5B3RA

Crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
214
Chain Sequence
b'LPDLKIEKLEKGVYVHTSFEGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-18
publication title Structural and Mutagenic Analysis of Metallo-beta-Lactamase IMP-18
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 69
structure length 214
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b3rA00
2Q42A 5DPXA 3X2YA 5EHTA 2M5DA 4AX1B 1MQOA 3SD9A 5LLDA 3IE1A 3T3NA 2AZ4A 1QH3A 2NZEA 3ZR9A 3I14A 4Z60A 5AEBA 2I7XA 3RKKA 4KEPA 3KNRA 2HB9A 4AWYB 3RPCA 5A0TA 5B15A 4XWWA 1JT1A 4Z67A 3G1PA 4AD9A 5ACQA 4KEQA 4HL2A 2YNTA 4EYBA 1Y44A 4V0HA 1BVTA 2Q0JA 2P18A 4C1HA 5K0WA 1DD6A 2WYMC 4RAMA 2P1EA 3R2UA 4F6ZA 4YSLA 4WD6A 4C09A 2P4ZA 5EH9A 2YCBA 3AJ3A 3DHAA 2BG2A 4FSBA 3X30A 2H6AA 1XTOA 4EFZA 3KNSA 3FCZA 4TZEA 1WUOA 3VQZA 4YSBA 2R2DA 1VMEA 4D1VA 2BGAA 4Z5ZA 2WHGA 3LVZA 3RKJA 4D1WA 3X2ZA 1ZTCA 1ZNBA 2YZ3A 3WXCA 2GKLA 2BFKA 1WW1A 4C1GA 2GFKA 4GYUA 5A5ZA 3I13A 3SFPA 4TYTA 1DDKA 4RL2A 4BZ3A 3I11A 4AWZA 4AX0B 2DOOA 3IE0A 4RL0A 4NQ6A 5HIPA 3ADRA 2Q9UA 4FR7A 4Z5YA 4CHLA 1WUPA 5HISA 1E5DA 2Q0IA 2FHXB 2XF4A 3SPUA 2BG8A 4RBSA 5B1UA 2FU7A 2BTNA 3PG4A 4UAMA 4EXSA 2YNVA 4P62A 2BFZA 5EV6A 5K4KA 4UA4A 4C1DA 2A7MA 2GFJA 4DILA 5A87A 4HKYA 5HIOA 1ZKPA 5ACPA 2OHHA 5KIKA 2E7YA 2WYMA 4Z6XA 3SBLA 1YCFA 5A0VA 3KL7A 4UBQA 5AXOA 3MD7A 4EYFA 4UWPB 5LCFA 1XM8A 2ZWRA 3BC2A 5K4MA 4FEKA 5EV8A 4UWOB 2BR6A 4RAWA 2NZFA 5KILA 3F9OA 4YSKA 1QH5A 4TZ9A 5ACVA 3SRXA 5IQKA 2BG7A 3P2UA 5AXRA 4NQ2A 5K4NA 5HIQA 4UWRB 3DH8A 4TYFA 3BK2A 3IOGA 3I0VA 5ACUA 4LE6A 3IE2A 3IOFA 2WRSA 1HLKA 5LCAA 1X8HA 5LMCA 2FM6A 2QEDA 4TZFA 4EY2A 4DIKA 2YNWA 3ZWFA 4C1FA 5EW0A 2GMNA 4NQ4A 5EWAA 1YCHA 4NQ5A 2YNUA 2I7TA 2QDSA 5FQBA 2OHJA 5HH4A 1KO2A 4H0DA 2M5CA 3IEKA 5AHRA 2BMIA 3T9MA 2FU6A 2QINA 1SMLA 3IELA 4Z7RA 3ZNBA 4U4LA 2UYXA 5EVBA 3DHCA 3S0ZA 3DHBA 1A8TA 3QH8A 4GYQA 5HH5A 3AF6A 4BP0A 3I15A 2BC2A 1K07A 3SW3A 3IEMA 2YNTB 3T3OA 2DKFA 2BIBA 1KO3A 2FK6A 5ACXA 2Y8AA 3PY5A 4HL1A 4B87A 4EXYA 4EYLA 4J5HA 4D1UA 2FHXA 5HH6A 2ZO4A 5B3RA 3ESHA 1BC2A 3BV6A 5LCHA 3AF5A 1DXKA 2XR1A 5AYAA 3ZQ4A 2Y87A 3A4YA 4O98A 4PVTA 2QDTA 4D02A 1KR3A 3VPEA 5FQCA 5ACSA 4ZO3A 2WYLA 