5B3RA

Crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
214
Chain Sequence
LPDLKIEKLEKGVYVHTSFEGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of Metallo-beta-Lactamase IMP-18
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords IMP-18
total genus 69
structure length 214
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b3rA00
2AZ4A 4LE6A 1DXKA 5A0VA 1K07A 4NQ6A 3BC2A 3SD9A 3ZWFA 3I0VA 2GKLA 2Q42A 5EH9A 2NZEA 3RPCA 2WYMA 1KR3A 2YNVA 2BG8A 3KNRA 2YZ3A 1MQOA 1JT1A 5HH6A 1X8HA 3MD7A 2WRSA 4P62A 3AF5A 4Z67A 3WXCA 2BFZB 1WW1A 4YSBA 5LE1A 5A87A 2QEDA 4XUKA 1X8GA 4CHLA 3BV6A 5LCFA 4H0DA 4ZO3A 3VQZA 2NZFA 2Q0IA 4EYLA 4UAMA 4AWYB 3I15A 2I7VA 1BC2A 4YSKA 1WRAA 3SW3A 5ACTA 5K4MA 2FHXB 4BZ3A 5LMCA 2ZO4A 3VPEA 5B1UA 1A7TA 3AJ3A 5ACPA 5B15A 2FU7A 4C1HA 4GYQA 4EXSA 3IDZA 3TP9A 2Y8BA 3IOFA 4RL0A 3T9MA 2WYLA 4YSLA 3A4YA 4C09A 5K4NA 4JO0A 5LCAA 3P2UA 5EVKA 4F6HA 4XWTA 4DIKA 5A0TA 3IE2A 4ZO2A 4DILA 4RAMA 2YNVB 1YCFA 1KO2A 2NXAA 4PVTA 2Y8AA 2YNTB 4TYFA 2BR6A 4J5FA 3ZR9A 3X2YA 5KILA 2BIBA 4RBSA 2GFJA 2BG7A 4C1GA 2BG2A 4Z5ZA 5LSCA 4D1TA 4D1WA 2QJSA 3IEMA 4XWWA 4EXYA 2P4ZA 3H3EA 2VW8A 5HISA 4AD9A 4EY2A 2I7TA 4UWPB 4NQ2A 4AX0B 4ZNBA 4TZBA 1Y44A 5LM6A 3L6NA 5DPXA 1X8IA 2BTNA 4UWSB 2M5CA 5AYAA 1VMEA 3IE1A 1E5DA 1P9EA 2GFKA 2AIOA 5ACXA 4UA4A 3DHCA 2P97A 3F9OA 5LLDA 1ZTCA 4TZEA 4GYUA 1QH5A 5KIKA 2YNUA 3RKKA 2YNWA 4AWZA 3I13A 5B3RA 1M2XA 4HKYA 3ESHA 5ACWA 4RAWA 2BG8B 4TYTA 2DKFA 2Q0JA 2ZZIA 4FEKA 4FSBA 4V0HA 3PY6A 3RKJA 3X2XA 1SMLA 4D1VA 2QINA 4RM5A 5K0WA 3FAIA 3QH8A 2BFKA 1QH3A 4FR7A 4Z7RA 2OHIA 4F6ZA 5LS3A 4TZ9A 4EYFA 5A5ZA 5EW0A 3SPUA 5K4KA 2FK6A 4NQ4A 2BC2A 1JJEA 3PY5A 5ACSA 3IOGA 2OHHA 3AF6A 2ZWRA 3SRXA 3X2ZA 5AEBA 4C1CA 2YNTA 4C1FA 1VJNA 3G1PA 4C1DA 3IEKA 4UWRB 4HL1A 2FHXA 4EYBA 1BMCA 2HB9A 5HIOA 3SFPA 4AX1B 2Q9UA 3X30A 5ACUA 2XR1A 2QDSA 4D02A 3S0ZA 1YCHA 2NYPA 3PG4A 1YCGA 3FCZA 5EV8A 4Z5YA 4BP0A 2P1EA 1WUPA 5EHTA 3LVZA 3ADRA 5EWAA 4KEQA 2FU8A 2E7YA 3ZQ4A 2DOOA 3DH8A 5AHRA 1XM8A 2ZNBA 5FQAA 2QDTA 2BFZA 5HH4A 4NQ5A 3KNSA 3DHBA 5ACRA 4J5HA 4Z6XA 4B87A 4KEPA 1BVTA 1HLKA 2A7MA 2BMIA 4ZEJA 3DHAA 4C1EA 2WYMC 2YCBA 4HL2A 5IQKA 2FU9A 2UYXA 4RL2A 2Y87A 5HIPA 2WHGA 2P18A 