5B3RA

Crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
214
Chain Sequence
LPDLKIEKLEKGVYVHTSFEGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-18
publication title Structural and Mutagenic Analysis of Metallo-beta-Lactamase IMP-18
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 69
structure length 214
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b3rA00
4DIKA 3S0ZA 4F6HA 4J5FA 4ZO3A 2OHJA 2WYMA 4UBQA 2Y8BA 2NZEA 2WYLA 3F9OA 4GCWA 3IE0A 3T3OA 5LM6A 3DH8A 3VPEA 3MD7A 3Q6VA 3SBLA 1KR3A 3RKJA 1DXKA 2P18A 3LVZA 5LMCA 4TYTA 4DILA 3RKKA 4RM5A 4TZ9A 4KEPA 4C1CA 3L6NA 5ACWA 2GMNA 2HB9A 2M5CA 2BMIA 5ACTA 2Q0IA 1BC2A 1HLKA 5HH5A 1WW1A 2YNTA 3SW3A 2BG6A 2ZWRA 3IELA 5FQAA 2BFLA 5A5ZA 5EV8A 4RL0A 2AZ4A 5FQCA 4NQ2A 4D1WA 4JO0A 3A4YA 2FHXB 1XTOA 2BTNA 5A0TA 2DOOA 4EXYA 4BP0A 4WD6A 2R2DA 4AWZA 2OHHA 1A8TA 2QJSA 2BG2A 4TZBA 4P62A 5ACPA 1SMLA 2FU7A 3SFPA 2YNVA 3P2UA 4Z5ZA 4V0HA 5ACRA 5AHOA 5LCAA 5LS3A 4H0DA 2AIOA 3X2XA 4D1TA 1JJTA 4GYUA 4CHLA 5AEBA 5HISA 2OHIA 3ADRA 3BK1A 3I11A 4NQ5A 4Z6XA 2BG7A 3RPCA 4HL2A 3H3EA 3DHCA 3ESHA 5B15A 2WHGA 3SD9A 2E7YA 1ZKPA 2GKLA 5ACUA 2QINA 2WYMC 5LE1A 3DHBA 2XR1A 3IEKA 1QH5A 4FR7A 3DHAA 3TP9A 2CBNA 4AX1B 5HIQA 5HIPA 3KL7A 5EWAA 2GCUA 5B1UA 1E5DA 1A7TA 4LE6A 2BC2A 3I14A 2VW8A 2FU9A 4XWTA 5EH9A 4YSKA 2BR6A 4UA4A 1KO3A 4AX0B 4EYFA 2H6AA 2I7TA 4C1EA 5K4MA 4ZNBA 2BFZB 4TZFA 3R2UA 4TZEA 4Z5YA 4C1DA 1X8IA 2I7VA 5A0VA 5FQBA 5KILA 2NXAA 2NZFA 1JT1A 3QH8A 4RL2A 4PVOA 3T3NA 3KNRA 2Q42A 1JJEA 2QEDA 4ZO2A 1XM8A 2QDTA 5B3RA 5ACQA 2DKFA 4D1UA 5HIOA 4Z7RA 2YNWA 4EY2A 4Z60A 4EYBA 2FHXA 4UWPB 3IOGA 1YCGA 5EV6A 4J5HA 3FAIA 1BVTA 4XWWA 5IQKA 1X8GA 1YCFA 2NYPA 2YZ3A 3ZWFA 2YCBA 3I13A 5ACXA 2FU8A 2GFJA 5AXRA 4RBSA 5EW0A 4C1FA 4O98A 2BG8B 3PY5A 5A87A 2M5DA 1WUOA 3ZQ4A 4YSBA 4NQ4A 2ZO4A 3X2YA 1BMCA 4PVTA 1X8HA 3IDZA 3AJ3A 3BK2A 5AHRA 3IE2A 4EXSA 4BZ3A 1DDKA 4EYLA 4EFZA 1QH3A 3PG4A 4FSBA 1KO2A 1VJNA 4NQ6A 3G1PA 4Z67A 4AWYB 3SPUA 1DD6A 3KNSA 3IEMA 2Q9UA 1YCHA 2I7XA 1M2XA 3IE1A 1Y44A 1P9EA 4C1HA 5K4KA 4AD9A 1L9YA 2WRSA 5EVBA 5ACSA 3PY6A 3IOFA 5EHTA 1K07A 2ZZIA 1VMEA 4RAMA 4YSLA 2YNTB 2BFZA 5EVDA 5K0WA 2XF4A 1ZTCA 2QDSA 3JXPA 2FU6A 2GFKA 5LCFA 3BV6A 