5B3RA

Crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
214
Chain Sequence
LPDLKIEKLEKGVYVHTSFEGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of Metallo-beta-Lactamase IMP-18
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords IMP-18
total genus 69
structure length 214
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b3rA00
3TP9A 2QDSA 1MQOA 4D1TA 4HL2A 3PY6A 4Z5ZA 2GFKA 2YNVA 5LLDA 2NYPA 1ZNBA 5HISA 1XTOA 4P62A 5EVDA 2YNWA 5LSCA 5LCHA 5ACUA 4YSKA 3BK1A 2FU8A 4C1DA 2FK6A 2Y87A 2BG8A 2I7XA 3SBLA 3IE2A 4C1GA 5AHOA 5HH4A 4EYBA 5AYAA 3AJ3A 3RPCA 1X8IA 4UWOB 2GFJA 1WUPA 5HIPA 5EH9A 2OHHA 1P9EA 4Z7RA 3H3EA 2NZEA 3ZR9A 2ZO4A 3RKJA 2ZZIA 5FQBA 3L6NA 4C1HA 3IE1A 2WHGA 3ZWFA 4HKYA 4NQ6A 1DD6A 2P97A 1KO2A 4Z6XA 1YCFA 4UAMA 4AD9A 5A5ZA 1E5DA 1JJEA 4DILA 3SFPA 4EXYA 2FU6A 3DHBA 5LM6A 4TZFA 3SRXA 3X2YA 4B87A 2Y8AA 3ESHA 5AXOA 4C1FA 1A7TA 5HH6A 4J5HA 5EVBA 5B1UA 4U4LA 3R2UA 4J5FA 3LVZA 4O98A 3AF6A 1X8HA 2XR1A 3FAIA 5AHRA 2BC2A 2P18A 2YNTB 2WYMC 4ZO3A 2I7VA 1JJTA 2YCBA 3FCZA 5K4MA 4JO0A 1VMEA 1DXKA 4UBQA 5ACSA 2CBNA 2BR6A 5EW0A 2UYXA 5DPXA 1VJNA 2QINA 3X30A 2VW8A 5ACXA 4D1VA 4TZBA 3KL7A 5EWAA 2BTNA 1QH3A 4YSLA 2Y8BA 4LE6A 2YNTA 2FHXA 1K07A 3DHAA 5ACPA 2BG7A 3PY5A 4ZO2A 4EXSA 3DH8A 3IELA 5KIKA 3ZQ4A 5EHTA 4TYTA 3PG4A 1Y44A 1WW1A 2YNUA 2BFZA 3I15A 2OHJA 2Q0IA 5HIOA 4EYFA 1YCHA 1KO3A 4UWSB 5EV6A 1ZTCA 1KR3A 4D02A 4H0DA 2XF4A 5KILA 4TYFA 2DKFA 2BG6A 4C1EA 4RL2A 1BMCA 2M5CA 5B3RA 2FU9A 4HL1A 1HLKA 1L9YA 4D1UA 3T3NA 5K4NA 2P1EA 1X8GA 4XUKA 2I7TA 1QH5A 5B15A 5K4KA 4NQ5A 4F6HA 4DIKA 5ACVA 2BIBA 2E7YA 5HH5A 2FU7A 3BV6A 4CHLA 2QDTA 4PVTA 4XWWA 3SPUA 2ZNBA 3G1PA 4RBSA 2BG8B 1DDKA 2YZ3A 2HB9A 5ACQA 5AXRA 4KEPA 4AX0B 3IEKA 4ZNBA 4UWPB 4YSBA 5A87A 1SMLA 3I11A 3ZNBA 5K0WA 5LE1A 3A4YA 4GYQA 4EFZA 2P4ZA 4GYUA 2OHIA 2YNVB 4FSBA 5A0TA 5LS3A 1ZKPA 4BZ3A 1BC2A 3JXPA 5LCAA 5AEBA 3T3OA 2WYLA 3I0VA 2Q42A 4ZEJA 3S0ZA 4EY2A 5ACTA 1WRAA 3KNRA 2GCUA 2DOOA 2NZFA 5FQAA 2BGAA 4NQ4A 3I14A 4WD6A 3KNSA 3X2XA 2R2DA 2BFLA 2BFZB 4Z60A 3MD7A 4FR7A 4AWYB 5IQKA 3P2UA 4C09A 2BFKA 2WYMA 5EV8A 4TZ9A 2NXAA 3F9OA 3SD9A 3QH8A 3SW3A 2AZ4A 4RL0A 3VQZA 4Z67A 5FQCA 2BMIA 2GMNA 3X2ZA 3IOGA 2Q9UA 4UWRB 