4UWOB 2GCUA 2R2DA 4Z60A 4EFZA 2BFLA 5AXOA 3I11A 1KO3A 4WD6A 3R2UA 4GCWA 2H6AA 1L9YA 2I7XA 5EVBA 3SBLA 5FQBA 3T3OA 2GMNA 3Q6VA 1JJTA 1DDKA 3ZNBA 1ZKPA 5ACQA 2BG6A 5HH5A 4UBQA 2FM6A 5EVDA 1DD6A 5LCHA 3BK2A 3IELA 5ACVA 1A8TA 5FQCA 3I14A 4O98A 2CBNA 3BK1A 2BGAA 2M5DA 2OHJA 3IE0A 1ZNBA 4TZFA 1VGNA 4U4LA 3T3NA 4D1UA 5AHOA 5HIQA 2XF4A 2FU6A 1WUOA 3KL7A 5AXRA 1XTOA 4PVOA 5EV6A 3JXPA
chains in the Genus database with same CATH superfamily
2AZ4A 4LE6A 1DXKA 5A0VA 1K07A 4NQ6A 3BC2A 3SD9A 3ZWFA 3I0VA 2GKLA 2Q42A 5EH9A 2NZEA 3RPCA 2WYMA 1KR3A 2YNVA 2BG8A 3KNRA 2YZ3A 1MQOA 1JT1A 5HH6A 1X8HA 3MD7A 2WRSA 4P62A 3AF5A 4Z67A 3WXCA 2BFZB 1WW1A 4YSBA 5LE1A 5A87A 2QEDA 4XUKA 1X8GA 4CHLA 3BV6A 2CFUA 5LCFA 4H0DA 4ZO3A 3VQZA 2NZFA 2Q0IA 4EYLA 4UAMA 2YHEA 4AWYB 3I15A 2I7VA 1BC2A 4YSKA 1WRAA 3SW3A 5ACTA 5K4MA 2FHXB 4BZ3A 5LMCA 2ZO4A 3VPEA 5B1UA 1A7TA 3AJ3A 5ACPA 5B15A 2FU7A 4C1HA 4GYQA 4EXSA 3IDZA 3TP9A 2Y8BA 3IOFA 4RL0A 3T9MA 2WYLA 4YSLA 3A4YA 4C09A 5K4NA 4JO0A 5LCAA 3P2UA 5EVKA 4F6HA 4XWTA 4DIKA 5A0TA 3IE2A 4ZO2A 4DILA 4RAMA 2YNVB 1YCFA 1KO2A 2NXAA 4PVTA 2Y8AA 2YNTB 4TYFA 2BR6A 4AXHA 4J5FA 3ZR9A 3X2YA 5KILA 2BIBA 4RBSA 2GFJA 2BG7A 4C1GA 2BG2A 4Z5ZA 5LSCA 4D1TA 4D1WA 2QJSA 3IEMA 4XWWA 4EXYA 2P4ZA 3H3EA 2VW8A 5AIJA 5HISA 4AD9A 4EY2A 2I7TA 4UWPB 4NQ2A 4AX0B 4ZNBA 4TZBA 1Y44A 5LM6A 3L6NA 5DPXA 1X8IA 2BTNA 4UWSB 2M5CA 5AYAA 1VMEA 3IE1A 1E5DA 1P9EA 2GFKA 4AV7A 2AIOA 5ACXA 4UA4A 3DHCA 2P97A 3F9OA 5LLDA 1ZTCA 4TZEA 4GYUA 1QH5A 5KIKA 2YNUA 4NURA 3RKKA 2YNWA 4AWZA 3I13A 5B3RA 1M2XA 4HKYA 3ESHA 5ACWA 4RAWA 2BG8B 4TYTA 2DKFA 2Q0JA 2ZZIA 4FEKA 4FSBA 4V0HA 4PDXA 3PY6A 3RKJA 3X2XA 1SMLA 4D1VA 2QINA 4RM5A 5K0WA 3FAIA 3QH8A 2BFKA 1QH3A 4FR7A 4Z7RA 2CG3A 2OHIA 4F6ZA 5LS3A 4TZ9A 4EYFA 5A5ZA 5EW0A 3SPUA 5K4KA 2FK6A 4NQ4A 2BC2A 1JJEA 3PY5A 5ACSA 3IOGA 2OHHA 3AF6A 2ZWRA 3SRXA 3X2ZA 5AJLA 5AEBA 4C1CA 2YNTA 4C1FA 1VJNA 3G1PA 4C1DA 3IEKA 4UWRB 4HL1A 2FHXA 4EYBA 1BMCA 2HB9A 5HIOA 3SFPA 4AX1B 2Q9UA 3X30A 5ACUA 2XR1A 2QDSA 4D02A 3S0ZA 1YCHA 2NYPA 3PG4A 1YCGA 3FCZA 5EV8A 2CFZA 4Z5YA 4BP0A 2P1EA 1WUPA 5EHTA 3LVZA 3ADRA 5EWAA 4KEQA 2FU8A 2E7YA 3ZQ4A 2DOOA 3DH8A 5AHRA 1XM8A 2ZNBA 5FQAA 2QDTA 2BFZA 5HH4A 4NQ5A 3KNSA 