4UAMA 2BIBA 5LLDA 3ZR9A 2Y8AA 5HH6A 3BC2A 1VGNA 5DPXA 1ZNBA 4HL1A 2A7MA 5AYAA 2UYXA 4UWSB 4ZEJA 2Y87A 2BFKA 4C09A 3T9MA 2P4ZA 2BGAA 3WXCA 4F6ZA 3X2ZA 2YNVB 4XUKA 4D1VA 4TYFA 5HH4A 1WUPA 3FCZA 4GYQA 4B87A 4UWOB 2P1EA 5AXOA 3ZNBA 3I0VA 3X30A 3SRXA 3I15A 3AF5A 2FM6A 5ACVA 2YNUA 4FEKA 5LCHA 5KIKA 4UWRB 3VQZA 4KEQA 2Q0JA 2FK6A 2P97A 5K4NA 4D02A 2BG8A 3AF6A 4HKYA 5EVKA 4U4LA 1WRAA 1MQOA 5LSCA 2ZNBA 4C1GA 4RAWA
chains in the Genus database with same CATH superfamily
4DIKA 3S0ZA 4F6HA 4J5FA 4ZO3A 2OHJA 2WYMA 4UBQA 2Y8BA 2NZEA 2WYLA 3F9OA 4GCWA 3IE0A 3T3OA 5LM6A 5AJLA 3DH8A 3VPEA 3MD7A 3Q6VA 3SBLA 1KR3A 3RKJA 1DXKA 2P18A 3LVZA 5LMCA 4NURA 4TYTA 4DILA 3RKKA 4RM5A 4TZ9A 4KEPA 4C1CA 3L6NA 5ACWA 2GMNA 2CG2A 2HB9A 2M5CA 2BMIA 5ACTA 2Q0IA 1BC2A 1HLKA 5HH5A 1WW1A 2YNTA 3SW3A 2BG6A 2ZWRA 3IELA 5FQAA 2BFLA 5A5ZA 5EV8A 4RL0A 2AZ4A 5FQCA 4NQ2A 4D1WA 4JO0A 3A4YA 2FHXB 1XTOA 2BTNA 5A0TA 2DOOA 4EXYA 4BP0A 4WD6A 2R2DA 4AWZA 2OHHA 1A8TA 2QJSA 2BG2A 4TZBA 2YHEA 4P62A 5ACPA 1SMLA 2FU7A 3SFPA 2YNVA 3P2UA 4Z5ZA 4V0HA 5ACRA 5AHOA 5LCAA 5LS3A 4H0DA 2AIOA 3X2XA 4D1TA 1JJTA 4AXHA 4GYUA 4CHLA 5AEBA 5HISA 2OHIA 3ADRA 3BK1A 3I11A 4NQ5A 2CFUA 2BG7A 3RPCA 4Z6XA 4HL2A 3H3EA 3DHCA 3ESHA 5B15A 2WHGA 3SD9A 2E7YA 1ZKPA 5AIJA 2GKLA 2CFZA 5ACUA 2QINA 2WYMC 5LE1A 3DHBA 2XR1A 3IEKA 1QH5A 4FR7A 3DHAA 3TP9A 2CBNA 4AX1B 5HIQA 5HIPA 3KL7A 5EWAA 2GCUA 5B1UA 1E5DA 1A7TA 4LE6A 2BC2A 3I14A 2VW8A 2FU9A 4XWTA 5EH9A 4YSKA 2BR6A 4UA4A 1KO3A 4AX0B 4EYFA 2H6AA 2I7TA 4C1EA 5K4MA 4ZNBA 2BFZB 4TZFA 3R2UA 4TZEA 4Z5YA 4C1DA 1X8IA 2I7VA 5A0VA 5FQBA 5KILA 2NXAA 2NZFA 1JT1A 3QH8A 4RL2A 4PVOA 3T3NA 3KNRA 2Q42A 1JJEA 4PDXA 2QEDA 4ZO2A 1XM8A 2QDTA 5B3RA 5ACQA 2DKFA 4D1UA 5HIOA 4AV7A 4Z7RA 2YNWA 4EY2A 4Z60A 4EYBA 2FHXA 4UWPB 3IOGA 1YCGA 5EV6A 4J5HA 3FAIA 1BVTA 4XWWA 5IQKA 1X8GA 1YCFA 2NYPA 2YZ3A 3ZWFA 2YCBA 3I13A 5ACXA 2FU8A 2GFJA 5AXRA 4RBSA 5EW0A 5A23A 4C1FA 4O98A 2BG8B 3PY5A 5A87A 2M5DA 1WUOA 3ZQ4A 4YSBA 4NQ4A 2ZO4A 3X2YA 1BMCA 4PVTA 1X8HA 3IDZA 3AJ3A 3BK2A 5AHRA 3IE2A 4EXSA 4BZ3A 1DDKA 4EYLA 4EFZA 1QH3A 3PG4A 4FSBA 1KO2A 1VJNA 4NQ6A 3G1PA 4Z67A 4AWYB 3SPUA 1DD6A 3KNSA 3IEMA 2Q9UA 1YCHA 2I7XA 1M2XA 3IE1A 1Y44A 1P9EA 4C1HA 5K4KA 4AD9A 