5B3MO

A mutant of ospa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKVLGDVKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title A mutant of OspA
rcsb
source organism Borreliella burgdorferi
molecule tags Membrane protein
total genus 49
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2016-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 5b3mO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 5b3mO02
2FKGA 5B10O 3EC5A 2OL6O 2G8CO 2OY7A 2AF5A 2OL7A 1OSPO 2HKDA 2OY8A 5B2AO 2FKJA 2OY1O 2I5VO 2OY5O 3CKFA 3AUMO 2OYBO 1FJ1E 5B3MO 1P4PA 2I5ZO 3CKGA 2PI3O 5B11O 2OL8O
chains in the Genus database with same CATH superfamily
2FKGA 2AT0X 5HWZA 5L3YA 2RA6A 3OBLA 1YWAA 2IZBA 1DF8A 5GAGG 5FAZA 4YMYA 1JJJA 2P8GA 1VWFB 4ORXA 3KFHA 1BSQA 1DZMA 2BS6A 1SLDB 2I5VO 4A8ZA 1AB0A 4TKJA 4PJ2A 3DTQA 5LJKA 1SLEB 3K3LA 1PEEA 1QY1A 3D9WA 2KD2A 4BX7B 3NPOA 2ACPX 2HZRA 3GAQA 4I3DA 2ZJPE 5FQ7E 3KFGA 4AZPA 4IBAA 5HCCC 4HWMA 4I9SA 3WZPA 1NQNA 4BBOA 3WZOA 1OBUA 4IB6A 2FKJA 1W5RA 5K06A 4ARHA 5LKFA 5D45A 1YWBA 1GT1A 2O62A 3EBWA 1EALA 5FQ6E 1NJIG 4OS8A 4GJSA 3BU1A 4ZH9A 3T6LA 1BLRA 1AQBA 3KFFA 2AVIA 1HMTA 3H3IA 1UREA 3RY1A 3RE6A 1HN2A 1STRB 4ZH6A 1SWQA 2PI3O 4ORYA 3EC5A 2AH7X 2OF9A 3FELA 5LJCA 2G5LA 3VG4A 1KL3A 2AT6X 3CQRA 1KT5A 2X45A 5HTDA 4QGVA 1MX8A 1VWPB 3I0AA 4BVMA 5B11O 5IO6A 1TXLA 3KQ0A 5FQ8E 4IAXA 2BS5A 1VQ4E 3CCSE 1KL4A 2X55A 3HOEA 4O4OA 3EW1A 1JQPA 1SWPA 1LICA 3EW2A 1MOYA 2RTBB 1FEMA 2Q9SA 2N93A 2M4LA 2DJGA 3RZYA 3WJDA 2OZQA 1LIFA 4GKCA 1LFOA 1LCZA 4R0BA 4NNSA 1B0OA 1IFBA 5HZ5A 4GZVA 3CF5E 1EW3A 5KICA 1LCWA 1KL5A 2OFMX 4MIRA 1JJUA 5GADG 3ZQ3A 1EPAA 1R0UA 4RUUA 4GDZA 1GT3A 1JJ2E 1VWGB 3AUMO 4NLJA 3VHIA 4LZUA 3IGEA 1OPAA 1K3BA 3B2HA 2OL8O 4YFQA 3VG3A 1G85A 1TOUA 4GD9A 5GAHG 5IRAA 3APVA 1BSYA 2HKDA 2ANSA 4LKTA 5CE4A 2RTLA 3FIDA 2X32A 1VWLB 3KFIA 4CDCA 5EDBA 3T2WA 2QM9A 1GX9A 5AN9B 1N4JA 3VE2A 1SREA 1YJ9E 3UEVA 4ZGUA 3RDMA 2VFCA 3OE3A 1G74A 2X4MA 2KW1A 1Q86G 1KGLA 1N8RG 1ERXA 2G7BA 2QO6A 3CWKA 4I3BA 1G7NA 1STPA 2AT8X 1EIOA 1JV4A 3FA6A 4NW4A 3CR6A 1DFVA 4YGHA 3CCUE 3S26A 1SWSA 4AYHA 3VGWA 1YI2E 1OEJA 4OS3A 1RAVA 3CMEE 4XMHA 1JBHA 1VQNE 1CJ5A 1N7YA 2BT9A 2LB6A 3BX7A 1UYOX 4XMEA 1JMZA 1SY1A 5HZ9A 5BVSA 4GE1A 1DZJA 1TW4A 4CPEA 4DCBA 3VG5A 2IZGB 3O19A 4CPIA 5IO7A 3G71E 5F58A 4TLJA 1KC8G 1X8UA 4O4SA 1W6FA 4I95A 1YUPA 2W2AA 4DQ3A 1SRHA 4ORUA 3O22A 4I9RA 1U18A 1YWDA 2GJ5A 4GU8A 2GC9A 3FIQA 2OFAA 3P6DA 3WJFA 5KHPA 2CQLA 5EZ2A 4COTA 5F7GA 4IOAE 1ML7A 1MVGA 1KOIA 3CCEE 5LKEA 2OVEA 4LZVA 2GTLO 3RBYA 3BSZE 2QOSC 3PP6A 5EPQA 3ELZA 1BEBA 4A1YA 1I06A 2IFBA 3QKGA 1CBIA 4YCEA 3WZQA 2A3FX 5H8TA 1E02A 3VPJE 4ORWA 1PMPA 2OVSA 3NQKA 3JS1A 2RCTA 1SWAA 2RTMA 2CBRA 