3DHBA 5ACRA 4J5HA 4Z6XA 4B87A 4KEPA 1BVTA 1HLKA 2A7MA 2BMIA 4ZEJA 3DHAA 4C1EA 2WYMC 2YCBA 4HL2A 5IQKA 2FU9A 2UYXA 4RL2A 2Y87A 5HIPA 2WHGA 2P18A 4UWOB 2GCUA 2R2DA 4Z60A 2CG2A 4EFZA 2BFLA 5AXOA 3I11A 1KO3A 4WD6A 3R2UA 4GCWA 2H6AA 1L9YA 2I7XA 5EVBA 3SBLA 5FQBA 3T3OA 2GMNA 3Q6VA 1JJTA 1DDKA 3ZNBA 1ZKPA 5ACQA 2BG6A 5HH5A 4UBQA 2FM6A 5EVDA 1DD6A 5LCHA 3BK2A 3IELA 5ACVA 1A8TA 5FQCA 3I14A 4O98A 5A23A 2CBNA 3BK1A 2BGAA 2M5DA 2OHJA 3IE0A 1ZNBA 4TZFA 1VGNA 4U4LA 3T3NA 4D1UA 5AHOA 5HIQA 2XF4A 2FU6A 1WUOA 3KL7A 5AXRA 1XTOA 4PVOA 5EV6A 3JXPA
chains in the Genus database with same CATH topology
2AZ4A 4LE6A 1DXKA 5A0VA 1K07A 4NQ6A 3BC2A 3SD9A 3ZWFA 3I0VA 2GKLA 2Q42A 5EH9A 2NZEA 3RPCA 2WYMA 1KR3A 2YNVA 2BG8A 3KNRA 2YZ3A 1MQOA 1JT1A 5HH6A 1X8HA 3MD7A 2WRSA 4P62A 3AF5A 4Z67A 3WXCA 2BFZB 1WW1A 4YSBA 5LE1A 5A87A 2QEDA 4XUKA 1X8GA 4CHLA 3BV6A 5LCFA 4H0DA 4ZO3A 3VQZA 2NZFA 2Q0IA 4EYLA 4UAMA 4AWYB 3I15A 2I7VA 1BC2A 4YSKA 1WRAA 3SW3A 5ACTA 5K4MA 2FHXB 4BZ3A 5LMCA 2ZO4A 3VPEA 5B1UA 1A7TA 3AJ3A 5ACPA 5B15A 2FU7A 4C1HA 4GYQA 4EXSA 3IDZA 3TP9A 2Y8BA 3IOFA 4RL0A 3T9MA 2WYLA 4YSLA 3A4YA 4C09A 5K4NA 4JO0A 5LCAA 3P2UA 5EVKA 4F6HA 4XWTA 4DIKA 5A0TA 3IE2A 4ZO2A 4DILA 4RAMA 2YNVB 1YCFA 1KO2A 2NXAA 4PVTA 2Y8AA 2YNTB 4TYFA 2BR6A 4J5FA 3ZR9A 3X2YA 5KILA 2BIBA 4RBSA 2GFJA 2BG7A 4C1GA 2BG2A 4Z5ZA 5LSCA 4D1TA 4D1WA 2QJSA 3IEMA 4XWWA 4EXYA 2P4ZA 3H3EA 2VW8A 5HISA 4AD9A 4EY2A 2I7TA 4UWPB 4NQ2A 4AX0B 4ZNBA 4TZBA 1Y44A 5LM6A 3L6NA 5DPXA 1X8IA 2BTNA 4UWSB 2M5CA 5AYAA 1VMEA 3IE1A 1E5DA 1P9EA 2GFKA 2AIOA 5ACXA 4UA4A 3DHCA 2P97A 3F9OA 5LLDA 1ZTCA 4TZEA 4GYUA 1QH5A 5KIKA 2YNUA 3RKKA 2YNWA 4AWZA 3I13A 5B3RA 1M2XA 4HKYA 3ESHA 5ACWA 4RAWA 2BG8B 4TYTA 2DKFA 2Q0JA 2ZZIA 4FEKA 4FSBA 4V0HA 3PY6A 3RKJA 3X2XA 1SMLA 4D1VA 2QINA 4RM5A 5K0WA 3FAIA 3QH8A 2BFKA 1QH3A 4FR7A 4Z7RA 2OHIA 4F6ZA 5LS3A 4TZ9A 4EYFA 5A5ZA 5EW0A 3SPUA 5K4KA 2FK6A 4NQ4A 2BC2A 1JJEA 3PY5A 5ACSA 3IOGA 2OHHA 3AF6A 2ZWRA 3SRXA 3X2ZA 5AEBA 4C1CA 2YNTA 4C1FA 1VJNA 3G1PA 4C1DA 3IEKA 4UWRB 4HL1A 2FHXA 4EYBA 1BMCA 2HB9A 5HIOA 3SFPA 4AX1B 2Q9UA 3X30A 5ACUA 2XR1A 2QDSA 4D02A 3S0ZA 1YCHA 2NYPA 3PG4A 1YCGA 3FCZA 5EV8A 4Z5YA 4BP0A 2P1EA 1WUPA 5EHTA 3LVZA 3ADRA 5EWAA 