1VGNA 5ACRA 4BP0A 2GKLA 1JT1A 2WRSA 4F6ZA 4Z5YA 4AWZA 1WUOA 4V0HA 4RM5A 3ADRA 4XWTA 2H6AA 1YCGA 3IEMA 4FEKA 2FHXB 4GCWA 2AIOA 3I13A 4RAMA 1M2XA 5ACWA 3VPEA 4KEQA 5HIQA 4NQ2A 2QJSA 3IDZA 2A7MA 3Q6VA 3BK2A 4EYLA 3RKKA 5A0VA 1XM8A 1A8TA 4RAWA 2M5DA 4UA4A 5LMCA 2ZWRA 3WXCA 3AF5A 2QEDA 3DHCA 3BC2A 2FM6A 3T9MA 5LCFA 4AX1B 4TZEA 2BG2A 3IE0A 4PVOA 4C1CA 2Q0JA 3IOFA 5EVKA 1BVTA 4D1WA
chains in the Genus database with same CATH superfamily
3TP9A 2QDSA 1MQOA 4D1TA 4HL2A 3PY6A 4Z5ZA 2GFKA 2YNVA 5LLDA 2NYPA 1ZNBA 5HISA 1XTOA 4P62A 5EVDA 2YNWA 5LSCA 5LCHA 5ACUA 4YSKA 3BK1A 2FU8A 4C1DA 2FK6A 2Y87A 2BG8A 2I7XA 3SBLA 3IE2A 4C1GA 5AHOA 5HH4A 4EYBA 5AYAA 3AJ3A 3RPCA 1X8IA 4UWOB 2GFJA 1WUPA 5HIPA 5EH9A 2OHHA 1P9EA 4Z7RA 3H3EA 2NZEA 3ZR9A 2ZO4A 3RKJA 2ZZIA 5FQBA 3L6NA 4C1HA 3IE1A 2WHGA 3ZWFA 4HKYA 4NQ6A 1DD6A 2P97A 1KO2A 4Z6XA 1YCFA 4UAMA 4AD9A 5A5ZA 1E5DA 1JJEA 4DILA 3SFPA 4NURA 4EXYA 2FU6A 3DHBA 5LM6A 4TZFA 5A23A 3SRXA 3X2YA 4B87A 2Y8AA 3ESHA 5AXOA 4C1FA 1A7TA 5HH6A 4J5HA 5EVBA 5B1UA 4U4LA 3R2UA 4J5FA 3LVZA 4O98A 2CFUA 3AF6A 1X8HA 2XR1A 3FAIA 5AHRA 2BC2A 2P18A 2YNTB 2WYMC 4ZO3A 2I7VA 1JJTA 2YCBA 3FCZA 5K4MA 4JO0A 1VMEA 1DXKA 4UBQA 5ACSA 2CBNA 2BR6A 5EW0A 2UYXA 5DPXA 1VJNA 2QINA 3X30A 2VW8A 5ACXA 4D1VA 4TZBA 3KL7A 5EWAA 2BTNA 1QH3A 4YSLA 2Y8BA 4LE6A 2YNTA 2FHXA 1K07A 3DHAA 5ACPA 4AXHA 2BG7A 3PY5A 4ZO2A 4EXSA 3DH8A 3IELA 5KIKA 3ZQ4A 5EHTA 4TYTA 3PG4A 1Y44A 1WW1A 2YNUA 2BFZA 3I15A 2OHJA 2Q0IA 5HIOA 4EYFA 1YCHA 1KO3A 4UWSB 5EV6A 1ZTCA 1KR3A 4D02A 4H0DA 2XF4A 5KILA 4TYFA 2DKFA 2BG6A 4C1EA 4RL2A 1BMCA 2M5CA 5B3RA 2FU9A 4HL1A 1HLKA 1L9YA 4D1UA 3T3NA 5K4NA 2P1EA 1X8GA 4XUKA 2I7TA 1QH5A 5B15A 5K4KA 4NQ5A 4F6HA 4DIKA 5ACVA 2BIBA 2E7YA 5HH5A 2FU7A 3BV6A 4CHLA 2QDTA 4PVTA 2YHEA 4XWWA 3SPUA 5AIJA 2ZNBA 3G1PA 4RBSA 2BG8B 1DDKA 2YZ3A 2HB9A 5ACQA 5AXRA 4KEPA 4AX0B 3IEKA 4ZNBA 4UWPB 4YSBA 5A87A 4PDXA 1SMLA 3I11A 3ZNBA 5K0WA 5LE1A 3A4YA 4GYQA 4EFZA 2P4ZA 4GYUA 2OHIA 2YNVB 4FSBA 5A0TA 5LS3A 1ZKPA 4BZ3A 1BC2A 3JXPA 5LCAA 5AEBA 3T3OA 2WYLA 3I0VA 2Q42A 4ZEJA 3S0ZA 4EY2A 5ACTA 1WRAA 3KNRA 2GCUA 2DOOA 2NZFA 5FQAA 5AJLA 4AV7A 2BGAA 4NQ4A 3I14A 4WD6A 3KNSA 3X2XA 2R2DA 2BFLA 2BFZB 4Z60A 3MD7A 4FR7A 4AWYB 