 1ABFA 4UHKA 3F1KA 3NT4A 4TWIA 3CZRA 1VJ0A 2VP5A 4FN5A 3MCWA 4FJ0A 5B2FA 4IHJA 3A6GA 2QN1A 1A2BA 3NHBA 1ULHA 4GF5A 2VTDA 5FOXA 3QXXA 2V7XA 2G1AA 2A9QA 3V8EA 2I3GA 2UUPA 1C3OA 1NZDA 4UTZA 4D6YA 4FFVA 2J87A 3U6KA 3LU1A 3TTTA 2V4MA 4KW7A 4ZU3A 2I66A 2O4UX 2ZYSA 3PRHA 1YZQA 1MA0A 1WMDA 1CEQA 2Q2NA 3L8MA 5TMPA 4OTZA 1BH6A 3G59A 4L8FA 3FI0A 3BE6A 5L45A 3DO8A 3KHKA 1JTVA 1M2VA 3Q3EA 4G0WA 2WRZA 1MC5A 1FRZA 1MG5A 3R0QA 2QTRA 4QUGA 4XW2A 3W7VA 1IZYA 3C45A 5AJWA 1CD5A 5BR4A 1CQIB 1WVIA 4GQAA 5FUMA 4IIYA 5A06A 1KO7A 3HU1A 5DM0A 1NPTO 1Q20A 3AR9A 2IITA 3QWIA 1Z45A 3TNJA 1G2IA 2J3JA 3B6KA 1RHRA 3HZOA 3NEPX 4IJ6A 1S96A 3I64A 4LY3A 4CKEB 1B93A 4F86A 1VHJA 3JQ7B 2VYQA 2WIAA 3AFHA 3Q12A 4MGZR 2Y2UA 1PR4A 3HSYA 1PSZA 1E0JA 1PG2A 4HTAA 4PHFA 5LJIA 16PKA 4NXNB 2J3MA 2E1RA 3WE7A 4JKOA 5JG7A 1EK1A 3C8ZA 4PC3A 4YIHA 3F98A 2Q7OE 1YK1A 3C41J 2D8MA 2XUOA 4QGHA 2I55A 2QROA 2VTKA 1CJKC 2JLBA 4FC6A 4MR9B 4B3FX 1XEXB 1GLVA 2WYVA 1CZLA 3GLTA 2Z3VA 3IBSA 8AT1A 2HWWA 1GAWA 2XSZA 3OEHA 5BMVA 2EW8A 2MINA 4FHCA 5FQOA 2C07A 1P45A 4D3FA 4UTNA 3DXXA 3UWKA 2ZIXA 3ANMA 1T1RA 3GA7A 4N0EA 4N5LA 4Q5IA 1DQYA 2PGXA 2BUCA 2YHBA 4G0PA 3ONDA 1BGVA 2WP0A 4QE3A 2OCGA 3VU9A 2R7AA 4G65A 4LOAA 3PC8C 1T36A 2DKNA 1W48A 2BM1A 3CX6A 2KBEA 5F4BA 3SIXA 2IEIA 4YYZA 3OMXA 3QOWA 5C46F 4PZDA 2VDWB 4E88A 2G0AA 1Z39A 3M1YA 5AMXA 2VUIB 3K0CA 4J76A 3CF4G 2W4IA 3INYA 3TUZC 2NP6A 4XDHA 1OBVA 2XUKA 2ZUCA 3PJRA 3KJGA 3T7IA 5K8UA 3NDPA 4LF4B 2JIOA 3K2IA 4KIJA 3OF5A 4HQOA 1CX9B 2B98A 3JQ8B 2ZJ7A 4LJ7A 5KTSA 5JJCA 5AKYA 2VXYA 3PWTA 2HK8A 2H4FA 1GTL1 3GJ3A 2DWQA 4OJYA 1KP2A 3D3KA 1FFAA 5BR8B 1HKUA 1T35A 3QMMA 3X1YA 1YZVA 1AA6A 1VHLA 4M0FA 4JR2A 1N9GB 4KPGA 3S2EA 5AUNB 2P9EA 4XUGB 1T0IA 3AUXA 4IRXA 5DVZA 