4KEQA 2FU8A 2E7YA 3ZQ4A 2DOOA 3DH8A 5AHRA 1XM8A 2ZNBA 5FQAA 2QDTA 2BFZA 5HH4A 4NQ5A 3KNSA 3DHBA 5ACRA 4J5HA 4Z6XA 4B87A 4KEPA 1BVTA 1HLKA 2A7MA 2BMIA 4ZEJA 3DHAA 4C1EA 2WYMC 2YCBA 4HL2A 5IQKA 2FU9A 2UYXA 4RL2A 2Y87A 5HIPA 2WHGA 2P18A 4UWOB 2GCUA 2R2DA 4Z60A 4EFZA 2BFLA 5AXOA 3I11A 1KO3A 4WD6A 3R2UA 4GCWA 2H6AA 1L9YA 2I7XA 5EVBA 3SBLA 5FQBA 3T3OA 2GMNA 3Q6VA 1JJTA 1DDKA 3ZNBA 1ZKPA 5ACQA 2BG6A 5HH5A 4UBQA 2FM6A 5EVDA 1DD6A 5LCHA 3BK2A 3IELA 5ACVA 1A8TA 5FQCA 3I14A 4O98A 2CBNA 3BK1A 2BGAA 2M5DA 2OHJA 3IE0A 1ZNBA 4TZFA 1VGNA 4U4LA 3T3NA 4D1UA 5AHOA 5HIQA 2XF4A 2FU6A 1WUOA 3KL7A 5AXRA 1XTOA 4PVOA 5EV6A 3JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ4 A;  4LE6 A;  1DXK A;  5A0V A;  1K07 A;  4NQ6 A;  3BC2 A;  3SD9 A;  3ZWF A;  3I0V A;  2GKL A;  2Q42 A;  5EH9 A;  2NZE A;  3RPC A;  2WYM A;  1KR3 A;  2YNV A;  2BG8 A;  3KNR A;  2YZ3 A;  1MQO A;  1JT1 A;  5HH6 A;  1X8H A;  3MD7 A;  2WRS A;  4P62 A;  3AF5 A;  4Z67 A;  3WXC A;  2BFZ B;  1WW1 A;  4YSB A;  5LE1 A;  5A87 A;  2QED A;  4XUK A;  1X8G A;  4CHL A;  3BV6 A;  5LCF A;  4H0D A;  4ZO3 A;  3VQZ A;  2NZF A;  2Q0I A;  4EYL A;  4UAM A;  4AWY B;  3I15 A;  2I7V A;  1BC2 A;  4YSK A;  1WRA A;  3SW3 A;  5ACT A;  5K4M A;  2FHX B;  4BZ3 A;  5LMC A;  2ZO4 A;  3VPE A;  5B1U A;  1A7T A;  3AJ3 A;  5ACP A;  5B15 A;  2FU7 A;  4C1H A;  4GYQ A;  4EXS A;  3IDZ A;  3TP9 A;  2Y8B A;  3IOF A;  4RL0 A;  3T9M A;  2WYL A;  4YSL A;  3A4Y A;  4C09 A;  5K4N A;  4JO0 A;  5LCA A;  3P2U A;  5EVK A;  4F6H A;  4XWT A;  4DIK A;  5A0T A;  3IE2 A;  4ZO2 A;  4DIL A;  4RAM A;  2YNV B;  1YCF A;  1KO2 A;  2NXA A;  4PVT A;  2Y8A A;  2YNT B;  4TYF A;  2BR6 A;  4J5F A;  3ZR9 A;  3X2Y A;  5KIL A;  2BIB A;  4RBS A;  2GFJ A;  2BG7 A;  4C1G A;  2BG2 A;  4Z5Z A;  5LSC A;  4D1T A;  4D1W A;  2QJS A;  3IEM A;  4XWW A;  4EXY A;  2P4Z A;  3H3E A;  2VW8 A;  5HIS A;  4AD9 A;  4EY2 A;  2I7T A;  4UWP B;  4NQ2 A;  4AX0 B;  4ZNB A;  4TZB A;  1Y44 A;  5LM6 A;  3L6N A;  5DPX A;  1X8I A;  2BTN A;  4UWS B;  2M5C A;  5AYA A;  1VME A;  3IE1 A;  1E5D A;  1P9E A;  2GFK A;  2AIO A;  5ACX A;  4UA4 A;  3DHC A;  2P97 A;  3F9O A;  5LLD A;  1ZTC A;  4TZE A;  4GYU A;  1QH5 A;  5KIK