5IQKA 3P2UA 4C09A 2BFKA 2WYMA 5EV8A 4TZ9A 2NXAA 3F9OA 3SD9A 3QH8A 3SW3A 2AZ4A 4RL0A 3VQZA 4Z67A 5FQCA 2BMIA 2GMNA 3X2ZA 3IOGA 2Q9UA 4UWRB 1VGNA 5ACRA 4BP0A 2GKLA 1JT1A 2WRSA 4F6ZA 4Z5YA 4AWZA 1WUOA 4V0HA 4RM5A 3ADRA 4XWTA 2H6AA 1YCGA 3IEMA 4FEKA 2FHXB 4GCWA 2AIOA 3I13A 4RAMA 1M2XA 5ACWA 3VPEA 4KEQA 5HIQA 4NQ2A 2QJSA 3IDZA 2A7MA 3Q6VA 2CG2A 3BK2A 4EYLA 3RKKA 5A0VA 1XM8A 2CFZA 1A8TA 4RAWA 2M5DA 4UA4A 5LMCA 2ZWRA 3WXCA 3AF5A 2QEDA 3DHCA 3BC2A 2FM6A 3T9MA 5LCFA 4AX1B 4TZEA 2BG2A 3IE0A 4PVOA 4C1CA 2Q0JA 3IOFA 5EVKA 1BVTA 2CG3A 4D1WA
chains in the Genus database with same CATH topology
3TP9A 2QDSA 1MQOA 4D1TA 4HL2A 3PY6A 4Z5ZA 2GFKA 2YNVA 5LLDA 2NYPA 1ZNBA 5HISA 1XTOA 4P62A 5EVDA 2YNWA 5LSCA 5LCHA 5ACUA 4YSKA 3BK1A 2FU8A 4C1DA 2FK6A 2Y87A 2BG8A 2I7XA 3SBLA 3IE2A 4C1GA 5AHOA 5HH4A 4EYBA 5AYAA 3AJ3A 3RPCA 1X8IA 4UWOB 2GFJA 1WUPA 5HIPA 5EH9A 2OHHA 1P9EA 4Z7RA 3H3EA 2NZEA 3ZR9A 2ZO4A 3RKJA 2ZZIA 5FQBA 3L6NA 4C1HA 3IE1A 2WHGA 3ZWFA 4HKYA 4NQ6A 1DD6A 2P97A 1KO2A 4Z6XA 1YCFA 4UAMA 4AD9A 5A5ZA 1E5DA 1JJEA 4DILA 3SFPA 4EXYA 2FU6A 3DHBA 5LM6A 4TZFA 3SRXA 3X2YA 4B87A 2Y8AA 3ESHA 5AXOA 4C1FA 1A7TA 5HH6A 4J5HA 5EVBA 5B1UA 4U4LA 3R2UA 4J5FA 3LVZA 4O98A 3AF6A 1X8HA 2XR1A 3FAIA 5AHRA 2BC2A 2P18A 2YNTB 2WYMC 4ZO3A 2I7VA 1JJTA 2YCBA 3FCZA 5K4MA 4JO0A 1VMEA 1DXKA 4UBQA 5ACSA 2CBNA 2BR6A 5EW0A 2UYXA 5DPXA 1VJNA 2QINA 3X30A 2VW8A 5ACXA 4D1VA 4TZBA 3KL7A 5EWAA 2BTNA 1QH3A 4YSLA 2Y8BA 4LE6A 2YNTA 2FHXA 1K07A 3DHAA 5ACPA 2BG7A 3PY5A 4ZO2A 4EXSA 3DH8A 3IELA 5KIKA 3ZQ4A 5EHTA 4TYTA 3PG4A 1Y44A 1WW1A 2YNUA 2BFZA 3I15A 2OHJA 2Q0IA 5HIOA 4EYFA 1YCHA 1KO3A 4UWSB 5EV6A 1ZTCA 1KR3A 4D02A 4H0DA 2XF4A 5KILA 4TYFA 2DKFA 2BG6A 4C1EA 4RL2A 1BMCA 2M5CA 5B3RA 2FU9A 4HL1A 1HLKA 1L9YA 4D1UA 3T3NA 5K4NA 2P1EA 1X8GA 4XUKA 2I7TA 1QH5A 5B15A 5K4KA 4NQ5A 4F6HA 4DIKA 5ACVA 2BIBA 2E7YA 5HH5A 2FU7A 3BV6A 4CHLA 2QDTA 4PVTA 4XWWA 3SPUA 2ZNBA 3G1PA 4RBSA 2BG8B 1DDKA 2YZ3A 2HB9A 5ACQA 5AXRA 4KEPA 4AX0B 3IEKA 4ZNBA 4UWPB 4YSBA 5A87A 1SMLA 3I11A 3ZNBA 5K0WA 5LE1A 3A4YA 4GYQA 4EFZA 2P4ZA 4GYUA 2OHIA 2YNVB 4FSBA 5A0TA 5LS3A 1ZKPA 4BZ3A 1BC2A 3JXPA 5LCAA 5AEBA 3T3OA 2WYLA 3I0VA 2Q42A 4ZEJA 3S0ZA 4EY2A 5ACTA 1WRAA 3KNRA 2GCUA 