5ACRA 3BK1A 4JO0A 5LM6A 1VGNA 3L6NA 1BMCA 1X8IA 4XUKA 2VW8A 4C1CA 2ZZIA 5LSCA 3H3EA 2FU9A 1WRAA 4D1TA 1JJEA 1X8GA 2P97A 2CBNA 5LS3A 1M2XA 3PY6A 5EVDA 1JJTA 2BG6A 5AHOA 2I7VA 2GCUA 2NXAA 3IDZA 4TZBA 5ACTA 1VJNA 4J5FA 1YCGA 4C1EA 2BFLA 1L9YA 5LE1A 2QJSA 2ZNBA 3TP9A 4XWTA 4GCWA 4F6HA 3FAIA 1P9EA 3JXPA 1A7TA 5EVKA 3X2XA 4ZO2A 5FQAA 2BG8B 3Q6VA 5ACWA 2NYPA 4RM5A 2YNVB 2Y8BA 2BFZB 2AIOA 4ZNBA 4PVOA 4UWSB 4ZEJA 2OHIA 2FU8A
chains in the Genus database with same CATH superfamily
2Q42A 5DPXA 3X2YA 5EHTA 2M5DA 4AX1B 1MQOA 3SD9A 5LLDA 3IE1A 3T3NA 2AZ4A 1QH3A 2NZEA 3ZR9A 3I14A 4Z60A 5AEBA 2I7XA 3RKKA 4KEPA 3KNRA 2HB9A 4AWYB 3RPCA 5A0TA 5B15A 4XWWA 1JT1A 4Z67A 3G1PA 4AD9A 5ACQA 4KEQA 4HL2A 2YNTA 4EYBA 1Y44A 4V0HA 1BVTA 2Q0JA 2P18A 4C1HA 5K0WA 1DD6A 2WYMC 4RAMA 2P1EA 3R2UA 4F6ZA 4YSLA 4WD6A 4C09A 2P4ZA 5EH9A 2YCBA 3AJ3A 3DHAA 2BG2A 4FSBA 3X30A 2H6AA 1XTOA 4EFZA 3KNSA 3FCZA 4TZEA 1WUOA 3VQZA 4YSBA 2R2DA 1VMEA 4D1VA 5AJLA 2BGAA 4Z5ZA 2WHGA 3LVZA 3RKJA 4D1WA 3X2ZA 1ZTCA 1ZNBA 2YZ3A 3WXCA 2GKLA 2BFKA 1WW1A 4C1GA 2GFKA 4GYUA 5A5ZA 3I13A 3SFPA 4TYTA 1DDKA 4RL2A 4BZ3A 3I11A 4AWZA 4AX0B 2DOOA 3IE0A 4RL0A 4NQ6A 5HIPA 3ADRA 2Q9UA 4FR7A 4Z5YA 4CHLA 1WUPA 5HISA 1E5DA 2Q0IA 2FHXB 2XF4A 3SPUA 2BG8A 4RBSA 5B1UA 2FU7A 2BTNA 3PG4A 4UAMA 4EXSA 2YNVA 4P62A 2BFZA 5EV6A 5K4KA 4UA4A 4C1DA 2A7MA 2GFJA 4DILA 5A87A 4HKYA 5HIOA 1ZKPA 5ACPA 2OHHA 5KIKA 2E7YA 2WYMA 4Z6XA 3SBLA 1YCFA 5A0VA 3KL7A 4UBQA 5AXOA 3MD7A 4EYFA 4UWPB 5LCFA 1XM8A 2ZWRA 3BC2A 5K4MA 4FEKA 5EV8A 4UWOB 2BR6A 4RAWA 2NZFA 5KILA 2CFUA 3F9OA 4YSKA 1QH5A 4TZ9A 4AV7A 5ACVA 3SRXA 5IQKA 2BG7A 3P2UA 5AXRA 4NQ2A 5K4NA 5HIQA 4UWRB 3DH8A 4TYFA 3BK2A 3IOGA 3I0VA 5ACUA 4LE6A 3IE2A 3IOFA 2WRSA 1HLKA 5LCAA 1X8HA 5LMCA 2FM6A 2QEDA 4TZFA 4EY2A 4DIKA 2YNWA 3ZWFA 4C1FA 5EW0A 2GMNA 4NQ4A 5EWAA 1YCHA 4NQ5A 2YNUA 2I7TA 5A23A 2QDSA 4NURA 5FQBA 2OHJA 5HH4A 1KO2A 4H0DA 2M5CA 3IEKA 5AHRA 2BMIA 3T9MA 2FU6A 2QINA 1SMLA 3IELA 4Z7RA 3ZNBA 4U4LA 2UYXA 5EVBA 3DHCA 4PDXA 3S0ZA 3DHBA 1A8TA 3QH8A 4GYQA 5HH5A 3AF6A 2CG2A 4BP0A 3I15A 2BC2A 1K07A 3SW3A 3IEMA 2YNTB 3T3OA 2DKFA 2BIBA 1KO3A 2FK6A 5ACXA 2Y8AA 3PY5A 4HL1A 4B87A 4EXYA 4EYLA 4J5HA 4D1UA 2FHXA 5HH6A 2ZO4A 