5F21A 4JYCA 2F3QA 2W71A 3OT1A 2HK6A 2G1PA 1FDUA 2CFIA 3BRCA 3E5RA 1CQPA 3HCBA 3TTYA 4UNRA 4QJBA 3JWPA 1B8VA 3I73A 1NVXQ 1IUOA 3OETA 1U0GA 3G02A 1UDAA 4MRRA 4Z0TA 5AXCA 1KDZA 3KELA 2Y9PB 2YRXA 4KQJA 2J0SA 1P4GA 4NG5A 5KTRA 3BIWA 1XRMA 3HO1A 1Y7IA 4LZLA 2VYCA 4QUEA 4XUCA 2YOGA 3ZZ1A 1I6WA 3ONWA 1O94D 1TJNA 1Z9BA 3Q9NA 4UMEA 2YWDA 2WSLA 3RLFA 2WHRA 4Z8XA 2CZCA 2JNWA 3SZ3A 3WICA 4IWYA 1P9NA 3R2JA 2PKCA 3QLJA 4HPXB 1GQQA 1NF3A 5A0FA 4YRKA 1JIIA 2CLKB 1F17A 4BN4A 1Z28A 2FJ0A 2JF0A 4QGFA 4F93B 3ACBA 2QE7A 4FW8A 1B0ZA 2YQ5A 2JGEA 4JU8A 5ITZB 1CIJA 5EZ6B 1CY2A 1Q21A 1DC5A 1IM5A 1QUFA 1ZI6A 1WUIS 4CI0B 4X9XA 2VHEA 3BFKA 2HGZA 4OSPA 2Z8YA 4N47A 3ROEA 2IU6A 1J39A 3I45A 1QK4A 2QY6A 2ZR9A 2MR5A 2P3QA 4LYGA 3PFFA 4JEMA 4I3HA 1SQ6A 3MWEA 2IYLD 5AVOA 3A6PC 1GEGA 1MLDA 2NU8A 4L95C 4KWEA 2TRSB 2L69A 2J08A 1FLVA 4H7HA 4BVJA 3DVSX 4YAKA 3EDCA 4R05A 2HXYA 5EUMA 3PV0A 4KPFC 1D2AA 4HSEA 4NU0A 2X6TA 4A0RA 4NS4A 4E1AA 2ZBDA 1TC1A 3HKBB 4YJ3A 1ETHA 4D02A 4DA7A 4NE9A 3G2OA 6Q21A 2G76A 2YJTD 4NDZA 1F14A 4KWIA 1FS6A 4MI1A 5IBPA 4LKRA 4TXJA 2C7QA 4XWAA 2JGRA 3NWOA 3OIFA 4F6CA 4LCBA 4ZZ0A 3L79A 3WJ2A 1YJ8A 4R2XA 2W4MA 4ND6A 4V0SA 5A5VA 3TRIA 4I4NA 2W6ZA 3B9BA 3X1ZA 2V5AA 4KN5A 2AV6A 4GL2A 1PL6A 2EATA 1PV1A 1T0HB 1UQTA 3BMOA 4NJOA 3RKRA 2K87A 3F3YA 1FPQA 3QV2A 5CCBA 2O07A 4R0NA 2RAFA 5AJYA 1KQNA 2IZ6A 3N9IA 1IE3A 1FJHA 2G6TA 3PFIA 2RBGA 1P18A 1NX9A 2PTGA 3FX2A 3G1UA 4ND1A 4K9KA 4DHWA 1M5TA 1N1GA 3HVHA 5LVAA 1QTRA 2W6NA 3E58A 3UN1A 2GLUA 3BVPA 4CU2A 1SHKA 2QWXA 5ESXA 4PC1A 2FR0A 3TO5A 5C1DA 2X3UA 2AF3C 7MHTA 1RJ9B 1LCIA 4LXGA 3R0VA 2XX3A 2YYSA 3AR8A 1EIWA 2CZGA 4F2WA 1L4EA 5IHPA 4DMFA 1ECJA 2DUUA 3UJNA 5FOSA 4JZYA 3BMCA 1UZUA 4AN4A 3R5SA 3SQXA 2PJZA 3FSRA 4I4TF 1KTVA 