5LJDA 3G7XA 5D8JA 4Y0RA 1GXAA 2QA4E 2XKLA 2OTJE 4YVBA 1Y55X 3HPEA 3SLTA 1BRQA 3CCRE 4MVLA 1Y52X 3HTYA 3NX2A 1L6MA 2WUTA 4YDBA 5FENA 5HCDC 1DZKA 4KIIA 2FS6A 1CBSA 2ZAIA 2OL6O 3FW5A 5JD2A 4BX5B 3VU1A 4AZMA 1IW2A 4YDAA 2DM5A 5CSEA 3PIPE 4JHQA 3OJYC 1I4UA 2OFBA 4L3RA 4WFVA 3VG6A 3CBCA 2A5CA 3B2JA 3ZW0B 3WJEA 4ZHCA 1VWKB 4A1HA 2OF8A 2FWVA 1OEKA 1KT6A 5LJBA 2RTPB 4IRWA 4A60A 3WOVA 4OELA 4U3QA 1MDCA 2RD7C 3WXQA 3WJCA 1U17A 1Y9TA 2JU7A 2POAA 3RE5A 5HA0A 2AKQA 1E06A 4YGGA 3EYCA 5HTEA 4O4UA 1X8OA 3E3CA 1BRPA 4TKHA 4U8UN 4BX5A 1IKEA 3TZSA 5LJGA 3LTWA 5HCEC 4I3CA 4GRJA 5D4AA 1STSB 2FRSA 4TNNA 4YFPA 4CDFA 1S44A 4EEJA 2W2FA 2IZIA 2GTFX 3ZW0A 1YWCA 2X8FA 2CM4A 2VDFA 3UEWA 3STNA 2R73A 1PBYA 2NNDA 3F8AA 2OY7A 1DC9A 3D96A 2DJFA 3ZUIA 2A13A 3C78X 3CKFA 2QMIA 5DPQA 1P4PA 2AMMX 1QY0A 3CCVE 5JVGE 1RBPA 4M7MA 3CC2E 3ZWEA 2ASNX 3APXA 3DLLE 3HWDA 1KZXA 4GJVA 4DNEA 1B4MA 2JU8A 2NNEA 3NQ3A 1EPBA 3MX7A 1SLFB 1G5WA 3NR3A 3F6ZB 1NQMA 4YCHA 4IO9E 5B29A 2CM9A 3RY2A 4IOCE 5DM6E 2WEWA 2WSJA 1PBOA 1VQ6E 1YP7A 1K24A 4EQAC 1SRFA 3C77X 1K9MG 4NV8A 4ORRA 4N7CA 1GT5A 5F6ZA 2LKKA 2E4JA 3B2IA 3P6HA 1Y0GA 3TGAA 3ZZVA 2RQ0A 5CYBA 2LBVA 3PECA 2IZEB 3PK2A 1KT7A 1LUQA 3VG7A 1VWNB 3S60A 3CBSA 1JMXA 1K73G 2AT5X 2BLGA 4BQUA 1KQXA 3FR4A 3OD9A 1ZNLA 1SXUA 2K62A 1Q7YG 3D97A 2F73A 2RCQA 3APWA 4C5PA 4BX7A 1AVGI 1NC9A 1NP4A 4FBOA 5JR8A 1S7DA 2MM3A 1RXKA 4AZOA 3CCQE 3B2KA 3BX8A 1LDQA 3EMMA 1EUOA 4KC7A 4O3ZA 3STMX 1SWGA 4ORSA 4EKVA 3RDUA 4YGZA 4IMOA 1I04A 2FT9A 3ZW1B 4IAWA 4QYNA 4CV7A 1I9HA 4ID2A 3SOTA 2JW1A 2ZJRE 2IZJA 4AW8A 1VQ5E 4U8UM 2RTGB 2JU3A 3VE1A 1NDJA 2X34A 2G78A 1YIJE 3RDSA 4Y0SA 5H9KA 3BS2A 1LDOA 1QVFE 4CSBA 2MWHA 4KT5A 2FHNX 2C1SA 2LBAA 3FA9A 1JYJA 3FW4A 3PPTA 3C76X 1BJ7A 1NGLA 5AJBA 2OY1O 4NV7A 1IKJA 1S2PA 3EBKA 4O3XB 1KZWA 3CMPA 1D2UA 4MISA 4Y0QA 1ZNHA 4ZFXA 4EFGA 1A3YA 4O9SA 1N43A 3WVMA 1PTSA 3ZW1A 1VWDB 4QYPA 1VQPE 2RTIB 1ZRYA 3RWXA 1HQPA 1Y53X 4IB8A 2RTNB 3IG9A 1W2BE 1LKEA 3Q6LA 3RDXA 2BHVA 2R74A 2FR2A 4CDEA 5L8NA 1DF3A 2L9CA 1SWTA 3Q34A 4ALBA 1K8AG 4KCAA 1LCVA 1ICNA 5LJEA 1SWOA 3FA8A 5EEEA 2ALLX 3CXCE 3HWEA 3STKA 3T6FA 1HQQA 4INNA 1A2DA 5HA1A 1D3SA 2HZQA 4U46A 1E2TA 3CQNA 5BVQA 4BGFA 2NP1A 5IXGA 4KC8A 1HBQA 2F09A 3PH6A 4MVEA 4NLIA 5FFHA 2A8GA 1XKIA 2FR3A 2Q2PA 3BLGA 1KXOA 3HOLA 4CPHB 1ZNKA 3CC4E 1SWRA 2IZKA 4D6BA 3AKMA 4ZHDA 3P6CA 1SWFA 1MM9A 2IZLB 3SZJA 1SWLA 1LELA 4Z6JA 3NP1A 4QZTA 1Y9LA 2QO4A 4ALOA 2MJIA 4UY8G 4GUZA 1ADLA 4ES7A 1SA8A 1FE3A 2UZ2A 2Z4HA 2EU7X 1LIDA 3BY0A 1WUBA 5H9NA 1TOWA 2JN3A 2OY5O 5DG4A 2BSZA 1FJ1E 4U67E 4EXZA 1SWCA 4DQ4A 4L1NA 2Y3FA 4IABA 1KD1G 5IO5A 2L5PA 4CPHA 3SAOA 1ICMA 2YG2A 2ZJQE 5HL7E 4D6AA 5HZ6A 3CPWE 1GGLA 5EEDA 1DV9A 3SZIA 2FHLA 4QQ1A 3HK1A 1YJWE 