A;  2YNU A;  3RKK A;  2YNW A;  4AWZ A;  3I13 A;  5B3R A;  1M2X A;  4HKY A;  3ESH A;  5ACW A;  4RAW A;  2BG8 B;  4TYT A;  2DKF A;  2Q0J A;  2ZZI A;  4FEK A;  4FSB A;  4V0H A;  3PY6 A;  3RKJ A;  3X2X A;  1SML A;  4D1V A;  2QIN A;  4RM5 A;  5K0W A;  3FAI A;  3QH8 A;  2BFK A;  1QH3 A;  4FR7 A;  4Z7R A;  2OHI A;  4F6Z A;  5LS3 A;  4TZ9 A;  4EYF A;  5A5Z A;  5EW0 A;  3SPU A;  5K4K A;  2FK6 A;  4NQ4 A;  2BC2 A;  1JJE A;  3PY5 A;  5ACS A;  3IOG A;  2OHH A;  3AF6 A;  2ZWR A;  3SRX A;  3X2Z A;  5AEB A;  4C1C A;  2YNT A;  4C1F A;  1VJN A;  3G1P A;  4C1D A;  3IEK A;  4UWR B;  4HL1 A;  2FHX A;  4EYB A;  1BMC A;  2HB9 A;  5HIO A;  3SFP A;  4AX1 B;  2Q9U A;  3X30 A;  5ACU A;  2XR1 A;  2QDS A;  4D02 A;  3S0Z A;  1YCH A;  2NYP A;  3PG4 A;  1YCG A;  3FCZ A;  5EV8 A;  4Z5Y A;  4BP0 A;  2P1E A;  1WUP A;  5EHT A;  3LVZ A;  3ADR A;  5EWA A;  4KEQ A;  2FU8 A;  2E7Y A;  3ZQ4 A;  2DOO A;  3DH8 A;  5AHR A;  1XM8 A;  2ZNB A;  5FQA A;  2QDT A;  2BFZ A;  5HH4 A;  4NQ5 A;  3KNS A;  3DHB A;  5ACR A;  4J5H A;  4Z6X A;  4B87 A;  4KEP A;  1BVT A;  1HLK A;  2A7M A;  2BMI A;  4ZEJ A;  3DHA A;  4C1E A;  2WYM C;  2YCB A;  4HL2 A;  5IQK A;  2FU9 A;  2UYX A;  4RL2 A;  2Y87 A;  5HIP A;  2WHG A;  2P18 A;  4UWO B;  2GCU A;  2R2D A;  4Z60 A;  4EFZ A;  2BFL A;  5AXO A;  3I11 A;  1KO3 A;  4WD6 A;  3R2U A;  4GCW A;  2H6A A;  1L9Y A;  2I7X A;  5EVB A;  3SBL A;  5FQB A;  3T3O A;  2GMN A;  3Q6V A;  1JJT A;  1DDK A;  3ZNB A;  1ZKP A;  5ACQ A;  2BG6 A;  5HH5 A;  4UBQ A;  2FM6 A;  5EVD A;  1DD6 A;  5LCH A;  3BK2 A;  3IEL A;  5ACV A;  1A8T A;  5FQC A;  3I14 A;  4O98 A;  2CBN A;  3BK1 A;  2BGA A;  2M5D A;  2OHJ A;  3IE0 A;  1ZNB A;  4TZF A;  1VGN A;  4U4L A;  3T3N A;  4D1U A;  5AHO A;  5HIQ A;  2XF4 A;  2FU6 A;  1WUO A;  3KL7 A;  5AXR A;  1XTO A;  4PVO A;  5EV6 A;  3JXP A; 
#chains in the Genus database with same CATH topology