5B3RA 3ESHA 1BC2A 3BV6A 5LCHA 3AF5A 1DXKA 2XR1A 5AYAA 3ZQ4A 2Y87A 3A4YA 4O98A 4PVTA 2QDTA 4D02A 1KR3A 3VPEA 5FQCA 5ACSA 4ZO3A 2WYLA 5ACRA 3BK1A 4JO0A 5LM6A 1VGNA 3L6NA 1BMCA 1X8IA 4XUKA 2VW8A 4C1CA 2ZZIA 5LSCA 4AXHA 3H3EA 2FU9A 1WRAA 4D1TA 1JJEA 1X8GA 2P97A 2CBNA 5LS3A 1M2XA 3PY6A 5EVDA 2CG3A 1JJTA 2BG6A 5AHOA 2I7VA 2GCUA 2NXAA 3IDZA 4TZBA 5ACTA 1VJNA 4J5FA 1YCGA 4C1EA 2BFLA 1L9YA 5LE1A 2QJSA 2ZNBA 3TP9A 4XWTA 4GCWA 4F6HA 3FAIA 1P9EA 3JXPA 1A7TA 5EVKA 3X2XA 4ZO2A 5FQAA 2BG8B 3Q6VA 5ACWA 2NYPA 4RM5A 2YNVB 2Y8BA 2BFZB 2YHEA 2AIOA 4ZNBA 4PVOA 2CFZA 5AIJA 4UWSB 4ZEJA 2OHIA 2FU8A
chains in the Genus database with same CATH topology
2Q42A 5DPXA 3X2YA 5EHTA 2M5DA 4AX1B 1MQOA 3SD9A 5LLDA 3IE1A 3T3NA 2AZ4A 1QH3A 2NZEA 3ZR9A 3I14A 4Z60A 5AEBA 2I7XA 3RKKA 4KEPA 3KNRA 2HB9A 4AWYB 3RPCA 5A0TA 5B15A 4XWWA 1JT1A 4Z67A 3G1PA 4AD9A 5ACQA 4KEQA 4HL2A 2YNTA 4EYBA 1Y44A 4V0HA 1BVTA 2Q0JA 2P18A 4C1HA 5K0WA 1DD6A 2WYMC 4RAMA 2P1EA 3R2UA 4F6ZA 4YSLA 4WD6A 4C09A 2P4ZA 5EH9A 2YCBA 3AJ3A 3DHAA 2BG2A 4FSBA 3X30A 2H6AA 1XTOA 4EFZA 3KNSA 3FCZA 4TZEA 1WUOA 3VQZA 4YSBA 2R2DA 1VMEA 4D1VA 2BGAA 4Z5ZA 2WHGA 3LVZA 3RKJA 4D1WA 3X2ZA 1ZTCA 1ZNBA 2YZ3A 3WXCA 2GKLA 2BFKA 1WW1A 4C1GA 2GFKA 4GYUA 5A5ZA 3I13A 3SFPA 4TYTA 1DDKA 4RL2A 4BZ3A 3I11A 4AWZA 4AX0B 2DOOA 3IE0A 4RL0A 4NQ6A 5HIPA 3ADRA 2Q9UA 4FR7A 4Z5YA 4CHLA 1WUPA 5HISA 1E5DA 2Q0IA 2FHXB 2XF4A 3SPUA 2BG8A 4RBSA 5B1UA 2FU7A 2BTNA 3PG4A 4UAMA 4EXSA 2YNVA 4P62A 2BFZA 5EV6A 5K4KA 4UA4A 4C1DA 2A7MA 2GFJA 4DILA 5A87A 4HKYA 5HIOA 1ZKPA 5ACPA 2OHHA 5KIKA 2E7YA 2WYMA 4Z6XA 3SBLA 1YCFA 5A0VA 3KL7A 4UBQA 5AXOA 3MD7A 4EYFA 4UWPB 5LCFA 1XM8A 2ZWRA 3BC2A 5K4MA 4FEKA 5EV8A 4UWOB 2BR6A 4RAWA 2NZFA 5KILA 3F9OA 4YSKA 1QH5A 4TZ9A 5ACVA 3SRXA 5IQKA 2BG7A 3P2UA 5AXRA 4NQ2A 5K4NA 5HIQA 4UWRB 3DH8A 4TYFA 3BK2A 3IOGA 3I0VA 5ACUA 4LE6A 3IE2A 3IOFA 2WRSA 1HLKA 5LCAA 1X8HA 5LMCA 2FM6A 2QEDA 4TZFA 4EY2A 4DIKA 2YNWA 3ZWFA 4C1FA 5EW0A 2GMNA 4NQ4A 5EWAA 1YCHA 4NQ5A 2YNUA 2I7TA 2QDSA 5FQBA 2OHJA 5HH4A 1KO2A 4H0DA 2M5CA 3IEKA 5AHRA 2BMIA 3T9MA 2FU6A 2QINA 1SMLA 3IELA 4Z7RA 3ZNBA 4U4LA 2UYXA 5EVBA 3DHCA 3S0ZA 3DHBA 1A8TA 3QH8A 4GYQA 5HH5A 3AF6A 4BP0A 3I15A 2BC2A 1K07A 