1VQOE 3NX1A 4XMDA 1OBPA 1X89A 3WBGA 5LJHA 3WJGA 2RTCB 1B8EA 3WYPA 5B2AO 4QRLA 1VQME 1ZNGA 1YJNE 2X56A 4HPBA 2R56A 4Y0PA 4GGZA 4M6SA 4O4XA 2MO5A 1GM6A 3RDQA 3PEDA 4Z2VA 4YBUA 5AEOA 1HBPA 1RJLC 1VQLE 4HFOA 1SXXA 2GH7A 3N91A 5AJCA 1BM5A 1Q82G 2F01A 3PH5A 1KQWA 1I05A 4MEEA 1SRGA 4JNJA 1RXJA 1VQ9E 4NNTA 4BX6B 1JZUA 1NBXA 5BVTA 3I56E 1FELA 4FBRA 2Y3EA 4TQ2A 1YITE 3VHMA 5BYPA 2OFRX 4RUNA 3OW2E 1VWQB 2RN4A 4GNWA 1LF7A 2WEXA 2RTOB 5B27A 5D47A 2L67A 4K19A 4WFNE 2KTSA 5K68A 4YKOA 3PDFA 3GE2A 5D48A 1KT4A 1SWJA 1PM1X 2Y32A 5B5GA 1NP1A 1T8VA 4QGXA 4B55A 2CZUA 4YFRA 1Z24A 4ZHHA 3WJBA 1SXYA 1SY0A 2OTLE 5H1SI 1MX7A 1VQ8E 2RTRB 5CHKA 4ML7B 4HPCA 4BX6A 5B3MO 1CBQA 3ZUOA 1O1UA 4GETA 4HPAA 3FEPA 1IIUA 4Z2OA 1VWHB 2HYSA 1CRBA 2UYWA 4KH8A 1ERBA 2QCBA 1MEPA 2FGSA 3T1DA 4QAEA 4YBPA 1SRJA 1FDQA 2JMBA 3D4RA 2QOMA 2RTDB 3FDCA 3HWFA 4OEMA 3SLOA 1SWNA 3G6EE 4UU3A 2ZSCA 1ALBA 1SY3A 1X8QA 2IZFB 1UZ2X 1T68X 3MG5A 5DM7E 1RSTB 4WFBE 3UAQA 1GT4A 1RSUB 4PSQA 3V8UA 2ACOA 1OPBA 4GGRA 5MLCH 3CCME 1BBPA 3D95A 5B5FA 1VPRA 4OMXA 1E5PA 1TVQA 1QFVA 4WBKA 3CMAE 2GTLN 4BCSA 1SWUA 2WQ9A 1VWRB 2ZAGA 2MF6A 3CKGA 5HZ8A 1VWOB 1SWKA 1Q81G 3PQUA 1JYDA 4AZNA 4JO6A 3CC7E 3F9DA 1HY2A 2FLJA 4IB7A 4NYRA 3U03A 4ZR2A 1A18A 1UYNX 3UEUA 4WCEE 3NADA 3SLJA 4ON1A 3BU9A 1SXWA 4IB9A 4Z28A 5HBSA 5JVHE 2CAMA 2OY8A 4U9CA 1N9YA 1QABE 2HMBA 2C4IA 2KTDA 1I78A 4QZUA 2X8SA 4I60A 3VHHA 1YHQE 1CBRA 2FTBA 1AVDA 4O3YA 3WZNA 2YMSA 1IFCA 3O2YA 4U8UO 4GGTA 3JQOA 3ZI8A 3PQSA 3TF6A 1EI5A 4WFAE 1WBIA 3MBTA 3CD6E 4XMGA 1GKAB 2OVDA 1FTPA 3FENA 1FENA 2X46A 4CDDA 1SLGB 3IA8A 4ODDA 3ELXA 1SY2A 1AELA 3FLLA 3ZW2A 1O8VA 2Q39A 3AKNA 5C0NA 2CBSA 1H91A 1X8PA 1IJ8A 4Z27A 1EXSA 3T2XA 1QY2A 2FS7A 3BRNA 1HXLA 3P6GA 4JGLA 2VFBA 4GK9A 4O49A 2IZAA 1KFFA 2LFOA 1VYOA 3P6EA 4Y5DA 1JJXA 1LPJA 1VWBB 1P6PA 3MVFA 4O3WA 1AVEA 3X00A 3FA7A 1LIEA 3NQ9A 2W2BA 3MM0A 1XCAA 2K23A 5F6BA 1SWDA 1BSOA 1OSPO 3U9PC 4WHIA 5F2BA 3RDOA 3CCJE 3P02A 1DZPA 1SRIA 1VWAB 2OYBO 2A5BA 1EQDA 2JGSA 4GH7A 1GKAA 2A2UA 3APUA 3I55E 3B2LA 5IRUA 3S5VA 1OEEA 4Y59A 1M90G 1U0XA 3JSQA 2RTEB 3L4RA 1RLBE 1ZNDA 1QG5A 1EIIA 2QO5A 4FQBB 2MHDA 1SWHA 2RTFB 5H9LA 5L8OA 1T0VA 1RXHA 2GTLM 4GDAA 5K67A 2Q4NA 4AZQA 1VWMB 2RTKA 1ACDA 2IZDB 5B10O 1LNMA 4BOEA 4QGWA 2AL0X 1QFTA 4WF9E 4FGIB 3U0DA 4ZHGA 4IMNA 2JOZA 2CZTA 4Z2PA 5HAEA 1VYGA 3S5XA 1MUPA 2G79A 4ZJ0A 1HMRA 2IZHB 3VG2A 3FR2A 1E00A 2A0AA 1SWEA 4YH0A 1N0SA 1SMPI 3I17A 5IRWA 4TKBA 4ZGFA 2RTQB 5HZQA 2Q2MA 2C1QA 1O1VA 5GAEG 2BC3A 2G8CO 4ZCBA 2AF5A 2KT4B 1OBQA 2AT3X 1VWEB 2RTAA 2WPUA 2RTHB 1MK5A 3RSWA 3TGCA 1M1KG 3J7ZG 1VWJB 1YP6A 2LA7A 3BDRA 3KZAA 1X8NA 1KT3A 1X71A 2RTJA 3P24A 1SWBA 4BJ8A 3G4SE 3IFBA 5KIDA 1VWCB 4QNIA 3KVNA 3PIOE 2WR6A 1RL6A 