1L9YA 2WRSA 2CG3A 5EVBA 5ACSA 3PY6A 3IOFA 5EHTA 1K07A 2ZZIA 1VMEA 4RAMA 4YSLA 2YNTB 2BFZA 5EVDA 5K0WA 2XF4A 1ZTCA 2QDSA 3JXPA 2FU6A 2GFKA 5LCFA 3BV6A 4UAMA 2BIBA 5LLDA 3ZR9A 2Y8AA 5HH6A 3BC2A 1VGNA 5DPXA 1ZNBA 4HL1A 2A7MA 5AYAA 2UYXA 4UWSB 4ZEJA 2Y87A 2BFKA 4C09A 3T9MA 2P4ZA 2BGAA 3WXCA 4F6ZA 3X2ZA 2YNVB 4XUKA 4D1VA 4TYFA 5HH4A 1WUPA 3FCZA 4GYQA 4B87A 4UWOB 2P1EA 5AXOA 3ZNBA 3I0VA 3X30A 3SRXA 3I15A 3AF5A 2FM6A 5ACVA 2YNUA 4FEKA 5LCHA 5KIKA 4UWRB 3VQZA 4KEQA 2Q0JA 2FK6A 2P97A 5K4NA 4D02A 2BG8A 3AF6A 4HKYA 5EVKA 4U4LA 1WRAA 1MQOA 5LSCA 2ZNBA 4C1GA 4RAWA
chains in the Genus database with same CATH topology
4DIKA 3S0ZA 4F6HA 4J5FA 4ZO3A 2OHJA 2WYMA 4UBQA 2Y8BA 2NZEA 2WYLA 3F9OA 4GCWA 3IE0A 3T3OA 5LM6A 3DH8A 3VPEA 3MD7A 3Q6VA 3SBLA 1KR3A 3RKJA 1DXKA 2P18A 3LVZA 5LMCA 4TYTA 4DILA 3RKKA 4RM5A 4TZ9A 4KEPA 4C1CA 3L6NA 5ACWA 2GMNA 2HB9A 2M5CA 2BMIA 5ACTA 2Q0IA 1BC2A 1HLKA 5HH5A 1WW1A 2YNTA 3SW3A 2BG6A 2ZWRA 3IELA 5FQAA 2BFLA 5A5ZA 5EV8A 4RL0A 2AZ4A 5FQCA 4NQ2A 4D1WA 4JO0A 3A4YA 2FHXB 1XTOA 2BTNA 5A0TA 2DOOA 4EXYA 4BP0A 4WD6A 2R2DA 4AWZA 2OHHA 1A8TA 2QJSA 2BG2A 4TZBA 4P62A 5ACPA 1SMLA 2FU7A 3SFPA 2YNVA 3P2UA 4Z5ZA 4V0HA 5ACRA 5AHOA 5LCAA 5LS3A 4H0DA 2AIOA 3X2XA 4D1TA 1JJTA 4GYUA 4CHLA 5AEBA 5HISA 2OHIA 3ADRA 3BK1A 3I11A 4NQ5A 4Z6XA 2BG7A 3RPCA 4HL2A 3H3EA 3DHCA 3ESHA 5B15A 2WHGA 3SD9A 2E7YA 1ZKPA 2GKLA 5ACUA 2QINA 2WYMC 5LE1A 3DHBA 2XR1A 3IEKA 1QH5A 4FR7A 3DHAA 3TP9A 2CBNA 4AX1B 5HIQA 5HIPA 3KL7A 5EWAA 2GCUA 5B1UA 1E5DA 1A7TA 4LE6A 2BC2A 3I14A 2VW8A 2FU9A 4XWTA 5EH9A 4YSKA 2BR6A 4UA4A 1KO3A 4AX0B 4EYFA 2H6AA 2I7TA 4C1EA 5K4MA 4ZNBA 2BFZB 4TZFA 3R2UA 4TZEA 4Z5YA 4C1DA 1X8IA 2I7VA 5A0VA 5FQBA 5KILA 2NXAA 2NZFA 1JT1A 3QH8A 4RL2A 4PVOA 3T3NA 3KNRA 2Q42A 1JJEA 2QEDA 4ZO2A 1XM8A 2QDTA 5B3RA 5ACQA 2DKFA 4D1UA 5HIOA 4Z7RA 2YNWA 4EY2A 4Z60A 4EYBA 2FHXA 4UWPB 3IOGA 1YCGA 5EV6A 4J5HA 3FAIA 1BVTA 4XWWA 5IQKA 1X8GA 1YCFA 2NYPA 2YZ3A 3ZWFA 2YCBA 3I13A 5ACXA 2FU8A 2GFJA 5AXRA 4RBSA 5EW0A 4C1FA 4O98A 2BG8B 3PY5A 5A87A 2M5DA 1WUOA 3ZQ4A 4YSBA 4NQ4A 2ZO4A 3X2YA 1BMCA 4PVTA 1X8HA 3IDZA 3AJ3A 3BK2A 5AHRA 3IE2A 4EXSA 4BZ3A 1DDKA 4EYLA 4EFZA 1QH3A 3PG4A 4FSBA 1KO2A 1VJNA 4NQ6A 3G1PA 4Z67A 4AWYB 3SPUA 