 2AZ4 A;  4LE6 A;  1DXK A;  5A0V A;  1K07 A;  4NQ6 A;  3BC2 A;  3SD9 A;  3ZWF A;  3I0V A;  2GKL A;  2Q42 A;  5EH9 A;  2NZE A;  3RPC A;  2WYM A;  1KR3 A;  2YNV A;  2BG8 A;  3KNR A;  2YZ3 A;  1MQO A;  1JT1 A;  5HH6 A;  1X8H A;  3MD7 A;  2WRS A;  4P62 A;  3AF5 A;  4Z67 A;  3WXC A;  2BFZ B;  1WW1 A;  4YSB A;  5LE1 A;  5A87 A;  2QED A;  4XUK A;  1X8G A;  4CHL A;  3BV6 A;  2CFU A;  5LCF A;  4H0D A;  4ZO3 A;  3VQZ A;  2NZF A;  2Q0I A;  4EYL A;  4UAM A;  2YHE A;  4AWY B;  3I15 A;  2I7V A;  1BC2 A;  4YSK A;  1WRA A;  3SW3 A;  5ACT A;  5K4M A;  2FHX B;  4BZ3 A;  5LMC A;  2ZO4 A;  3VPE A;  5B1U A;  1A7T A;  3AJ3 A;  5ACP A;  5B15 A;  2FU7 A;  4C1H A;  4GYQ A;  4EXS A;  3IDZ A;  3TP9 A;  2Y8B A;  3IOF A;  4RL0 A;  3T9M A;  2WYL A;  4YSL A;  3A4Y A;  4C09 A;  5K4N A;  4JO0 A;  5LCA A;  3P2U A;  5EVK A;  4F6H A;  4XWT A;  4DIK A;  5A0T A;  3IE2 A;  4ZO2 A;  4DIL A;  4RAM A;  2YNV B;  1YCF A;  1KO2 A;  2NXA A;  4PVT A;  2Y8A A;  2YNT B;  4TYF A;  2BR6 A;  4AXH A;  4J5F A;  3ZR9 A;  3X2Y A;  5KIL A;  2BIB A;  4RBS A;  2GFJ A;  2BG7 A;  4C1G A;  2BG2 A;  4Z5Z A;  5LSC A;  4D1T A;  4D1W A;  2QJS A;  3IEM A;  4XWW A;  4EXY A;  2P4Z A;  3H3E A;  2VW8 A;  5AIJ A;  5HIS A;  4AD9 A;  4EY2 A;  2I7T A;  4UWP B;  4NQ2 A;  4AX0 B;  4ZNB A;  4TZB A;  1Y44 A;  5LM6 A;  3L6N A;  5DPX A;  1X8I A;  2BTN A;  4UWS B;  2M5C A;  5AYA A;  1VME A;  3IE1 A;  1E5D A;  1P9E A;  2GFK A;  4AV7 A;  2AIO A;  5ACX A;  4UA4 A;  3DHC A;  2P97 A;  3F9O A;  5LLD A;  1ZTC A;  4TZE A;  4GYU A;  1QH5 A;  5KIK A;  2YNU A;  4NUR A;  3RKK A;  2YNW A;  4AWZ A;  3I13 A;  5B3R A;  1M2X A;  4HKY A;  3ESH A;  5ACW A;  4RAW A;  2BG8 B;  4TYT A;  2DKF A;  2Q0J A;  2ZZI A;  4FEK A;  4FSB A;  4V0H A;  4PDX A;  3PY6 A;  3RKJ A;  3X2X A;  1SML A;  4D1V A;  2QIN A;  4RM5 A;  5K0W A;  3FAI A;  3QH8 A;  2BFK A;  1QH3 A;  4FR7 A;  4Z7R A;  2CG3 A;  2OHI A;  4F6Z A;  5LS3 A;  4TZ9 A;  4EYF A;  5A5Z A;  5EW0 A;  3SPU A;  5K4K A;  2FK6 A;  4NQ4 A;  2BC2 A;  1JJE A;  3PY5 A;  5ACS A;  3IOG A;  2OHH A;  3AF6 A;  2ZWR A;  3SRX A;  3X2Z A;  5AJL A;  5AEB A;  4C1C A;  2YNT A;  4C1F A;  1VJN A;  3G1P A;  4C1D A;  3IEK A;  4UWR B;  4HL1 A;  2FHX A;  4EYB A;  1BMC A;  2HB9 A;  5HIO A;  3SFP A;  4AX1 B;  2Q9U A;  3X30 A;  5ACU A;  2XR1 A;  2QDS A;  4D02 A;  3S0Z A;  1YCH A;  2NYP A;  3PG4 A;  1YCG A;  3FCZ A;  5EV8 A;  2CFZ A;  4Z5Y A;  4BP0 A;  2P1E A;  1WUP A;  5EHT A;  3LVZ A;  3ADR A;  5EWA A;  4KEQ A;  2FU8 A;  2E7Y A;  3ZQ4 