3P6FA 1VQKE 4YKMA 5F1EA 1HMSA 3QQ2A 4ZHFA 2IZCB 3RKGA 4GNYA 1S72E 1QQSA 4NYQA 1ZNEA 1BWYA 3FR5A 2HNXA 5AQ6A 4N7DA 1HXZA 4MVIA 2OL7A 3UEXA 4UU2A 4OMWA 5EDCA 3CCLE 3DSZA 3FEKA 1VYFA 2OVAA 4WFUA 2Z4IA 2I5ZO 1KQSE 4AZRA 3LHNA 1GX3A 2WQAE 3HWGA 4FBVA 4XMCA 1JIWI 4MVKA 2XSTA 4EDEA 2QEXE 3AEHA 2L68A 3NBXX 3FMZA 2PY1A 4LQZA 4CPFA 1A57A 3WYQA 1W4TA 4I6SA 1QWDA 1B56A 2X8TA 1VWIB 5H9AA 3SZHA 1LIBA 3TGBA 4CK4A 4LKPA 2NNQA 4TJZA 1GX8A 1N9MA 1VQ7E 4OS0A 4OKAA 2HLVA 2A2GA 4XMFA 2WWPA 3FYFA 3LV4A 4HPDA 3EM0A 4NP1A 1YIVA 1QVGE 5L8IA
chains in the Genus database with same CATH topology
2FKGA 5B10O 3EC5A 2OL6O 2G8CO 2OY7A 2AF5A 2OL7A 1OSPO 2HKDA 2OY8A 5B2AO 2FKJA 2OY1O 2I5VO 2OY5O 3CKFA 3AUMO 2OYBO 1FJ1E 5B3MO 1P4PA 2I5ZO 3IGEA 3CKGA 1RJLC 3IG9A 2PI3O 5B11O 2OL8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKG A;  5B10 O;  3EC5 A;  2OL6 O;  2G8C O;  2OY7 A;  2AF5 A;  2OL7 A;  1OSP O;  2HKD A;  2OY8 A;  5B2A O;  2FKJ A;  2OY1 O;  2I5V O;  2OY5 O;  3CKF A;  3AUM O;  2OYB O;  1FJ1 E;  5B3M O;  1P4P A;  2I5Z O;  3CKG A;  2PI3 O;  5B11 O;  2OL8 O; 
#chains in the Genus database with same CATH topology
 2FKG A;  2AT0 X;  5HWZ A;  5L3Y A;  2RA6 A;  3OBL A;  1YWA A;  2IZB A;  1DF8 A;  5GAG G;  5FAZ A;  4YMY A;  1JJJ A;  2P8G A;  1VWF B;  4ORX A;  3KFH A;  1BSQ A;  1DZM A;  2BS6 A;  1SLD B;  2I5V O;  4A8Z A;  1AB0 A;  4TKJ A;  4PJ2 A;  3DTQ A;  5LJK A;  1SLE B;  3K3L A;  1PEE A;  1QY1 A;  3D9W A;  2KD2 A;  4BX7 B;  3NPO A;  2ACP X;  2HZR A;  3GAQ A;  4I3D A;  2ZJP E;  5FQ7 E;  3KFG A;  4AZP A;  4IBA A;  5HCC C;  4HWM A;  4I9S A;  3WZP A;  1NQN A;  4BBO A;  3WZO A;  1OBU A;  4IB6 A;  2FKJ A;  1W5R A;  5K06 A;  4ARH A;  5LKF A;  5D45 A;  1YWB A;  1GT1 A;  2O62 A;  3EBW A;  1EAL A;  5FQ6 E;  1NJI G;  4OS8 A;  4GJS A;  3BU1 A;  4ZH9 A;  3T6L A;  1BLR A;  1AQB A;  3KFF A;  2AVI A;  1HMT A;  3H3I A;  1URE A;  3RY1 A;  3RE6 A;  1HN2 A;  1STR B;  4ZH6 A;  1SWQ A;  2PI3 O;  4ORY A;  3EC5 A;  2AH7 X;  2OF9 A;  3FEL A;  5LJC A;  2G5L A;  3VG4 A;  1KL3 A;  2AT6 X;  3CQR A;  1KT5 A;  2X45 A;  5HTD A;  4QGV A;  1MX8 A;  1VWP B;  3I0A A;  4BVM A;  5B11 O;  5IO6 A;  1TXL A;  3KQ0 A;  5FQ8 E;  4IAX A;  2BS5 A;  1VQ4 E;  3CCS E;  1KL4 A;  2X55 A;  3HOE A;  4O4O A;  3EW1 A;  1JQP A;  1SWP A;  1LIC A;  3EW2 A;  1MOY A;  2RTB B;  1FEM A;  2Q9S A;  2N93 A;  2M4L A;  2DJG A;  3RZY A;  3WJD A;  2OZQ A;  1LIF A;  4GKC A;  1LFO A;  1LCZ A;  4R0B A;  4NNS A;  1B0O A;  1IFB A;  5HZ5 A;  4GZV A;  3CF5 E;  1EW3 A;  5KIC A;  1LCW A;  1KL5 A;  2OFM X;  4MIR A;  1JJU A;  5GAD G;  3ZQ3 A;  1EPA A;  1R0U A;  4RUU A;  4GDZ A;  1GT3 A;  1JJ2 E;  1VWG B;  3AUM O;  4NLJ A;  3VHI A;  4LZU A;  3IGE