2DOOA 2NZFA 5FQAA 2BGAA 4NQ4A 3I14A 4WD6A 3KNSA 3X2XA 2R2DA 2BFLA 2BFZB 4Z60A 3MD7A 4FR7A 4AWYB 5IQKA 3P2UA 4C09A 2BFKA 2WYMA 5EV8A 4TZ9A 2NXAA 3F9OA 3SD9A 3QH8A 3SW3A 2AZ4A 4RL0A 3VQZA 4Z67A 5FQCA 2BMIA 2GMNA 3X2ZA 3IOGA 2Q9UA 4UWRB 1VGNA 5ACRA 4BP0A 2GKLA 1JT1A 2WRSA 4F6ZA 4Z5YA 4AWZA 1WUOA 4V0HA 4RM5A 3ADRA 4XWTA 2H6AA 1YCGA 3IEMA 4FEKA 2FHXB 4GCWA 2AIOA 3I13A 4RAMA 1M2XA 5ACWA 3VPEA 4KEQA 5HIQA 4NQ2A 2QJSA 3IDZA 2A7MA 3Q6VA 3BK2A 4EYLA 3RKKA 5A0VA 1XM8A 1A8TA 4RAWA 2M5DA 4UA4A 5LMCA 2ZWRA 3WXCA 3AF5A 2QEDA 3DHCA 3BC2A 2FM6A 3T9MA 5LCFA 4AX1B 4TZEA 2BG2A 3IE0A 4PVOA 4C1CA 2Q0JA 3IOFA 5EVKA 1BVTA 4D1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP9 A;  2QDS A;  1MQO A;  4D1T A;  4HL2 A;  3PY6 A;  4Z5Z A;  2GFK A;  2YNV A;  5LLD A;  2NYP A;  1ZNB A;  5HIS A;  1XTO A;  4P62 A;  5EVD A;  2YNW A;  5LSC A;  5LCH A;  5ACU A;  4YSK A;  3BK1 A;  2FU8 A;  4C1D A;  2FK6 A;  2Y87 A;  2BG8 A;  2I7X A;  3SBL A;  3IE2 A;  4C1G A;  5AHO A;  5HH4 A;  4EYB A;  5AYA A;  3AJ3 A;  3RPC A;  1X8I A;  4UWO B;  2GFJ A;  1WUP A;  5HIP A;  5EH9 A;  2OHH A;  1P9E A;  4Z7R A;  3H3E A;  2NZE A;  3ZR9 A;  2ZO4 A;  3RKJ A;  2ZZI A;  5FQB A;  3L6N A;  4C1H A;  3IE1 A;  2WHG A;  3ZWF A;  4HKY A;  4NQ6 A;  1DD6 A;  2P97 A;  1KO2 A;  4Z6X A;  1YCF A;  4UAM A;  4AD9 A;  5A5Z A;  1E5D A;  1JJE A;  4DIL A;  3SFP A;  4EXY A;  2FU6 A;  3DHB A;  5LM6 A;  4TZF A;  3SRX A;  3X2Y A;  4B87 A;  2Y8A A;  3ESH A;  5AXO A;  4C1F A;  1A7T A;  5HH6 A;  4J5H A;  5EVB A;  5B1U A;  4U4L A;  3R2U A;  4J5F A;  3LVZ A;  4O98 A;  3AF6 A;  1X8H A;  2XR1 A;  3FAI A;  5AHR A;  2BC2 A;  2P18 A;  2YNT B;  2WYM C;  4ZO3 A;  2I7V A;  1JJT A;  2YCB A;  3FCZ A;  5K4M A;  4JO0 A;  1VME A;  1DXK A;  4UBQ A;  5ACS A;  2CBN A;  2BR6 A;  5EW0 A;  2UYX A;  5DPX A;  1VJN A;  2QIN A;  3X30 A;  2VW8 A;  5ACX A;  4D1V A;  4TZB A;  3KL7 A;  5EWA A;  2BTN A;  1QH3 A;  4YSL A;  2Y8B A;  4LE6 A;  2YNT A;  2FHX A;  1K07 A;  3DHA A;  5ACP A;  2BG7 A;  3PY5 A;  4ZO2 A;  4EXS A;  3DH8 A;  3IEL A;  5KIK A;  3ZQ4 A;  5EHT A;  4TYT A;  3PG4 A;  1Y44 A;  1WW1 A;  2YNU A;  2BFZ A;  3I15 A;  2OHJ A;  2Q0I A;  5HIO A;  4EYF A;  1YCH A;  1KO3 