3SW3A 3IEMA 2YNTB 3T3OA 2DKFA 2BIBA 1KO3A 2FK6A 5ACXA 2Y8AA 3PY5A 4HL1A 4B87A 4EXYA 4EYLA 4J5HA 4D1UA 2FHXA 5HH6A 2ZO4A 5B3RA 3ESHA 1BC2A 3BV6A 5LCHA 3AF5A 1DXKA 2XR1A 5AYAA 3ZQ4A 2Y87A 3A4YA 4O98A 4PVTA 2QDTA 4D02A 1KR3A 3VPEA 5FQCA 5ACSA 4ZO3A 2WYLA 5ACRA 3BK1A 4JO0A 5LM6A 1VGNA 3L6NA 1BMCA 1X8IA 4XUKA 2VW8A 4C1CA 2ZZIA 5LSCA 3H3EA 2FU9A 1WRAA 4D1TA 1JJEA 1X8GA 2P97A 2CBNA 5LS3A 1M2XA 3PY6A 5EVDA 1JJTA 2BG6A 5AHOA 2I7VA 2GCUA 2NXAA 3IDZA 4TZBA 5ACTA 1VJNA 4J5FA 1YCGA 4C1EA 2BFLA 1L9YA 5LE1A 2QJSA 2ZNBA 3TP9A 4XWTA 4GCWA 4F6HA 3FAIA 1P9EA 3JXPA 1A7TA 5EVKA 3X2XA 4ZO2A 5FQAA 2BG8B 3Q6VA 5ACWA 2NYPA 4RM5A 2YNVB 2Y8BA 2BFZB 2AIOA 4ZNBA 4PVOA 4UWSB 4ZEJA 2OHIA 2FU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q42 A;  5DPX A;  3X2Y A;  5EHT A;  2M5D A;  4AX1 B;  1MQO A;  3SD9 A;  5LLD A;  3IE1 A;  3T3N A;  2AZ4 A;  1QH3 A;  2NZE A;  3ZR9 A;  3I14 A;  4Z60 A;  5AEB A;  2I7X A;  3RKK A;  4KEP A;  3KNR A;  2HB9 A;  4AWY B;  3RPC A;  5A0T A;  5B15 A;  4XWW A;  1JT1 A;  4Z67 A;  3G1P A;  4AD9 A;  5ACQ A;  4KEQ A;  4HL2 A;  2YNT A;  4EYB A;  1Y44 A;  4V0H A;  1BVT A;  2Q0J A;  2P18 A;  4C1H A;  5K0W A;  1DD6 A;  2WYM C;  4RAM A;  2P1E A;  3R2U A;  4F6Z A;  4YSL A;  4WD6 A;  4C09 A;  2P4Z A;  5EH9 A;  2YCB A;  3AJ3 A;  3DHA A;  2BG2 A;  4FSB A;  3X30 A;  2H6A A;  1XTO A;  4EFZ A;  3KNS A;  3FCZ A;  4TZE A;  1WUO A;  3VQZ A;  4YSB A;  2R2D A;  1VME A;  4D1V A;  2BGA A;  4Z5Z A;  2WHG A;  3LVZ A;  3RKJ A;  4D1W A;  3X2Z A;  1ZTC A;  1ZNB A;  2YZ3 A;  3WXC A;  2GKL A;  2BFK A;  1WW1 A;  4C1G A;  2GFK A;  4GYU A;  5A5Z A;  3I13 A;  3SFP A;  4TYT A;  1DDK A;  4RL2 A;  4BZ3 A;  3I11 A;  4AWZ A;  4AX0 B;  2DOO A;  3IE0 A;  4RL0 A;  4NQ6 A;  5HIP A;  3ADR A;  2Q9U A;  4FR7 A;  4Z5Y A;  4CHL A;  1WUP A;  5HIS A;  1E5D A;  2Q0I A;  2FHX B;  2XF4 A;  3SPU A;  2BG8 A;  4RBS A;  5B1U A;  2FU7 A;  2BTN A;  3PG4 A;  4UAM A;  4EXS A;  2YNV A;  4P62 A;  2BFZ A;  5EV6 A;  5K4K A;  4UA4 A;  4C1D A;  2A7M A;  2GFJ A;  4DIL A;  5A87 A;  4HKY A;  5HIO A;  1ZKP A;  5ACP A;  2OHH A;  5KIK A;  2E7Y A;  2WYM A;  4Z6X A;  3SBL A;  1YCF A;  5A0V A;  3KL7 A;  4UBQ A;  5AXO A;  3MD7 A;  