1NBAA 2Q1YA 2UU9B 2P5SA 4F7WA 3ZJ5A 1ZUD1 3PLNA 3U80A 4B8ZA 5AIBA 4DJTA 1YTLA 3AUKA 4MROA 4RLSA 1QCCA 3DM9B 4OA8A 5L3QB 1MCZA 2WHPB 3CSUA 3NOOA 3Q5EA 5TQ0A 1JQKA 2C2WA 3B82A 4UFOA 1N6IA 5A4JA 1WUYA 2RH5A 2V7UA 4IMPA 5KSYA 2B4QA 2OG2A 2P2CA 3PQ6A 5H4HA 4YLYA 3WOHA 2B6NA 3CEHA 3L4BA 2XOEA 2RC6A 3DHWC 2CCGA 4Z99A 1LTHR 4MQ4A 1ZU5A 2ZIWB 1BXRA 2IIPA 5CLLA 1JHYA 3JD4A 1RRGA 4CQJA 3M6LA 4A6PA 3JZFA 3PD0A 3GGGA 3VC7A 2ZSAA 1Z62A 2O0HA 2B25A 3VNRA 1MOZA 2J0VA 1EX1A 2XB9A 2ZR7A 3ZWAA 4GQBA 4NCXA 2J5XA 3LKVA 1EK0A 1T3LA 1GNSA 4J43A 3UMBA 5F51A 4WH0A 3EMBA 4ZCQA 4D9BA 3V1YA 2NSDA 1LX6A 4LF7B 1FTNA 1YA4A 4OHZA 4CM3A 4RE6A 5LDGA 3V1NA 4C7OA 3K5PA 5FTJA 3KV1A 1M83A 4HBZA 1JEYB 2DR2A 3ASUA 3IAEA 3WLLA 3I2KA 1ZBDA 4K6CA 2VCEA 4B83A 1JBQA 2PCLA 3AOGA 4P4SB 2O3QA 2OC9A 3NBXX 4TXMA 3PF9A 5CVJA 5LZ7A 1Z5WA 1E3EA 1OTYA 2QW1A 4N41A 4US0R 3CF6R 3PJGA 4D8TA 2E37A 2ZGVA 3OCZA 5MFZA 5DNEA 2ZT8A 4W5NA 2BGIA 1Z2EA 3AVPA 4GXTA 4IIHA 4F7DA 3WG9A 1Y33E 2O54A 4O2AF 2W98A 4CCYA 4ZC1A 121PA 1H2FA 1XEWX 2GRJA 2QMOA 2VDMB 1E4EA 2PGIA 4L4RA 1CJUC 3DO5A 3ZQUA 2QN2A 4ZYUA 2AXPA 1YOBA 3SYMA 2H1HA 2I7TA 3GEEA 1AMUA 4NZZA 4C0BA 1BVHA 4EWLA 3HSSA 4ZJZA 1ZD4A 3O83A 3MT9A 3RJ9A 2HA7A 3CQ9A 4Y18A 4J0EA 5MHTA 1UEXC 4BEWA 2RGNA 3K1ZA 4HVCA 1EFVB 4TRMA 3EUEA 5EIHA 1I7PA 1XU7A 2ADOA 4OF4A 1E2PA 3OU7A 1TPYA 4TL6A 1ZSNA 4YMLA 3HXKA 4EFKA 1T8PA 2YZ7A 3DPUA 2QX6A 2FN9A 4QEKA 1ZLYA 4IHAA 4D0RA 5HZGA 4B3GA 1ODCA 1ATZA 4GE0A 2QX9A 2QKYA 2EKZA 2WUVA 4AICA 4ZODA 4RJIA 5K3EA 1ZHFA 2PS1A 3B1KA 1JN0A 1ZL0A 1SC9A 1TVKA 4J4HA 4F3CA 1I3MA 2ETXA 4GRIA 4Q4AA 3QU4A 1U02A 1JFFA 1Y1TA 2Y3IA 1GTMA 3HXTA 4OH1A 4OUKX 2Y1FA 2IH4A 1V48A 4MUYA 1I4OA 2UVPA 3M70A 5B3AA 3ZKWB 1WKBA 2DH5A 3TIXB 1JDPA 3RHZA 5BNZA 