A;  4UWS B;  5EV6 A;  1ZTC A;  1KR3 A;  4D02 A;  4H0D A;  2XF4 A;  5KIL A;  4TYF A;  2DKF A;  2BG6 A;  4C1E A;  4RL2 A;  1BMC A;  2M5C A;  5B3R A;  2FU9 A;  4HL1 A;  1HLK A;  1L9Y A;  4D1U A;  3T3N A;  5K4N A;  2P1E A;  1X8G A;  4XUK A;  2I7T A;  1QH5 A;  5B15 A;  5K4K A;  4NQ5 A;  4F6H A;  4DIK A;  5ACV A;  2BIB A;  2E7Y A;  5HH5 A;  2FU7 A;  3BV6 A;  4CHL A;  2QDT A;  4PVT A;  4XWW A;  3SPU A;  2ZNB A;  3G1P A;  4RBS A;  2BG8 B;  1DDK A;  2YZ3 A;  2HB9 A;  5ACQ A;  5AXR A;  4KEP A;  4AX0 B;  3IEK A;  4ZNB A;  4UWP B;  4YSB A;  5A87 A;  1SML A;  3I11 A;  3ZNB A;  5K0W A;  5LE1 A;  3A4Y A;  4GYQ A;  4EFZ A;  2P4Z A;  4GYU A;  2OHI A;  2YNV B;  4FSB A;  5A0T A;  5LS3 A;  1ZKP A;  4BZ3 A;  1BC2 A;  3JXP A;  5LCA A;  5AEB A;  3T3O A;  2WYL A;  3I0V A;  2Q42 A;  4ZEJ A;  3S0Z A;  4EY2 A;  5ACT A;  1WRA A;  3KNR A;  2GCU A;  2DOO A;  2NZF A;  5FQA A;  2BGA A;  4NQ4 A;  3I14 A;  4WD6 A;  3KNS A;  3X2X A;  2R2D A;  2BFL A;  2BFZ B;  4Z60 A;  3MD7 A;  4FR7 A;  4AWY B;  5IQK A;  3P2U A;  4C09 A;  2BFK A;  2WYM A;  5EV8 A;  4TZ9 A;  2NXA A;  3F9O A;  3SD9 A;  3QH8 A;  3SW3 A;  2AZ4 A;  4RL0 A;  3VQZ A;  4Z67 A;  5FQC A;  2BMI A;  2GMN A;  3X2Z A;  3IOG A;  2Q9U A;  4UWR B;  1VGN A;  5ACR A;  4BP0 A;  2GKL A;  1JT1 A;  2WRS A;  4F6Z A;  4Z5Y A;  4AWZ A;  1WUO A;  4V0H A;  4RM5 A;  3ADR A;  4XWT A;  2H6A A;  1YCG A;  3IEM A;  4FEK A;  2FHX B;  4GCW A;  2AIO A;  3I13 A;  4RAM A;  1M2X A;  5ACW A;  3VPE A;  4KEQ A;  5HIQ A;  4NQ2 A;  2QJS A;  3IDZ A;  2A7M A;  3Q6V A;  3BK2 A;  4EYL A;  3RKK A;  5A0V A;  1XM8 A;  1A8T A;  4RAW A;  2M5D A;  4UA4 A;  5LMC A;  2ZWR A;  3WXC A;  3AF5 A;  2QED A;  3DHC A;  3BC2 A;  2FM6 A;  3T9M A;  5LCF A;  4AX1 B;  4TZE A;  2BG2 A;  3IE0 A;  4PVO A;  4C1C A;  2Q0J A;  3IOF A;  5EVK A;  1BVT A;  4D1W A; 
#chains in the Genus database with same CATH topology