4EYF A;  4UWP B;  5LCF A;  1XM8 A;  2ZWR A;  3BC2 A;  5K4M A;  4FEK A;  5EV8 A;  4UWO B;  2BR6 A;  4RAW A;  2NZF A;  5KIL A;  3F9O A;  4YSK A;  1QH5 A;  4TZ9 A;  5ACV A;  3SRX A;  5IQK A;  2BG7 A;  3P2U A;  5AXR A;  4NQ2 A;  5K4N A;  5HIQ A;  4UWR B;  3DH8 A;  4TYF A;  3BK2 A;  3IOG A;  3I0V A;  5ACU A;  4LE6 A;  3IE2 A;  3IOF A;  2WRS A;  1HLK A;  5LCA A;  1X8H A;  5LMC A;  2FM6 A;  2QED A;  4TZF A;  4EY2 A;  4DIK A;  2YNW A;  3ZWF A;  4C1F A;  5EW0 A;  2GMN A;  4NQ4 A;  5EWA A;  1YCH A;  4NQ5 A;  2YNU A;  2I7T A;  2QDS A;  5FQB A;  2OHJ A;  5HH4 A;  1KO2 A;  4H0D A;  2M5C A;  3IEK A;  5AHR A;  2BMI A;  3T9M A;  2FU6 A;  2QIN A;  1SML A;  3IEL A;  4Z7R A;  3ZNB A;  4U4L A;  2UYX A;  5EVB A;  3DHC A;  3S0Z A;  3DHB A;  1A8T A;  3QH8 A;  4GYQ A;  5HH5 A;  3AF6 A;  4BP0 A;  3I15 A;  2BC2 A;  1K07 A;  3SW3 A;  3IEM A;  2YNT B;  3T3O A;  2DKF A;  2BIB A;  1KO3 A;  2FK6 A;  5ACX A;  2Y8A A;  3PY5 A;  4HL1 A;  4B87 A;  4EXY A;  4EYL A;  4J5H A;  4D1U A;  2FHX A;  5HH6 A;  2ZO4 A;  5B3R A;  3ESH A;  1BC2 A;  3BV6 A;  5LCH A;  3AF5 A;  1DXK A;  2XR1 A;  5AYA A;  3ZQ4 A;  2Y87 A;  3A4Y A;  4O98 A;  4PVT A;  2QDT A;  4D02 A;  1KR3 A;  3VPE A;  5FQC A;  5ACS A;  4ZO3 A;  2WYL A;  5ACR A;  3BK1 A;  4JO0 A;  5LM6 A;  1VGN A;  3L6N A;  1BMC A;  1X8I A;  4XUK A;  2VW8 A;  4C1C A;  2ZZI A;  5LSC A;  3H3E A;  2FU9 A;  1WRA A;  4D1T A;  1JJE A;  1X8G A;  2P97 A;  2CBN A;  5LS3 A;  1M2X A;  3PY6 A;  5EVD A;  1JJT A;  2BG6 A;  5AHO A;  2I7V A;  2GCU A;  2NXA A;  3IDZ A;  4TZB A;  5ACT A;  1VJN A;  4J5F A;  1YCG A;  4C1E A;  2BFL A;  1L9Y A;  5LE1 A;  2QJS A;  2ZNB A;  3TP9 A;  4XWT A;  4GCW A;  4F6H A;  3FAI A;  1P9E A;  3JXP A;  1A7T A;  5EVK A;  3X2X A;  4ZO2 A;  5FQA A;  2BG8 B;  3Q6V A;  5ACW A;  2NYP A;  4RM5 A;  2YNV B;  2Y8B A;  2BFZ B;  2AIO A;  4ZNB A;  4PVO A;  4UWS B;  4ZEJ A;  2OHI A;  2FU8 A; 
#chains in the Genus database with same CATH topology