A;  1OPA A;  1K3B A;  3B2H A;  2OL8 O;  4YFQ A;  3VG3 A;  1G85 A;  1TOU A;  4GD9 A;  5GAH G;  5IRA A;  3APV A;  1BSY A;  2HKD A;  2ANS A;  4LKT A;  5CE4 A;  2RTL A;  3FID A;  2X32 A;  1VWL B;  3KFI A;  4CDC A;  5EDB A;  3T2W A;  2QM9 A;  1GX9 A;  5AN9 B;  1N4J A;  3VE2 A;  1SRE A;  1YJ9 E;  3UEV A;  4ZGU A;  3RDM A;  2VFC A;  3OE3 A;  1G74 A;  2X4M A;  2KW1 A;  1Q86 G;  1KGL A;  1N8R G;  1ERX A;  2G7B A;  2QO6 A;  3CWK A;  4I3B A;  1G7N A;  1STP A;  2AT8 X;  1EIO A;  1JV4 A;  3FA6 A;  4NW4 A;  3CR6 A;  1DFV A;  4YGH A;  3CCU E;  3S26 A;  1SWS A;  4AYH A;  3VGW A;  1YI2 E;  1OEJ A;  4OS3 A;  1RAV A;  3CME E;  4XMH A;  1JBH A;  1VQN E;  1CJ5 A;  1N7Y A;  2BT9 A;  2LB6 A;  3BX7 A;  1UYO X;  4XME A;  1JMZ A;  1SY1 A;  5HZ9 A;  5BVS A;  4GE1 A;  1DZJ A;  1TW4 A;  4CPE A;  4DCB A;  3VG5 A;  2IZG B;  3O19 A;  4CPI A;  5IO7 A;  3G71 E;  5F58 A;  4TLJ A;  1KC8 G;  1X8U A;  4O4S A;  1W6F A;  4I95 A;  1YUP A;  2W2A A;  4DQ3 A;  1SRH A;  4ORU A;  3O22 A;  4I9R A;  1U18 A;  1YWD A;  2GJ5 A;  4GU8 A;  2GC9 A;  3FIQ A;  2OFA A;  3P6D A;  3WJF A;  5KHP A;  2CQL A;  5EZ2 A;  4COT A;  5F7G A;  4IOA E;  1ML7 A;  1MVG A;  1KOI A;  3CCE E;  5LKE A;  2OVE A;  4LZV A;  2GTL O;  3RBY A;  3BSZ E;  2QOS C;  3PP6 A;  5EPQ A;  3ELZ A;  1BEB A;  4A1Y A;  1I06 A;  2IFB A;  3QKG A;  1CBI A;  4YCE A;  3WZQ A;  2A3F X;  5H8T A;  1E02 A;  3VPJ E;  4ORW A;  1PMP A;  2OVS A;  3NQK A;  3JS1 A;  2RCT A;  1SWA A;  2RTM A;  2CBR A;  5LJD A;  3G7X A;  5D8J A;  4Y0R A;  1GXA A;  2QA4 E;  2XKL A;  2OTJ E;  4YVB A;  1Y55 X;  3HPE A;  3SLT A;  1BRQ A;  3CCR E;  4MVL A;  1Y52 X;  3HTY A;  3NX2 A;  1L6M A;  2WUT A;  4YDB A;  5FEN A;  5HCD C;  1DZK A;  4KII A;  2FS6 A;  1CBS A;  2ZAI A;  2OL6 O;  3FW5 A;  5JD2 A;  4BX5 B;  3VU1 A;  4AZM A;  1IW2 A;  4YDA A;  2DM5 A;  5CSE A;  3PIP E;  4JHQ A;  3OJY C;  1I4U A;  2OFB A;  4L3R A;  4WFV A;  3VG6 A;  3CBC A;  2A5C A;  3B2J A;  3ZW0 B;  3WJE A;  4ZHC A;  1VWK B;  4A1H A;  2OF8 A;  2FWV A;  1OEK A;  1KT6 A;  5LJB A;  2RTP B;  4IRW A;  4A60 A;  3WOV A;  4OEL A;  4U3Q A;  1MDC A;  2RD7 C;  3WXQ A;  3WJC A;  1U17 A;  1Y9T A;  2JU7 A;  2POA A;  3RE5 A;  5HA0 A;  2AKQ A;  1E06 A;  4YGG A;  3EYC A;  5HTE A;  4O4U A;  1X8O A;  3E3C A;  1BRP A;  4TKH A;  4U8U N;  4BX5 A;  1IKE A;  3TZS A;  5LJG A;  3LTW A;  5HCE C;  4I3C A;  4GRJ A;  5D4A A;  1STS B;  2FRS A;  4TNN A;  4YFP A;  4CDF A;  1S44 A;  4EEJ A;  2W2F A;  2IZI A;  2GTF X;  3ZW0 A;  1YWC A;  2X8F A;  2CM4 A;  2VDF A;  3UEW A;  3STN A;  2R73 A;  1PBY A;  2NND A;  3F8A A;  2OY7 A;  1DC9 A;  3D96 A;  2DJF A;  3ZUI A;  2A13 A;  3C78 X;  3CKF A;  2QMI A;  5DPQ A;  1P4P A;  2AMM X;  1QY0 A;  