1DD6A 3KNSA 3IEMA 2Q9UA 1YCHA 2I7XA 1M2XA 3IE1A 1Y44A 1P9EA 4C1HA 5K4KA 4AD9A 1L9YA 2WRSA 5EVBA 5ACSA 3PY6A 3IOFA 5EHTA 1K07A 2ZZIA 1VMEA 4RAMA 4YSLA 2YNTB 2BFZA 5EVDA 5K0WA 2XF4A 1ZTCA 2QDSA 3JXPA 2FU6A 2GFKA 5LCFA 3BV6A 4UAMA 2BIBA 5LLDA 3ZR9A 2Y8AA 5HH6A 3BC2A 1VGNA 5DPXA 1ZNBA 4HL1A 2A7MA 5AYAA 2UYXA 4UWSB 4ZEJA 2Y87A 2BFKA 4C09A 3T9MA 2P4ZA 2BGAA 3WXCA 4F6ZA 3X2ZA 2YNVB 4XUKA 4D1VA 4TYFA 5HH4A 1WUPA 3FCZA 4GYQA 4B87A 4UWOB 2P1EA 5AXOA 3ZNBA 3I0VA 3X30A 3SRXA 3I15A 3AF5A 2FM6A 5ACVA 2YNUA 4FEKA 5LCHA 5KIKA 4UWRB 3VQZA 4KEQA 2Q0JA 2FK6A 2P97A 5K4NA 4D02A 2BG8A 3AF6A 4HKYA 5EVKA 4U4LA 1WRAA 1MQOA 5LSCA 2ZNBA 4C1GA 4RAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIK A;  3S0Z A;  4F6H A;  4J5F A;  4ZO3 A;  2OHJ A;  2WYM A;  4UBQ A;  2Y8B A;  2NZE A;  2WYL A;  3F9O A;  4GCW A;  3IE0 A;  3T3O A;  5LM6 A;  3DH8 A;  3VPE A;  3MD7 A;  3Q6V A;  3SBL A;  1KR3 A;  3RKJ A;  1DXK A;  2P18 A;  3LVZ A;  5LMC A;  4TYT A;  4DIL A;  3RKK A;  4RM5 A;  4TZ9 A;  4KEP A;  4C1C A;  3L6N A;  5ACW A;  2GMN A;  2HB9 A;  2M5C A;  2BMI A;  5ACT A;  2Q0I A;  1BC2 A;  1HLK A;  5HH5 A;  1WW1 A;  2YNT A;  3SW3 A;  2BG6 A;  2ZWR A;  3IEL A;  5FQA A;  2BFL A;  5A5Z A;  5EV8 A;  4RL0 A;  2AZ4 A;  5FQC A;  4NQ2 A;  4D1W A;  4JO0 A;  3A4Y A;  2FHX B;  1XTO A;  2BTN A;  5A0T A;  2DOO A;  4EXY A;  4BP0 A;  4WD6 A;  2R2D A;  4AWZ A;  2OHH A;  1A8T A;  2QJS A;  2BG2 A;  4TZB A;  4P62 A;  5ACP A;  1SML A;  2FU7 A;  3SFP A;  2YNV A;  3P2U A;  4Z5Z A;  4V0H A;  5ACR A;  5AHO A;  5LCA A;  5LS3 A;  4H0D A;  2AIO A;  3X2X A;  4D1T A;  1JJT A;  4GYU A;  4CHL A;  5AEB A;  5HIS A;  2OHI A;  3ADR A;  3BK1 A;  3I11 A;  4NQ5 A;  4Z6X A;  2BG7 A;  3RPC A;  4HL2 A;  3H3E A;  3DHC A;  3ESH A;  5B15 A;  2WHG A;  3SD9 A;  2E7Y A;  1ZKP A;  2GKL A;  5ACU A;  2QIN A;  2WYM C;  5LE1 A;  3DHB A;  2XR1 A;  3IEK A;  1QH5 A;  4FR7 A;  3DHA A;  3TP9 A;  2CBN A;  4AX1 B;  5HIQ A;  5HIP A;  3KL7 A;  5EWA A;  2GCU A;  5B1U A;  1E5D A;  1A7T A;  4LE6 A;  2BC2 A;  3I14 A;  2VW8 A;  2FU9 A;  4XWT A;  5EH9 A;  4YSK A;  2BR6 A;  4UA4 A;  1KO3 A;  4AX0 B;  4EYF A;  2H6A A;  2I7T A;  4C1E A;  5K4M A;  4ZNB A;  2BFZ B;  4TZF A;  