 2Q42 A;  5DPX A;  3X2Y A;  5EHT A;  2M5D A;  4AX1 B;  1MQO A;  3SD9 A;  5LLD A;  3IE1 A;  3T3N A;  2AZ4 A;  1QH3 A;  2NZE A;  3ZR9 A;  3I14 A;  4Z60 A;  5AEB A;  2I7X A;  3RKK A;  4KEP A;  3KNR A;  2HB9 A;  4AWY B;  3RPC A;  5A0T A;  5B15 A;  4XWW A;  1JT1 A;  4Z67 A;  3G1P A;  4AD9 A;  5ACQ A;  4KEQ A;  4HL2 A;  2YNT A;  4EYB A;  1Y44 A;  4V0H A;  1BVT A;  2Q0J A;  2P18 A;  4C1H A;  5K0W A;  1DD6 A;  2WYM C;  4RAM A;  2P1E A;  3R2U A;  4F6Z A;  4YSL A;  4WD6 A;  4C09 A;  2P4Z A;  5EH9 A;  2YCB A;  3AJ3 A;  3DHA A;  2BG2 A;  4FSB A;  3X30 A;  2H6A A;  1XTO A;  4EFZ A;  3KNS A;  3FCZ A;  4TZE A;  1WUO A;  3VQZ A;  4YSB A;  2R2D A;  1VME A;  4D1V A;  5AJL A;  2BGA A;  4Z5Z A;  2WHG A;  3LVZ A;  3RKJ A;  4D1W A;  3X2Z A;  1ZTC A;  1ZNB A;  2YZ3 A;  3WXC A;  2GKL A;  2BFK A;  1WW1 A;  4C1G A;  2GFK A;  4GYU A;  5A5Z A;  3I13 A;  3SFP A;  4TYT A;  1DDK A;  4RL2 A;  4BZ3 A;  3I11 A;  4AWZ A;  4AX0 B;  2DOO A;  3IE0 A;  4RL0 A;  4NQ6 A;  5HIP A;  3ADR A;  2Q9U A;  4FR7 A;  4Z5Y A;  4CHL A;  1WUP A;  5HIS A;  1E5D A;  2Q0I A;  2FHX B;  2XF4 A;  3SPU A;  2BG8 A;  4RBS A;  5B1U A;  2FU7 A;  2BTN A;  3PG4 A;  4UAM A;  4EXS A;  2YNV A;  4P62 A;  2BFZ A;  5EV6 A;  5K4K A;  4UA4 A;  4C1D A;  2A7M A;  2GFJ A;  4DIL A;  5A87 A;  4HKY A;  5HIO A;  1ZKP A;  5ACP A;  2OHH A;  5KIK A;  2E7Y A;  2WYM A;  4Z6X A;  3SBL A;  1YCF A;  5A0V A;  3KL7 A;  4UBQ A;  5AXO A;  3MD7 A;  4EYF A;  4UWP B;  5LCF A;  1XM8 A;  2ZWR A;  3BC2 A;  5K4M A;  4FEK A;  5EV8 A;  4UWO B;  2BR6 A;  4RAW A;  2NZF A;  5KIL A;  2CFU A;  3F9O A;  4YSK A;  1QH5 A;  4TZ9 A;  4AV7 A;  5ACV A;  3SRX A;  5IQK A;  2BG7 A;  3P2U A;  5AXR A;  4NQ2 A;  5K4N A;  5HIQ A;  4UWR B;  3DH8 A;  4TYF A;  3BK2 A;  3IOG A;  3I0V A;  5ACU A;  4LE6 A;  3IE2 A;  3IOF A;  2WRS A;  1HLK A;  5LCA A;  1X8H A;  5LMC A;  2FM6 A;  2QED A;  4TZF A;  4EY2 A;  4DIK A;  2YNW A;  3ZWF A;  4C1F A;  5EW0 A;  2GMN A;  4NQ4 A;  5EWA A;  1YCH A;  4NQ5 A;  2YNU A;  2I7T A;  5A23 A;  2QDS A;  4NUR A;  5FQB A;  2OHJ A;  5HH4 A;  1KO2 A;  4H0D A;  2M5C A;  3IEK A;  5AHR A;  2BMI A;  3T9M A;  2FU6 A;  2QIN A;  1SML A;  3IEL A;  4Z7R A;  3ZNB A;  4U4L A;  2UYX A;  5EVB A;  3DHC A;  4PDX A;  3S0Z A;  3DHB A;  1A8T A;  3QH8 A;  4GYQ A;  5HH5 A;  3AF6 A;  2CG2 A;  4BP0 A;  3I15 A;  2BC2 A;  1K07 A;  3SW3 A;  3IEM A;  2YNT B;  3T3O A;  2DKF A;  2BIB A;  1KO3 A;  