3CCV E;  5JVG E;  1RBP A;  4M7M A;  3CC2 E;  3ZWE A;  2ASN X;  3APX A;  3DLL E;  3HWD A;  1KZX A;  4GJV A;  4DNE A;  1B4M A;  2JU8 A;  2NNE A;  3NQ3 A;  1EPB A;  3MX7 A;  1SLF B;  1G5W A;  3NR3 A;  3F6Z B;  1NQM A;  4YCH A;  4IO9 E;  5B29 A;  2CM9 A;  3RY2 A;  4IOC E;  5DM6 E;  2WEW A;  2WSJ A;  1PBO A;  1VQ6 E;  1YP7 A;  1K24 A;  4EQA C;  1SRF A;  3C77 X;  1K9M G;  4NV8 A;  4ORR A;  4N7C A;  1GT5 A;  5F6Z A;  2LKK A;  2E4J A;  3B2I A;  3P6H A;  1Y0G A;  3TGA A;  3ZZV A;  2RQ0 A;  5CYB A;  2LBV A;  3PEC A;  2IZE B;  3PK2 A;  1KT7 A;  1LUQ A;  3VG7 A;  1VWN B;  3S60 A;  3CBS A;  1JMX A;  1K73 G;  2AT5 X;  2BLG A;  4BQU A;  1KQX A;  3FR4 A;  3OD9 A;  1ZNL A;  1SXU A;  2K62 A;  1Q7Y G;  3D97 A;  2F73 A;  2RCQ A;  3APW A;  4C5P A;  4BX7 A;  1AVG I;  1NC9 A;  1NP4 A;  4FBO A;  5JR8 A;  1S7D A;  2MM3 A;  1RXK A;  4AZO A;  3CCQ E;  3B2K A;  3BX8 A;  1LDQ A;  3EMM A;  1EUO A;  4KC7 A;  4O3Z A;  3STM X;  1SWG A;  4ORS A;  4EKV A;  3RDU A;  4YGZ A;  4IMO A;  1I04 A;  2FT9 A;  3ZW1 B;  4IAW A;  4QYN A;  4CV7 A;  1I9H A;  4ID2 A;  3SOT A;  2JW1 A;  2ZJR E;  2IZJ A;  4AW8 A;  1VQ5 E;  4U8U M;  2RTG B;  2JU3 A;  3VE1 A;  1NDJ A;  2X34 A;  2G78 A;  1YIJ E;  3RDS A;  4Y0S A;  5H9K A;  3BS2 A;  1LDO A;  1QVF E;  4CSB A;  2MWH A;  4KT5 A;  2FHN X;  2C1S A;  2LBA A;  3FA9 A;  1JYJ A;  3FW4 A;  3PPT A;  3C76 X;  1BJ7 A;  1NGL A;  5AJB A;  2OY1 O;  4NV7 A;  1IKJ A;  1S2P A;  3EBK A;  4O3X B;  1KZW A;  3CMP A;  1D2U A;  4MIS A;  4Y0Q A;  1ZNH A;  4ZFX A;  4EFG A;  1A3Y A;  4O9S A;  1N43 A;  3WVM A;  1PTS A;  3ZW1 A;  1VWD B;  4QYP A;  1VQP E;  2RTI B;  1ZRY A;  3RWX A;  1HQP A;  1Y53 X;  4IB8 A;  2RTN B;  3IG9 A;  1W2B E;  1LKE A;  3Q6L A;  3RDX A;  2BHV A;  2R74 A;  2FR2 A;  4CDE A;  5L8N A;  1DF3 A;  2L9C A;  1SWT A;  3Q34 A;  4ALB A;  1K8A G;  4KCA A;  1LCV A;  1ICN A;  5LJE A;  1SWO A;  3FA8 A;  5EEE A;  2ALL X;  3CXC E;  3HWE A;  3STK A;  3T6F A;  1HQQ A;  4INN A;  1A2D A;  5HA1 A;  1D3S A;  2HZQ A;  4U46 A;  1E2T A;  3CQN A;  5BVQ A;  4BGF A;  2NP1 A;  5IXG A;  4KC8 A;  1HBQ A;  2F09 A;  3PH6 A;  4MVE A;  4NLI A;  5FFH A;  2A8G A;  1XKI A;  2FR3 A;  2Q2P A;  3BLG A;  1KXO A;  3HOL A;  4CPH B;  1ZNK A;  3CC4 E;  1SWR A;  2IZK A;  4D6B A;  3AKM A;  4ZHD A;  3P6C A;  1SWF A;  1MM9 A;  2IZL B;  3SZJ A;  1SWL A;  1LEL A;  4Z6J A;  3NP1 A;  4QZT A;  1Y9L A;  2QO4 A;  4ALO A;  2MJI A;  4UY8 G;  4GUZ A;  1ADL A;  4ES7 A;  1SA8 A;  1FE3 A;  2UZ2 A;  2Z4H A;  2EU7 X;  1LID A;  3BY0 A;  1WUB A;  5H9N A;  1TOW A;  2JN3 A;  2OY5 O;  5DG4 A;  2BSZ A;  1FJ1 E;  4U67 E;  4EXZ A;  1SWC A;  4DQ4 A;  4L1N A;  2Y3F A;  4IAB A;  1KD1 G;  5IO5 A;  2L5P A;  4CPH A;  3SAO A;  