3R2U A;  4TZE A;  4Z5Y A;  4C1D A;  1X8I A;  2I7V A;  5A0V A;  5FQB A;  5KIL A;  2NXA A;  2NZF A;  1JT1 A;  3QH8 A;  4RL2 A;  4PVO A;  3T3N A;  3KNR A;  2Q42 A;  1JJE A;  2QED A;  4ZO2 A;  1XM8 A;  2QDT A;  5B3R A;  5ACQ A;  2DKF A;  4D1U A;  5HIO A;  4Z7R A;  2YNW A;  4EY2 A;  4Z60 A;  4EYB A;  2FHX A;  4UWP B;  3IOG A;  1YCG A;  5EV6 A;  4J5H A;  3FAI A;  1BVT A;  4XWW A;  5IQK A;  1X8G A;  1YCF A;  2NYP A;  2YZ3 A;  3ZWF A;  2YCB A;  3I13 A;  5ACX A;  2FU8 A;  2GFJ A;  5AXR A;  4RBS A;  5EW0 A;  4C1F A;  4O98 A;  2BG8 B;  3PY5 A;  5A87 A;  2M5D A;  1WUO A;  3ZQ4 A;  4YSB A;  4NQ4 A;  2ZO4 A;  3X2Y A;  1BMC A;  4PVT A;  1X8H A;  3IDZ A;  3AJ3 A;  3BK2 A;  5AHR A;  3IE2 A;  4EXS A;  4BZ3 A;  1DDK A;  4EYL A;  4EFZ A;  1QH3 A;  3PG4 A;  4FSB A;  1KO2 A;  1VJN A;  4NQ6 A;  3G1P A;  4Z67 A;  4AWY B;  3SPU A;  1DD6 A;  3KNS A;  3IEM A;  2Q9U A;  1YCH A;  2I7X A;  1M2X A;  3IE1 A;  1Y44 A;  1P9E A;  4C1H A;  5K4K A;  4AD9 A;  1L9Y A;  2WRS A;  5EVB A;  5ACS A;  3PY6 A;  3IOF A;  5EHT A;  1K07 A;  2ZZI A;  1VME A;  4RAM A;  4YSL A;  2YNT B;  2BFZ A;  5EVD A;  5K0W A;  2XF4 A;  1ZTC A;  2QDS A;  3JXP A;  2FU6 A;  2GFK A;  5LCF A;  3BV6 A;  4UAM A;  2BIB A;  5LLD A;  3ZR9 A;  2Y8A A;  5HH6 A;  3BC2 A;  1VGN A;  5DPX A;  1ZNB A;  4HL1 A;  2A7M A;  5AYA A;  2UYX A;  4UWS B;  4ZEJ A;  2Y87 A;  2BFK A;  4C09 A;  3T9M A;  2P4Z A;  2BGA A;  3WXC A;  4F6Z A;  3X2Z A;  2YNV B;  4XUK A;  4D1V A;  4TYF A;  5HH4 A;  1WUP A;  3FCZ A;  4GYQ A;  4B87 A;  4UWO B;  2P1E A;  5AXO A;  3ZNB A;  3I0V A;  3X30 A;  3SRX A;  3I15 A;  3AF5 A;  2FM6 A;  5ACV A;  2YNU A;  4FEK A;  5LCH A;  5KIK A;  4UWR B;  3VQZ A;  4KEQ A;  2Q0J A;  2FK6 A;  2P97 A;  5K4N A;  4D02 A;  2BG8 A;  3AF6 A;  4HKY A;  5EVK A;  4U4L A;  1WRA A;  1MQO A;  5LSC A;  2ZNB A;  4C1G A;  4RAW A; 
#chains in the Genus database with same CATH topology