2FK6 A;  5ACX A;  2Y8A A;  3PY5 A;  4HL1 A;  4B87 A;  4EXY A;  4EYL A;  4J5H A;  4D1U A;  2FHX A;  5HH6 A;  2ZO4 A;  5B3R A;  3ESH A;  1BC2 A;  3BV6 A;  5LCH A;  3AF5 A;  1DXK A;  2XR1 A;  5AYA A;  3ZQ4 A;  2Y87 A;  3A4Y A;  4O98 A;  4PVT A;  2QDT A;  4D02 A;  1KR3 A;  3VPE A;  5FQC A;  5ACS A;  4ZO3 A;  2WYL A;  5ACR A;  3BK1 A;  4JO0 A;  5LM6 A;  1VGN A;  3L6N A;  1BMC A;  1X8I A;  4XUK A;  2VW8 A;  4C1C A;  2ZZI A;  5LSC A;  4AXH A;  3H3E A;  2FU9 A;  1WRA A;  4D1T A;  1JJE A;  1X8G A;  2P97 A;  2CBN A;  5LS3 A;  1M2X A;  3PY6 A;  5EVD A;  2CG3 A;  1JJT A;  2BG6 A;  5AHO A;  2I7V A;  2GCU A;  2NXA A;  3IDZ A;  4TZB A;  5ACT A;  1VJN A;  4J5F A;  1YCG A;  4C1E A;  2BFL A;  1L9Y A;  5LE1 A;  2QJS A;  2ZNB A;  3TP9 A;  4XWT A;  4GCW A;  4F6H A;  3FAI A;  1P9E A;  3JXP A;  1A7T A;  5EVK A;  3X2X A;  4ZO2 A;  5FQA A;  2BG8 B;  3Q6V A;  5ACW A;  2NYP A;  4RM5 A;  2YNV B;  2Y8B A;  2BFZ B;  2YHE A;  2AIO A;  4ZNB A;  4PVO A;  2CFZ A;  5AIJ A;  4UWS B;  4ZEJ A;  2OHI A;  2FU8 A; 
#chains in the Genus database with same CATH homology
 2Q42 A;  5DPX A;  3X2Y A;  5EHT A;  2M5D A;  4AX1 B;  1MQO A;  3SD9 A;  5LLD A;  3IE1 A;  3T3N A;  2AZ4 A;  1QH3 A;  2NZE A;  3ZR9 A;  3I14 A;  4Z60 A;  5AEB A;  2I7X A;  3RKK A;  4KEP A;  3KNR A;  2HB9 A;  4AWY B;  3RPC A;  5A0T A;  5B15 A;  4XWW A;  1JT1 A;  4Z67 A;  3G1P A;  4AD9 A;  5ACQ A;  4KEQ A;  4HL2 A;  2YNT A;  4EYB A;  1Y44 A;  4V0H A;  1BVT A;  2Q0J A;  2P18 A;  4C1H A;  5K0W A;  1DD6 A;  2WYM C;  4RAM A;  2P1E A;  3R2U A;  4F6Z A;  4YSL A;  4WD6 A;  4C09 A;  2P4Z A;  5EH9 A;  2YCB A;  3AJ3 A;  3DHA A;  2BG2 A;  4FSB A;  3X30 A;  2H6A A;  1XTO A;  4EFZ A;  3KNS A;  3FCZ A;  4TZE A;  1WUO A;  3VQZ A;  4YSB A;  2R2D A;  1VME A;  4D1V A;  2BGA A;  4Z5Z A;  2WHG A;  3LVZ A;  3RKJ A;  4D1W A;  3X2Z A;  1ZTC A;  1ZNB A;  2YZ3 A;  3WXC A;  2GKL A;  2BFK A;  1WW1 A;  4C1G A;  2GFK A;  4GYU A;  5A5Z A;  3I13 A;  3SFP A;  4TYT A;  1DDK A;  4RL2 A;  4BZ3 A;  3I11 A;  4AWZ A;  4AX0 B;  2DOO A;  3IE0 A;  4RL0 A;  4NQ6 A;  5HIP A;  3ADR A;  2Q9U A;  4FR7 A;  4Z5Y A;  4CHL A;  1WUP A;  5HIS A;  1E5D A;  2Q0I A;  2FHX B;  2XF4 A;  