4YRCA 1YQQA 5DHRA 1PJTA 4AJ2A 4O25A 2XBUA 4JUBA 2VYVD 2GFIA 2WZDA 3DL0A 1P7VA 4M46A 4MUMA 4P58A 4Q37A 4R0VA 5FO0A 4BL5A 4J9VA 2Q3MA 3I23A 1M6VB 4MKZA 5E3IA 5IK2D 5E38A 2FRDA 1ECCA 1PGQA 1FFGA 1TW2A 4YAJA 5TPZD 5CDSA 5FI3A 3HO8A 2ZUEA 5FV7A 1QGDA 1RZVA 1P2TA 4OI1A 3PPWA 1FB5A 2IEYA 2Q2QA 1CUVA 3H87A 4WESA 5EMLA 1M2EA 1NJFA 3GP3A 2A59A 1OH8A 1F7VA 3M6XA 5U1PA 5CURA 1RXEA 1FZTA 2OOSA 4GI5A 3DE2X 1OVGA 1YGYA 4OV6B 3V8PA 3PTZA 1VM6A 4MV3A 5EUQB 1Z8FA 4EEZA 3BN3A 1A82A 3F6BX 3KWJA 2YMPA 1RLMA 4KAFA 4JGBA 4DANA 4G2TA 4URYR 4DAOA 3EVGA 3KJQA 4HBGA 1M1YE 2Q41A 2YWJA 3SE0A 1QG4A 2Q8PA 5CR9A 3TRFA 1VBMA 4QPCA 1AZLA 5D1NA 4MCJA 4MHOA 3N2EA 3Q3GE 3QVWA 5AHXA 4YV1A 1TZCA 2O2ZA 2R65A 4QBTA 2WNIA 4GVLA 4FEYA 3INNA 1FSSA 4E14A 2H07A 4HWSA 4B9AA 2BSAA 1DJMA 3GG2A 4F2PA 3QYJA 4G41A 3ZDBA 1ZOIA 2EP8A 4R3UC 3DV2A 5IAEA 3QEAZ 3UC9A 1UJMA 2FWRA 4JS0A 3U4HA 1O54A 3ZI0A 2YZMA 3W2EA 3SYRA 5CHYA 2PRSA 3TNDA 1WPXA 2JZCA 5L7YA 3DR3A 3FUCA 4BNNA 1O6CA 2V9CA 2WFZA 3BRWD 4HXGA 5BR7A 2YHAA 4NBLA 4U3JB 1HPLA 1HNWB 1AXRA 5ENZA 3LPAA 3NKFA 1AKEA 4N40A 1V3QE 4Q3AA 3B1VA 2P91A 3A27A 5DBGA 5ILGA 4IVNA 3L7DA 4GLFA 3S2ZA 3BE5A 2YXEA 2FFAA 3UV7A 4X1YA 2EBHX 3PDIB 2DEUA 4RD3A 2W8ZA 1HLGA 1G5TA 4AX8A 5JHGB 4EX7A 1L4BA 2O7QA 4CKBB 1UUFA 3OVMA 4JC5A 4FP9A 3V8RA 4MPRA 4H2DA 3PHGA 4ZO6A 3UMCA 4DMKA 5C8XA 1HFKA 4KPUB 1ZD1A 2JJ1A 2RJ3A 4U5XA 1Z83A 2AFIB 1A71A 1CQJA 2Q6VA 4YRQA 3RUCA 4AKEA 5ITVA 4Q1DA 5AJVB 1C3XA 1FXSA 1WMAA 3EG9B 3HO6A 3NUQA 2CFRA 3FRIA 4Y6PA 4A3SA 4MIEA 3QI2A 4MEJA 4YC7A 2VTBB 3JQRA 4PZ0A 2ON6A 1BWSA 1MAAA 1VLMA 4GPD1 3PT9A 1WW2A 1IATA 1WMEA 3BDVA 4JITA 4PNZA 2PZKA 4ZCPA 5JXHA 3K9FC 1NMZA 3HY4A 3QXGA 3IQEA 2NZ8A 3OZ7A 2ZBFA 1U90A 1Q0RA 3ECAA 4UHCA 1SVOA 3ZXYA 