 4DIK A;  3S0Z A;  4F6H A;  4J5F A;  4ZO3 A;  2OHJ A;  2WYM A;  4UBQ A;  2Y8B A;  2NZE A;  2WYL A;  3F9O A;  4GCW A;  3IE0 A;  3T3O A;  5LM6 A;  5AJL A;  3DH8 A;  3VPE A;  3MD7 A;  3Q6V A;  3SBL A;  1KR3 A;  3RKJ A;  1DXK A;  2P18 A;  3LVZ A;  5LMC A;  4NUR A;  4TYT A;  4DIL A;  3RKK A;  4RM5 A;  4TZ9 A;  4KEP A;  4C1C A;  3L6N A;  5ACW A;  2GMN A;  2CG2 A;  2HB9 A;  2M5C A;  2BMI A;  5ACT A;  2Q0I A;  1BC2 A;  1HLK A;  5HH5 A;  1WW1 A;  2YNT A;  3SW3 A;  2BG6 A;  2ZWR A;  3IEL A;  5FQA A;  2BFL A;  5A5Z A;  5EV8 A;  4RL0 A;  2AZ4 A;  5FQC A;  4NQ2 A;  4D1W A;  4JO0 A;  3A4Y A;  2FHX B;  1XTO A;  2BTN A;  5A0T A;  2DOO A;  4EXY A;  4BP0 A;  4WD6 A;  2R2D A;  4AWZ A;  2OHH A;  1A8T A;  2QJS A;  2BG2 A;  4TZB A;  2YHE A;  4P62 A;  5ACP A;  1SML A;  2FU7 A;  3SFP A;  2YNV A;  3P2U A;  4Z5Z A;  4V0H A;  5ACR A;  5AHO A;  5LCA A;  5LS3 A;  4H0D A;  2AIO A;  3X2X A;  4D1T A;  1JJT A;  4AXH A;  4GYU A;  4CHL A;  5AEB A;  5HIS A;  2OHI A;  3ADR A;  3BK1 A;  3I11 A;  4NQ5 A;  2CFU A;  2BG7 A;  3RPC A;  4Z6X A;  4HL2 A;  3H3E A;  3DHC A;  3ESH A;  5B15 A;  2WHG A;  3SD9 A;  2E7Y A;  1ZKP A;  5AIJ A;  2GKL A;  2CFZ A;  5ACU A;  2QIN A;  2WYM C;  5LE1 A;  3DHB A;  2XR1 A;  3IEK A;  1QH5 A;  4FR7 A;  3DHA A;  3TP9 A;  2CBN A;  4AX1 B;  5HIQ A;  5HIP A;  3KL7 A;  5EWA A;  2GCU A;  5B1U A;  1E5D A;  1A7T A;  4LE6 A;  2BC2 A;  3I14 A;  2VW8 A;  2FU9 A;  4XWT A;  5EH9 A;  4YSK A;  2BR6 A;  4UA4 A;  1KO3 A;  4AX0 B;  4EYF A;  2H6A A;  2I7T A;  4C1E A;  5K4M A;  4ZNB A;  2BFZ B;  4TZF A;  3R2U A;  4TZE A;  4Z5Y A;  4C1D A;  1X8I A;  2I7V A;  5A0V A;  5FQB A;  5KIL A;  2NXA A;  2NZF A;  1JT1 A;  3QH8 A;  4RL2 A;  4PVO A;  3T3N A;  3KNR A;  2Q42 A;  1JJE A;  4PDX A;  2QED A;  4ZO2 A;  1XM8 A;  2QDT A;  5B3R A;  5ACQ A;  2DKF A;  4D1U A;  5HIO A;  4AV7 A;  4Z7R A;  2YNW A;  4EY2 A;  4Z60 A;  4EYB A;  2FHX A;  4UWP B;  3IOG A;  1YCG A;  5EV6 A;  4J5H A;  3FAI A;  1BVT A;  4XWW A;  5IQK A;  1X8G A;  1YCF A;  2NYP A;  2YZ3 A;  3ZWF A;  2YCB A;  3I13 A;  5ACX A;  2FU8 A;  2GFJ A;  5AXR A;  4RBS A;  5EW0 A;  5A23 A;  4C1F A;  4O98 A;  2BG8 B;  3PY5 A;  5A87 A;  2M5D A;  1WUO A;  3ZQ4 A;  4YSB A;  4NQ4 A;  2ZO4 A;  3X2Y A;  1BMC A;  4PVT A;  1X8H A;  3IDZ A;  3AJ3 A;  3BK2 A;  5AHR A;  3IE2 A;  4EXS A;  4BZ3 A;  1DDK A;  4EYL A;  4EFZ A;  1QH3 A;  3PG4 A;  4FSB A;  1KO2 A;  1VJN A;  4NQ6 A;  3G1P A;  4Z67 A;  4AWY B;  3SPU A;  1DD6 A;  3KNS A;  3IEM A;  2Q9U A;  1YCH