 3TP9 A;  2QDS A;  1MQO A;  4D1T A;  4HL2 A;  3PY6 A;  4Z5Z A;  2GFK A;  2YNV A;  5LLD A;  2NYP A;  1ZNB A;  5HIS A;  1XTO A;  4P62 A;  5EVD A;  2YNW A;  5LSC A;  5LCH A;  5ACU A;  4YSK A;  3BK1 A;  2FU8 A;  4C1D A;  2FK6 A;  2Y87 A;  2BG8 A;  2I7X A;  3SBL A;  3IE2 A;  4C1G A;  5AHO A;  5HH4 A;  4EYB A;  5AYA A;  3AJ3 A;  3RPC A;  1X8I A;  4UWO B;  2GFJ A;  1WUP A;  5HIP A;  5EH9 A;  2OHH A;  1P9E A;  4Z7R A;  3H3E A;  2NZE A;  3ZR9 A;  2ZO4 A;  3RKJ A;  2ZZI A;  5FQB A;  3L6N A;  4C1H A;  3IE1 A;  2WHG A;  3ZWF A;  4HKY A;  4NQ6 A;  1DD6 A;  2P97 A;  1KO2 A;  4Z6X A;  1YCF A;  4UAM A;  4AD9 A;  5A5Z A;  1E5D A;  1JJE A;  4DIL A;  3SFP A;  4NUR A;  4EXY A;  2FU6 A;  3DHB A;  5LM6 A;  4TZF A;  5A23 A;  3SRX A;  3X2Y A;  4B87 A;  2Y8A A;  3ESH A;  5AXO A;  4C1F A;  1A7T A;  5HH6 A;  4J5H A;  5EVB A;  5B1U A;  4U4L A;  3R2U A;  4J5F A;  3LVZ A;  4O98 A;  2CFU A;  3AF6 A;  1X8H A;  2XR1 A;  3FAI A;  5AHR A;  2BC2 A;  2P18 A;  2YNT B;  2WYM C;  4ZO3 A;  2I7V A;  1JJT A;  2YCB A;  3FCZ A;  5K4M A;  4JO0 A;  1VME A;  1DXK A;  4UBQ A;  5ACS A;  2CBN A;  2BR6 A;  5EW0 A;  2UYX A;  5DPX A;  1VJN A;  2QIN A;  3X30 A;  2VW8 A;  5ACX A;  4D1V A;  4TZB A;  3KL7 A;  5EWA A;  2BTN A;  1QH3 A;  4YSL A;  2Y8B A;  4LE6 A;  2YNT A;  2FHX A;  1K07 A;  3DHA A;  5ACP A;  4AXH A;  2BG7 A;  3PY5 A;  4ZO2 A;  4EXS A;  3DH8 A;  3IEL A;  5KIK A;  3ZQ4 A;  5EHT A;  4TYT A;  3PG4 A;  1Y44 A;  1WW1 A;  2YNU A;  2BFZ A;  3I15 A;  2OHJ A;  2Q0I A;  5HIO A;  4EYF A;  1YCH A;  1KO3 A;  4UWS B;  5EV6 A;  1ZTC A;  1KR3 A;  4D02 A;  4H0D A;  2XF4 A;  5KIL A;  4TYF A;  2DKF A;  2BG6 A;  4C1E A;  4RL2 A;  1BMC A;  2M5C A;  5B3R A;  2FU9 A;  4HL1 A;  1HLK A;  1L9Y A;  4D1U A;  3T3N A;  5K4N A;  2P1E A;  1X8G A;  4XUK A;  2I7T A;  1QH5 A;  5B15 A;  5K4K A;  4NQ5 A;  4F6H A;  4DIK A;  5ACV A;  2BIB A;  2E7Y A;  5HH5 A;  2FU7 A;  3BV6 A;  4CHL A;  2QDT A;  4PVT A;  2YHE A;  4XWW A;  3SPU A;  5AIJ A;  2ZNB A;  3G1P A;  4RBS A;  2BG8 B;  1DDK A;  2YZ3 A;  2HB9 A;  5ACQ A;  5AXR A;  4KEP A;  4AX0 B;  3IEK A;  4ZNB A;  4UWP B;  4YSB A;  5A87 A;  4PDX A;  1SML A;  3I11 A;  3ZNB A;  5K0W A;  5LE1 A;  3A4Y A;  4GYQ A;  4EFZ A;  2P4Z A;  4GYU A;  2OHI A;  2YNV B;  4FSB A;  5A0T A;  5LS3 A;  1ZKP A;  4BZ3 A;  1BC2 A;  3JXP A;  5LCA A;  5AEB A;  3T3O A;  2WYL A;  3I0V A;  2Q42 A;  4ZEJ A;  3S0Z A;  4EY2 A;  5ACT A;  1WRA A;  3KNR A;  2GCU A;  2DOO A;  2NZF A;  5FQA A;  5AJL A;  4AV7 A;  2BGA A;  4NQ4 