1ICM A;  2YG2 A;  2ZJQ E;  5HL7 E;  4D6A A;  5HZ6 A;  3CPW E;  1GGL A;  5EED A;  1DV9 A;  3SZI A;  2FHL A;  4QQ1 A;  3HK1 A;  1YJW E;  1VQO E;  3NX1 A;  4XMD A;  1OBP A;  1X89 A;  3WBG A;  5LJH A;  3WJG A;  2RTC B;  1B8E A;  3WYP A;  5B2A O;  4QRL A;  1VQM E;  1ZNG A;  1YJN E;  2X56 A;  4HPB A;  2R56 A;  4Y0P A;  4GGZ A;  4M6S A;  4O4X A;  2MO5 A;  1GM6 A;  3RDQ A;  3PED A;  4Z2V A;  4YBU A;  5AEO A;  1HBP A;  1RJL C;  1VQL E;  4HFO A;  1SXX A;  2GH7 A;  3N91 A;  5AJC A;  1BM5 A;  1Q82 G;  2F01 A;  3PH5 A;  1KQW A;  1I05 A;  4MEE A;  1SRG A;  4JNJ A;  1RXJ A;  1VQ9 E;  4NNT A;  4BX6 B;  1JZU A;  1NBX A;  5BVT A;  3I56 E;  1FEL A;  4FBR A;  2Y3E A;  4TQ2 A;  1YIT E;  3VHM A;  5BYP A;  2OFR X;  4RUN A;  3OW2 E;  1VWQ B;  2RN4 A;  4GNW A;  1LF7 A;  2WEX A;  2RTO B;  5B27 A;  5D47 A;  2L67 A;  4K19 A;  4WFN E;  2KTS A;  5K68 A;  4YKO A;  3PDF A;  3GE2 A;  5D48 A;  1KT4 A;  1SWJ A;  1PM1 X;  2Y32 A;  5B5G A;  1NP1 A;  1T8V A;  4QGX A;  4B55 A;  2CZU A;  4YFR A;  1Z24 A;  4ZHH A;  3WJB A;  1SXY A;  1SY0 A;  2OTL E;  5H1S I;  1MX7 A;  1VQ8 E;  2RTR B;  5CHK A;  4ML7 B;  4HPC A;  4BX6 A;  5B3M O;  1CBQ A;  3ZUO A;  1O1U A;  4GET A;  4HPA A;  3FEP A;  1IIU A;  4Z2O A;  1VWH B;  2HYS A;  1CRB A;  2UYW A;  4KH8 A;  1ERB A;  2QCB A;  1MEP A;  2FGS A;  3T1D A;  4QAE A;  4YBP A;  1SRJ A;  1FDQ A;  2JMB A;  3D4R A;  2QOM A;  2RTD B;  3FDC A;  3HWF A;  4OEM A;  3SLO A;  1SWN A;  3G6E E;  4UU3 A;  2ZSC A;  1ALB A;  1SY3 A;  1X8Q A;  2IZF B;  1UZ2 X;  1T68 X;  3MG5 A;  5DM7 E;  1RST B;  4WFB E;  3UAQ A;  1GT4 A;  1RSU B;  4PSQ A;  3V8U A;  2ACO A;  1OPB A;  4GGR A;  5MLC H;  3CCM E;  1BBP A;  3D95 A;  5B5F A;  1VPR A;  4OMX A;  1E5P A;  1TVQ A;  1QFV A;  4WBK A;  3CMA E;  2GTL N;  4BCS A;  1SWU A;  2WQ9 A;  1VWR B;  2ZAG A;  2MF6 A;  3CKG A;  5HZ8 A;  1VWO B;  1SWK A;  1Q81 G;  3PQU A;  1JYD A;  4AZN A;  4JO6 A;  3CC7 E;  3F9D A;  1HY2 A;  2FLJ A;  4IB7 A;  4NYR A;  3U03 A;  4ZR2 A;  1A18 A;  1UYN X;  3UEU A;  4WCE E;  3NAD A;  3SLJ A;  4ON1 A;  3BU9 A;  1SXW A;  4IB9 A;  4Z28 A;  5HBS A;  5JVH E;  2CAM A;  2OY8 A;  4U9C A;  1N9Y A;  1QAB E;  2HMB A;  2C4I A;  2KTD A;  1I78 A;  4QZU A;  2X8S A;  4I60 A;  3VHH A;  1YHQ E;  1CBR A;  2FTB A;  1AVD A;  4O3Y A;  3WZN A;  2YMS A;  1IFC A;  3O2Y A;  4U8U O;  4GGT A;  3JQO A;  3ZI8 A;  3PQS A;  3TF6 A;  1EI5 A;  4WFA E;  1WBI A;  3MBT A;  3CD6 E;  4XMG A;  1GKA B;  2OVD A;  1FTP A;  3FEN A;  1FEN A;  2X46 A;  4CDD A;  1SLG B;  3IA8 A;  4ODD A;  3ELX A;  1SY2 A;  1AEL A;  3FLL A;  3ZW2 A;  1O8V A;  2Q39 A;  3AKN A;  5C0N A;  2CBS A;  1H91 A;  1X8P A;  1IJ8 A;  4Z27 A;  1EXS A;  3T2X A;  1QY2 A;  2FS7 A;  3BRN A;  