A;  2I7X A;  1M2X A;  3IE1 A;  1Y44 A;  1P9E A;  4C1H A;  5K4K A;  4AD9 A;  1L9Y A;  2WRS A;  2CG3 A;  5EVB A;  5ACS A;  3PY6 A;  3IOF A;  5EHT A;  1K07 A;  2ZZI A;  1VME A;  4RAM A;  4YSL A;  2YNT B;  2BFZ A;  5EVD A;  5K0W A;  2XF4 A;  1ZTC A;  2QDS A;  3JXP A;  2FU6 A;  2GFK A;  5LCF A;  3BV6 A;  4UAM A;  2BIB A;  5LLD A;  3ZR9 A;  2Y8A A;  5HH6 A;  3BC2 A;  1VGN A;  5DPX A;  1ZNB A;  4HL1 A;  2A7M A;  5AYA A;  2UYX A;  4UWS B;  4ZEJ A;  2Y87 A;  2BFK A;  4C09 A;  3T9M A;  2P4Z A;  2BGA A;  3WXC A;  4F6Z A;  3X2Z A;  2YNV B;  4XUK A;  4D1V A;  4TYF A;  5HH4 A;  1WUP A;  3FCZ A;  4GYQ A;  4B87 A;  4UWO B;  2P1E A;  5AXO A;  3ZNB A;  3I0V A;  3X30 A;  3SRX A;  3I15 A;  3AF5 A;  2FM6 A;  5ACV A;  2YNU A;  4FEK A;  5LCH A;  5KIK A;  4UWR B;  3VQZ A;  4KEQ A;  2Q0J A;  2FK6 A;  2P97 A;  5K4N A;  4D02 A;  2BG8 A;  3AF6 A;  4HKY A;  5EVK A;  4U4L A;  1WRA A;  1MQO A;  5LSC A;  2ZNB A;  4C1G A;  4RAW A; 
#chains in the Genus database with same CATH homology
 4DIK A;  3S0Z A;  4F6H A;  4J5F A;  4ZO3 A;  2OHJ A;  2WYM A;  4UBQ A;  2Y8B A;  2NZE A;  2WYL A;  3F9O A;  4GCW A;  3IE0 A;  3T3O A;  5LM6 A;  3DH8 A;  3VPE A;  3MD7 A;  3Q6V A;  3SBL A;  1KR3 A;  3RKJ A;  1DXK A;  2P18 A;  3LVZ A;  5LMC A;  4TYT A;  4DIL A;  3RKK A;  4RM5 A;  4TZ9 A;  4KEP A;  4C1C A;  3L6N A;  5ACW A;  2GMN A;  2HB9 A;  2M5C A;  2BMI A;  5ACT A;  2Q0I A;  1BC2 A;  1HLK A;  5HH5 A;  1WW1 A;  2YNT A;  3SW3 A;  2BG6 A;  2ZWR A;  3IEL A;  5FQA A;  2BFL A;  5A5Z A;  5EV8 A;  4RL0 A;  2AZ4 A;  5FQC A;  4NQ2 A;  4D1W A;  4JO0 A;  3A4Y A;  2FHX B;  1XTO A;  2BTN A;  5A0T A;  2DOO A;  4EXY A;  4BP0 A;  4WD6 A;  2R2D A;  4AWZ A;  2OHH A;  1A8T A;  2QJS A;  2BG2 A;  4TZB A;  4P62 A;  5ACP A;  1SML A;  2FU7 A;  3SFP A;  2YNV A;  3P2U A;  4Z5Z A;  4V0H A;  5ACR A;  5AHO A;  5LCA A;  5LS3 A;  4H0D A;  2AIO A;  3X2X A;  4D1T A;  1JJT A;  4GYU A;  4CHL A;  5AEB A;  5HIS A;  2OHI A;  3ADR A;  3BK1 A;  3I11 A;  4NQ5 A;  4Z6X A;  2BG7 A;  3RPC A;  4HL2 A;  3H3E A;  3DHC A;  3ESH A;  5B15 A;  2WHG A;  3SD9 A;  2E7Y A;  1ZKP A;  2GKL A;  5ACU A;  2QIN A;  2WYM C;  5LE1 A;  3DHB A;  2XR1 A;  3IEK A;  1QH5 A;  4FR7 A;  