A;  2DOO A;  3DH8 A;  5AHR A;  1XM8 A;  2ZNB A;  5FQA A;  2QDT A;  2BFZ A;  5HH4 A;  4NQ5 A;  3KNS A;  3DHB A;  5ACR A;  4J5H A;  4Z6X A;  4B87 A;  4KEP A;  1BVT A;  1HLK A;  2A7M A;  2BMI A;  4ZEJ A;  3DHA A;  4C1E A;  2WYM C;  2YCB A;  4HL2 A;  5IQK A;  2FU9 A;  2UYX A;  4RL2 A;  2Y87 A;  5HIP A;  2WHG A;  2P18 A;  4UWO B;  2GCU A;  2R2D A;  4Z60 A;  2CG2 A;  4EFZ A;  2BFL A;  5AXO A;  3I11 A;  1KO3 A;  4WD6 A;  3R2U A;  4GCW A;  2H6A A;  1L9Y A;  2I7X A;  5EVB A;  3SBL A;  5FQB A;  3T3O A;  2GMN A;  3Q6V A;  1JJT A;  1DDK A;  3ZNB A;  1ZKP A;  5ACQ A;  2BG6 A;  5HH5 A;  4UBQ A;  2FM6 A;  5EVD A;  1DD6 A;  5LCH A;  3BK2 A;  3IEL A;  5ACV A;  1A8T A;  5FQC A;  3I14 A;  4O98 A;  5A23 A;  2CBN A;  3BK1 A;  2BGA A;  2M5D A;  2OHJ A;  3IE0 A;  1ZNB A;  4TZF A;  1VGN A;  4U4L A;  3T3N A;  4D1U A;  5AHO A;  5HIQ A;  2XF4 A;  2FU6 A;  1WUO A;  3KL7 A;  5AXR A;  1XTO A;  4PVO A;  5EV6 A;  3JXP A; 
#chains in the Genus database with same CATH homology
 2AZ4 A;  4LE6 A;  1DXK A;  5A0V A;  1K07 A;  4NQ6 A;  3BC2 A;  3SD9 A;  3ZWF A;  3I0V A;  2GKL A;  2Q42 A;  5EH9 A;  2NZE A;  3RPC A;  2WYM A;  1KR3 A;  2YNV A;  2BG8 A;  3KNR A;  2YZ3 A;  1MQO A;  1JT1 A;  5HH6 A;  1X8H A;  3MD7 A;  2WRS A;  4P62 A;  3AF5 A;  4Z67 A;  3WXC A;  2BFZ B;  1WW1 A;  4YSB A;  5LE1 A;  5A87 A;  2QED A;  4XUK A;  1X8G A;  4CHL A;  3BV6 A;  5LCF A;  4H0D A;  4ZO3 A;  3VQZ A;  2NZF A;  2Q0I A;  4EYL A;  4UAM A;  4AWY B;  3I15 A;  2I7V A;  1BC2 A;  4YSK A;  1WRA A;  3SW3 A;  5ACT A;  5K4M A;  2FHX B;  4BZ3 A;  5LMC A;  2ZO4 A;  3VPE A;  5B1U A;  1A7T A;  3AJ3 A;  5ACP A;  5B15 A;  2FU7 A;  4C1H A;  4GYQ A;  4EXS A;  3IDZ A;  3TP9 A;  2Y8B A;  3IOF A;  4RL0 A;  3T9M A;  2WYL A;  4YSL A;  3A4Y A;  4C09 A;  5K4N A;  4JO0 A;  5LCA A;  3P2U A;  5EVK A;  4F6H A;  4XWT A;  4DIK A;  5A0T A;  3IE2 A;  4ZO2 A;  4DIL A;  4RAM A;  2YNV B;  1YCF A;  1KO2 A;  2NXA A;  4PVT A;  2Y8A A;  2YNT B;  4TYF A;  2BR6 A;  4J5F A;  3ZR9 A;  3X2Y A;  5KIL A;  2BIB A;  4RBS A;  2GFJ A;  2BG7 A;  4C1G A;  2BG2 A;  4Z5Z A;  5LSC A;  4D1T A;  4D1W A;  2QJS A;  3IEM A;  4XWW A;  4EXY A;  2P4Z A;  3H3E A;  2VW8 A;  5HIS A;  4AD9 