A;  3I14 A;  4WD6 A;  3KNS A;  3X2X A;  2R2D A;  2BFL A;  2BFZ B;  4Z60 A;  3MD7 A;  4FR7 A;  4AWY B;  5IQK A;  3P2U A;  4C09 A;  2BFK A;  2WYM A;  5EV8 A;  4TZ9 A;  2NXA A;  3F9O A;  3SD9 A;  3QH8 A;  3SW3 A;  2AZ4 A;  4RL0 A;  3VQZ A;  4Z67 A;  5FQC A;  2BMI A;  2GMN A;  3X2Z A;  3IOG A;  2Q9U A;  4UWR B;  1VGN A;  5ACR A;  4BP0 A;  2GKL A;  1JT1 A;  2WRS A;  4F6Z A;  4Z5Y A;  4AWZ A;  1WUO A;  4V0H A;  4RM5 A;  3ADR A;  4XWT A;  2H6A A;  1YCG A;  3IEM A;  4FEK A;  2FHX B;  4GCW A;  2AIO A;  3I13 A;  4RAM A;  1M2X A;  5ACW A;  3VPE A;  4KEQ A;  5HIQ A;  4NQ2 A;  2QJS A;  3IDZ A;  2A7M A;  3Q6V A;  2CG2 A;  3BK2 A;  4EYL A;  3RKK A;  5A0V A;  1XM8 A;  2CFZ A;  1A8T A;  4RAW A;  2M5D A;  4UA4 A;  5LMC A;  2ZWR A;  3WXC A;  3AF5 A;  2QED A;  3DHC A;  3BC2 A;  2FM6 A;  3T9M A;  5LCF A;  4AX1 B;  4TZE A;  2BG2 A;  3IE0 A;  4PVO A;  4C1C A;  2Q0J A;  3IOF A;  5EVK A;  1BVT A;  2CG3 A;  4D1W A; 
#chains in the Genus database with same CATH homology
 3TP9 A;  2QDS A;  1MQO A;  4D1T A;  4HL2 A;  3PY6 A;  4Z5Z A;  2GFK A;  2YNV A;  5LLD A;  2NYP A;  1ZNB A;  5HIS A;  1XTO A;  4P62 A;  5EVD A;  2YNW A;  5LSC A;  5LCH A;  5ACU A;  4YSK A;  3BK1 A;  2FU8 A;  4C1D A;  2FK6 A;  2Y87 A;  2BG8 A;  2I7X A;  3SBL A;  3IE2 A;  4C1G A;  5AHO A;  5HH4 A;  4EYB A;  5AYA A;  3AJ3 A;  3RPC A;  1X8I A;  4UWO B;  2GFJ A;  1WUP A;  5HIP A;  5EH9 A;  2OHH A;  1P9E A;  4Z7R A;  3H3E A;  2NZE A;  3ZR9 A;  2ZO4 A;  3RKJ A;  2ZZI A;  5FQB A;  3L6N A;  4C1H A;  3IE1 A;  2WHG A;  3ZWF A;  4HKY A;  4NQ6 A;  1DD6 A;  2P97 A;  1KO2 A;  4Z6X A;  1YCF A;  4UAM A;  4AD9 A;  5A5Z A;  1E5D A;  1JJE A;  4DIL A;  3SFP A;  4EXY A;  2FU6 A;  3DHB A;  5LM6 A;  4TZF A;  3SRX A;  3X2Y A;  4B87 A;  2Y8A A;  3ESH A;  5AXO A;  4C1F A;  1A7T A;  5HH6 A;  4J5H A;  5EVB A;  5B1U A;  4U4L A;  3R2U A;  4J5F A;  3LVZ A;  4O98 A;  3AF6 A;  1X8H A;  2XR1 A;  3FAI A;  5AHR A;  2BC2 A;  2P18 A;  2YNT B;  2WYM C;  4ZO3 A;  2I7V A;  1JJT A;  2YCB A;  3FCZ A;  5K4M A;  4JO0 A;  1VME A;  1DXK A;  4UBQ A;  5ACS A;  2CBN A;  2BR6 A;  5EW0 A;  2UYX A;  5DPX A;  1VJN A;  2QIN A;  3X30 A;  2VW8 A;  5ACX A;  4D1V A;  4TZB A;  3KL7 