1HXL A;  3P6G A;  4JGL A;  2VFB A;  4GK9 A;  4O49 A;  2IZA A;  1KFF A;  2LFO A;  1VYO A;  3P6E A;  4Y5D A;  1JJX A;  1LPJ A;  1VWB B;  1P6P A;  3MVF A;  4O3W A;  1AVE A;  3X00 A;  3FA7 A;  1LIE A;  3NQ9 A;  2W2B A;  3MM0 A;  1XCA A;  2K23 A;  5F6B A;  1SWD A;  1BSO A;  1OSP O;  3U9P C;  4WHI A;  5F2B A;  3RDO A;  3CCJ E;  3P02 A;  1DZP A;  1SRI A;  1VWA B;  2OYB O;  2A5B A;  1EQD A;  2JGS A;  4GH7 A;  1GKA A;  2A2U A;  3APU A;  3I55 E;  3B2L A;  5IRU A;  3S5V A;  1OEE A;  4Y59 A;  1M90 G;  1U0X A;  3JSQ A;  2RTE B;  3L4R A;  1RLB E;  1ZND A;  1QG5 A;  1EII A;  2QO5 A;  4FQB B;  2MHD A;  1SWH A;  2RTF B;  5H9L A;  5L8O A;  1T0V A;  1RXH A;  2GTL M;  4GDA A;  5K67 A;  2Q4N A;  4AZQ A;  1VWM B;  2RTK A;  1ACD A;  2IZD B;  5B10 O;  1LNM A;  4BOE A;  4QGW A;  2AL0 X;  1QFT A;  4WF9 E;  4FGI B;  3U0D A;  4ZHG A;  4IMN A;  2JOZ A;  2CZT A;  4Z2P A;  5HAE A;  1VYG A;  3S5X A;  1MUP A;  2G79 A;  4ZJ0 A;  1HMR A;  2IZH B;  3VG2 A;  3FR2 A;  1E00 A;  2A0A A;  1SWE A;  4YH0 A;  1N0S A;  1SMP I;  3I17 A;  5IRW A;  4TKB A;  4ZGF A;  2RTQ B;  5HZQ A;  2Q2M A;  2C1Q A;  1O1V A;  5GAE G;  2BC3 A;  2G8C O;  4ZCB A;  2AF5 A;  2KT4 B;  1OBQ A;  2AT3 X;  1VWE B;  2RTA A;  2WPU A;  2RTH B;  1MK5 A;  3RSW A;  3TGC A;  1M1K G;  3J7Z G;  1VWJ B;  1YP6 A;  2LA7 A;  3BDR A;  3KZA A;  1X8N A;  1KT3 A;  1X71 A;  2RTJ A;  3P24 A;  1SWB A;  4BJ8 A;  3G4S E;  3IFB A;  5KID A;  1VWC B;  4QNI A;  3KVN A;  3PIO E;  2WR6 A;  1RL6 A;  3P6F A;  1VQK E;  4YKM A;  5F1E A;  1HMS A;  3QQ2 A;  4ZHF A;  2IZC B;  3RKG A;  4GNY A;  1S72 E;  1QQS A;  4NYQ A;  1ZNE A;  1BWY A;  3FR5 A;  2HNX A;  5AQ6 A;  4N7D A;  1HXZ A;  4MVI A;  2OL7 A;  3UEX A;  4UU2 A;  4OMW A;  5EDC A;  3CCL E;  3DSZ A;  3FEK A;  1VYF A;  2OVA A;  4WFU A;  2Z4I A;  2I5Z O;  1KQS E;  4AZR A;  3LHN A;  1GX3 A;  2WQA E;  3HWG A;  4FBV A;  4XMC A;  1JIW I;  4MVK A;  2XST A;  4EDE A;  2QEX E;  3AEH A;  2L68 A;  3NBX X;  3FMZ A;  2PY1 A;  4LQZ A;  4CPF A;  1A57 A;  3WYQ A;  1W4T A;  4I6S A;  1QWD A;  1B56 A;  2X8T A;  1VWI B;  5H9A A;  3SZH A;  1LIB A;  3TGB A;  4CK4 A;  4LKP A;  2NNQ A;  4TJZ A;  1GX8 A;  1N9M A;  1VQ7 E;  4OS0 A;  4OKA A;  2HLV A;  2A2G A;  4XMF A;  2WWP A;  3FYF A;  3LV4 A;  4HPD A;  3EM0 A;  4NP1 A;  1YIV A;  1QVG E;  5L8I A; 
#chains in the Genus database with same CATH homology
 2FKG A;  5B10 O;  3EC5 A;  2OL6 O;  2G8C O;  2OY7 A;  2AF5 A;  2OL7 A;  1OSP O;  2HKD A;  2OY8 A;  5B2A O;  2FKJ A;  2OY1 O;  2I5V O;  2OY5 O;  3CKF A;  3AUM O;  2OYB O;  1FJ1 E;  5B3M O;  1P4P A;  2I5Z O;  3IGE A;  3CKG A;  1RJL C;  3IG9 A;  2PI3 O;  5B11 O;  2OL8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...