3DHA A;  3TP9 A;  2CBN A;  4AX1 B;  5HIQ A;  5HIP A;  3KL7 A;  5EWA A;  2GCU A;  5B1U A;  1E5D A;  1A7T A;  4LE6 A;  2BC2 A;  3I14 A;  2VW8 A;  2FU9 A;  4XWT A;  5EH9 A;  4YSK A;  2BR6 A;  4UA4 A;  1KO3 A;  4AX0 B;  4EYF A;  2H6A A;  2I7T A;  4C1E A;  5K4M A;  4ZNB A;  2BFZ B;  4TZF A;  3R2U A;  4TZE A;  4Z5Y A;  4C1D A;  1X8I A;  2I7V A;  5A0V A;  5FQB A;  5KIL A;  2NXA A;  2NZF A;  1JT1 A;  3QH8 A;  4RL2 A;  4PVO A;  3T3N A;  3KNR A;  2Q42 A;  1JJE A;  2QED A;  4ZO2 A;  1XM8 A;  2QDT A;  5B3R A;  5ACQ A;  2DKF A;  4D1U A;  5HIO A;  4Z7R A;  2YNW A;  4EY2 A;  4Z60 A;  4EYB A;  2FHX A;  4UWP B;  3IOG A;  1YCG A;  5EV6 A;  4J5H A;  3FAI A;  1BVT A;  4XWW A;  5IQK A;  1X8G A;  1YCF A;  2NYP A;  2YZ3 A;  3ZWF A;  2YCB A;  3I13 A;  5ACX A;  2FU8 A;  2GFJ A;  5AXR A;  4RBS A;  5EW0 A;  4C1F A;  4O98 A;  2BG8 B;  3PY5 A;  5A87 A;  2M5D A;  1WUO A;  3ZQ4 A;  4YSB A;  4NQ4 A;  2ZO4 A;  3X2Y A;  1BMC A;  4PVT A;  1X8H A;  3IDZ A;  3AJ3 A;  3BK2 A;  5AHR A;  3IE2 A;  4EXS A;  4BZ3 A;  1DDK A;  4EYL A;  4EFZ A;  1QH3 A;  3PG4 A;  4FSB A;  1KO2 A;  1VJN A;  4NQ6 A;  3G1P A;  4Z67 A;  4AWY B;  3SPU A;  1DD6 A;  3KNS A;  3IEM A;  2Q9U A;  1YCH A;  2I7X A;  1M2X A;  3IE1 A;  1Y44 A;  1P9E A;  4C1H A;  5K4K A;  4AD9 A;  1L9Y A;  2WRS A;  5EVB A;  5ACS A;  3PY6 A;  3IOF A;  5EHT A;  1K07 A;  2ZZI A;  1VME A;  4RAM A;  4YSL A;  2YNT B;  2BFZ A;  5EVD A;  5K0W A;  2XF4 A;  1ZTC A;  2QDS A;  3JXP A;  2FU6 A;  2GFK A;  5LCF A;  3BV6 A;  4UAM A;  2BIB A;  5LLD A;  3ZR9 A;  2Y8A A;  5HH6 A;  3BC2 A;  1VGN A;  5DPX A;  1ZNB A;  4HL1 A;  2A7M A;  5AYA A;  2UYX A;  4UWS B;  4ZEJ A;  2Y87 A;  2BFK A;  4C09 A;  3T9M A;  2P4Z A;  2BGA A;  3WXC A;  4F6Z A;  3X2Z A;  2YNV B;  4XUK A;  4D1V A;  4TYF A;  5HH4 A;  1WUP A;  3FCZ A;  4GYQ A;  4B87 A;  4UWO B;  2P1E A;  5AXO A;  3ZNB A;  3I0V A;  3X30 A;  3SRX A;  3I15 A;  3AF5 A;  2FM6 A;  5ACV A;  2YNU A;  4FEK A;  5LCH A;  5KIK A;  4UWR B;  3VQZ A;  4KEQ A;  2Q0J A;  2FK6 A;  2P97 A;  5K4N A;  4D02 A;  2BG8 A;  3AF6 A;  4HKY A;  5EVK A;  4U4L A;  1WRA A;  1MQO A;  5LSC A;  2ZNB A;  4C1G A;  4RAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...