A;  4EY2 A;  2I7T A;  4UWP B;  4NQ2 A;  4AX0 B;  4ZNB A;  4TZB A;  1Y44 A;  5LM6 A;  3L6N A;  5DPX A;  1X8I A;  2BTN A;  4UWS B;  2M5C A;  5AYA A;  1VME A;  3IE1 A;  1E5D A;  1P9E A;  2GFK A;  2AIO A;  5ACX A;  4UA4 A;  3DHC A;  2P97 A;  3F9O A;  5LLD A;  1ZTC A;  4TZE A;  4GYU A;  1QH5 A;  5KIK A;  2YNU A;  3RKK A;  2YNW A;  4AWZ A;  3I13 A;  5B3R A;  1M2X A;  4HKY A;  3ESH A;  5ACW A;  4RAW A;  2BG8 B;  4TYT A;  2DKF A;  2Q0J A;  2ZZI A;  4FEK A;  4FSB A;  4V0H A;  3PY6 A;  3RKJ A;  3X2X A;  1SML A;  4D1V A;  2QIN A;  4RM5 A;  5K0W A;  3FAI A;  3QH8 A;  2BFK A;  1QH3 A;  4FR7 A;  4Z7R A;  2OHI A;  4F6Z A;  5LS3 A;  4TZ9 A;  4EYF A;  5A5Z A;  5EW0 A;  3SPU A;  5K4K A;  2FK6 A;  4NQ4 A;  2BC2 A;  1JJE A;  3PY5 A;  5ACS A;  3IOG A;  2OHH A;  3AF6 A;  2ZWR A;  3SRX A;  3X2Z A;  5AEB A;  4C1C A;  2YNT A;  4C1F A;  1VJN A;  3G1P A;  4C1D A;  3IEK A;  4UWR B;  4HL1 A;  2FHX A;  4EYB A;  1BMC A;  2HB9 A;  5HIO A;  3SFP A;  4AX1 B;  2Q9U A;  3X30 A;  5ACU A;  2XR1 A;  2QDS A;  4D02 A;  3S0Z A;  1YCH A;  2NYP A;  3PG4 A;  1YCG A;  3FCZ A;  5EV8 A;  4Z5Y A;  4BP0 A;  2P1E A;  1WUP A;  5EHT A;  3LVZ A;  3ADR A;  5EWA A;  4KEQ A;  2FU8 A;  2E7Y A;  3ZQ4 A;  2DOO A;  3DH8 A;  5AHR A;  1XM8 A;  2ZNB A;  5FQA A;  2QDT A;  2BFZ A;  5HH4 A;  4NQ5 A;  3KNS A;  3DHB A;  5ACR A;  4J5H A;  4Z6X A;  4B87 A;  4KEP A;  1BVT A;  1HLK A;  2A7M A;  2BMI A;  4ZEJ A;  3DHA A;  4C1E A;  2WYM C;  2YCB A;  4HL2 A;  5IQK A;  2FU9 A;  2UYX A;  4RL2 A;  2Y87 A;  5HIP A;  2WHG A;  2P18 A;  4UWO B;  2GCU A;  2R2D A;  4Z60 A;  4EFZ A;  2BFL A;  5AXO A;  3I11 A;  1KO3 A;  4WD6 A;  3R2U A;  4GCW A;  2H6A A;  1L9Y A;  2I7X A;  5EVB A;  3SBL A;  5FQB A;  3T3O A;  2GMN A;  3Q6V A;  1JJT A;  1DDK A;  3ZNB A;  1ZKP A;  5ACQ A;  2BG6 A;  5HH5 A;  4UBQ A;  2FM6 A;  5EVD A;  1DD6 A;  5LCH A;  3BK2 A;  3IEL A;  5ACV A;  1A8T A;  5FQC A;  3I14 A;  4O98 A;  2CBN A;  3BK1 A;  2BGA A;  2M5D A;  2OHJ A;  3IE0 A;  1ZNB A;  4TZF A;  1VGN A;  4U4L A;  3T3N A;  4D1U A;  5AHO A;  5HIQ A;  2XF4 A;  2FU6 A;  1WUO A;  3KL7 A;  5AXR A;  1XTO A;  4PVO A;  5EV6 A;  3JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...