A;  5EWA A;  2BTN A;  1QH3 A;  4YSL A;  2Y8B A;  4LE6 A;  2YNT A;  2FHX A;  1K07 A;  3DHA A;  5ACP A;  2BG7 A;  3PY5 A;  4ZO2 A;  4EXS A;  3DH8 A;  3IEL A;  5KIK A;  3ZQ4 A;  5EHT A;  4TYT A;  3PG4 A;  1Y44 A;  1WW1 A;  2YNU A;  2BFZ A;  3I15 A;  2OHJ A;  2Q0I A;  5HIO A;  4EYF A;  1YCH A;  1KO3 A;  4UWS B;  5EV6 A;  1ZTC A;  1KR3 A;  4D02 A;  4H0D A;  2XF4 A;  5KIL A;  4TYF A;  2DKF A;  2BG6 A;  4C1E A;  4RL2 A;  1BMC A;  2M5C A;  5B3R A;  2FU9 A;  4HL1 A;  1HLK A;  1L9Y A;  4D1U A;  3T3N A;  5K4N A;  2P1E A;  1X8G A;  4XUK A;  2I7T A;  1QH5 A;  5B15 A;  5K4K A;  4NQ5 A;  4F6H A;  4DIK A;  5ACV A;  2BIB A;  2E7Y A;  5HH5 A;  2FU7 A;  3BV6 A;  4CHL A;  2QDT A;  4PVT A;  4XWW A;  3SPU A;  2ZNB A;  3G1P A;  4RBS A;  2BG8 B;  1DDK A;  2YZ3 A;  2HB9 A;  5ACQ A;  5AXR A;  4KEP A;  4AX0 B;  3IEK A;  4ZNB A;  4UWP B;  4YSB A;  5A87 A;  1SML A;  3I11 A;  3ZNB A;  5K0W A;  5LE1 A;  3A4Y A;  4GYQ A;  4EFZ A;  2P4Z A;  4GYU A;  2OHI A;  2YNV B;  4FSB A;  5A0T A;  5LS3 A;  1ZKP A;  4BZ3 A;  1BC2 A;  3JXP A;  5LCA A;  5AEB A;  3T3O A;  2WYL A;  3I0V A;  2Q42 A;  4ZEJ A;  3S0Z A;  4EY2 A;  5ACT A;  1WRA A;  3KNR A;  2GCU A;  2DOO A;  2NZF A;  5FQA A;  2BGA A;  4NQ4 A;  3I14 A;  4WD6 A;  3KNS A;  3X2X A;  2R2D A;  2BFL A;  2BFZ B;  4Z60 A;  3MD7 A;  4FR7 A;  4AWY B;  5IQK A;  3P2U A;  4C09 A;  2BFK A;  2WYM A;  5EV8 A;  4TZ9 A;  2NXA A;  3F9O A;  3SD9 A;  3QH8 A;  3SW3 A;  2AZ4 A;  4RL0 A;  3VQZ A;  4Z67 A;  5FQC A;  2BMI A;  2GMN A;  3X2Z A;  3IOG A;  2Q9U A;  4UWR B;  1VGN A;  5ACR A;  4BP0 A;  2GKL A;  1JT1 A;  2WRS A;  4F6Z A;  4Z5Y A;  4AWZ A;  1WUO A;  4V0H A;  4RM5 A;  3ADR A;  4XWT A;  2H6A A;  1YCG A;  3IEM A;  4FEK A;  2FHX B;  4GCW A;  2AIO A;  3I13 A;  4RAM A;  1M2X A;  5ACW A;  3VPE A;  4KEQ A;  5HIQ A;  4NQ2 A;  2QJS A;  3IDZ A;  2A7M A;  3Q6V A;  3BK2 A;  4EYL A;  3RKK A;  5A0V A;  1XM8 A;  1A8T A;  4RAW A;  2M5D A;  4UA4 A;  5LMC A;  2ZWR A;  3WXC A;  3AF5 A;  2QED A;  3DHC A;  3BC2 A;  2FM6 A;  3T9M A;  5LCF A;  4AX1 B;  4TZE A;  2BG2 A;  3IE0 A;  4PVO A;  4C1C A;  2Q0J A;  3IOF A;  5EVK A;  1BVT A;  4D1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...