3DDUA 3AR2A 5D3MB 1T9BA 2FEMA 4YRLA 1R9NA 3NC1C 2WT8A 5CB4B 2JFFA 1N1EA 3AKEA 1Q11A 3DEZA 3CXUA 2YWBA 3BKXA 1U0FA 1U2GA 1DKUA 1G8GA 3D8SA 1DKMA 3PKZA 3C3DA 5JASA 5CDHA 4LDZA 1IOWA 4KR6A 4O1HA 2BGUA 3OKCA 2DPMA 3W6ZA 4PC6A 4US2R 1OVMA 4ZVLA 3SMQA 1P0IA 3EAGA 3J81A 1BCRA 1C7FA 2VF5X 3EQ6A 1Y1SA 4ANFA 3G2KA 3NT5A 5FTNA 3GLQA 1QF7A 3BGWA 1CIPA 3VYSB 4LFBB 3W5BA 4BIIA 4UAGA 3WDSA 1OD6A 2RHGB 4Z1MA 3D6AA 1P1IA 2D74A 1FVHA 1KMHA 2QN8A 4WLEA 3TCKA 2PY6A 3GLHB 5A3SA 3VPSA 4K9QA 1YU9A 1HETA 4K9LA 4X24A 3MFQA 1SZJG 1PCXA 2PS0A 3A05A 2GN8A 1NMYA 5U9CA 3SFZA 1GGEA 5B1SA 2R68A 2A84A 3R3SA 1JSRA 2O0MA 5ECWA 1CJSA 3ABOB 2PKQP 4UDYX 1ZOPA 1DPGA 4WW0A 2IS6A 1TMYA 4M2LA 1V7QA 1JALA 3SAJA 3P4UA 2ZBQA 2VHXA 1KJIA 4WXYB 3WBFA 4EYEA 2G5TA 3CONA 1JNYA 4ON9A 3IBCA 3REOA 4LW8A 1BA3A 3WYDA 3PICA 3PKJA 4NENB 2OMKA 2X2EA 3ZHYA 4Y0NA 3U0VA 4B46A 1N0HA 3CNBA 2R3SA 4G5SA 4K6OA 2XA1A 1ZCZA 1UFVA 1DTSA 2QTVA 5EXEA 5SZIA 3R9XB 3RWOA 3CRQA 2RI6A 1XJQA 3M4YA 1Z08A 2MR6A 4DBVO 5D6NA 3JPWA 5ALIA 2O3SA 2FMTA 3M81A 3FRHA 2Y0EA 4DXAA 4CT0A 5HOEA 3O9ZA 3KX2A 1PU2A 4YT4A 5I7HA 1AS3A 2YFYA 3GEPA 2WTBA 2NVOA 5JYCA 2VTEA 3ZXIA 3CFYA 1OHHA 3GJ6A 3AVUA 4R01A 3U2QA 2A0YA 1F0KA 1OFUA 3BF7A 1XF1A 2Y1GA 5AJUA 5F3DA 3WLEA 1S8FA 1V7CA 1L8XA 3MJEA 4RH3A 2P1ZA 3OA0A 3PIDA 2OAP1 3L9WA 3PUWA 2HMWA 2DTDA 2D5BA 1U11A 1Y6JA 3R40A 2V6IA 1SPXA 4DRXB 1HORA 2YOHA 1IN4A 5LQNA 5HS4A 2YVAA 1BHQ1 3G9ZA 4UDNA 4F91B 4GNKA 1HBJA 3ZPXA 1JEDA 4LTMA 3ELBA 4AY2A 1KAOA 2XZOA 4KMSA 5HFNA 3IC5A 3LRPA 1RKQA 5GONB 3CVOA 3M0EA 1TZBA 5JQGF 5AUOB 5DSTA 1E2BA 3DPSA 3MGCA 1ZITA 1N1DA 1H23A 4AJLA 5K7SA 5K8IA 1A9SA 4QYXA 2O20A 3C48A 4A8TA 1RHJA 2JIZA 1NBHA 1FX0B 2QXYA 5J5VA 3TLBA 3WL5A 4BX9A 3THWA 2ISSD 3PUZA 1PYDA 3DBIA