3SPU A;  2BG8 A;  4RBS A;  5B1U A;  2FU7 A;  2BTN A;  3PG4 A;  4UAM A;  4EXS A;  2YNV A;  4P62 A;  2BFZ A;  5EV6 A;  5K4K A;  4UA4 A;  4C1D A;  2A7M A;  2GFJ A;  4DIL A;  5A87 A;  4HKY A;  5HIO A;  1ZKP A;  5ACP A;  2OHH A;  5KIK A;  2E7Y A;  2WYM A;  4Z6X A;  3SBL A;  1YCF A;  5A0V A;  3KL7 A;  4UBQ A;  5AXO A;  3MD7 A;  4EYF A;  4UWP B;  5LCF A;  1XM8 A;  2ZWR A;  3BC2 A;  5K4M A;  4FEK A;  5EV8 A;  4UWO B;  2BR6 A;  4RAW A;  2NZF A;  5KIL A;  3F9O A;  4YSK A;  1QH5 A;  4TZ9 A;  5ACV A;  3SRX A;  5IQK A;  2BG7 A;  3P2U A;  5AXR A;  4NQ2 A;  5K4N A;  5HIQ A;  4UWR B;  3DH8 A;  4TYF A;  3BK2 A;  3IOG A;  3I0V A;  5ACU A;  4LE6 A;  3IE2 A;  3IOF A;  2WRS A;  1HLK A;  5LCA A;  1X8H A;  5LMC A;  2FM6 A;  2QED A;  4TZF A;  4EY2 A;  4DIK A;  2YNW A;  3ZWF A;  4C1F A;  5EW0 A;  2GMN A;  4NQ4 A;  5EWA A;  1YCH A;  4NQ5 A;  2YNU A;  2I7T A;  2QDS A;  5FQB A;  2OHJ A;  5HH4 A;  1KO2 A;  4H0D A;  2M5C A;  3IEK A;  5AHR A;  2BMI A;  3T9M A;  2FU6 A;  2QIN A;  1SML A;  3IEL A;  4Z7R A;  3ZNB A;  4U4L A;  2UYX A;  5EVB A;  3DHC A;  3S0Z A;  3DHB A;  1A8T A;  3QH8 A;  4GYQ A;  5HH5 A;  3AF6 A;  4BP0 A;  3I15 A;  2BC2 A;  1K07 A;  3SW3 A;  3IEM A;  2YNT B;  3T3O A;  2DKF A;  2BIB A;  1KO3 A;  2FK6 A;  5ACX A;  2Y8A A;  3PY5 A;  4HL1 A;  4B87 A;  4EXY A;  4EYL A;  4J5H A;  4D1U A;  2FHX A;  5HH6 A;  2ZO4 A;  5B3R A;  3ESH A;  1BC2 A;  3BV6 A;  5LCH A;  3AF5 A;  1DXK A;  2XR1 A;  5AYA A;  3ZQ4 A;  2Y87 A;  3A4Y A;  4O98 A;  4PVT A;  2QDT A;  4D02 A;  1KR3 A;  3VPE A;  5FQC A;  5ACS A;  4ZO3 A;  2WYL A;  5ACR A;  3BK1 A;  4JO0 A;  5LM6 A;  1VGN A;  3L6N A;  1BMC A;  1X8I A;  4XUK A;  2VW8 A;  4C1C A;  2ZZI A;  5LSC A;  3H3E A;  2FU9 A;  1WRA A;  4D1T A;  1JJE A;  1X8G A;  2P97 A;  2CBN A;  5LS3 A;  1M2X A;  3PY6 A;  5EVD A;  1JJT A;  2BG6 A;  5AHO A;  2I7V A;  2GCU A;  2NXA A;  3IDZ A;  4TZB A;  5ACT A;  1VJN A;  4J5F A;  1YCG A;  4C1E A;  2BFL A;  1L9Y A;  5LE1 A;  2QJS A;  2ZNB A;  3TP9 A;  4XWT A;  4GCW A;  4F6H A;  3FAI A;  1P9E A;  3JXP A;  1A7T A;  5EVK A;  3X2X A;  4ZO2 A;  5FQA A;  2BG8 B;  3Q6V A;  5ACW A;  2NYP A;  4RM5 A;  2YNV B;  2Y8B A;  2BFZ B;  2AIO A;  4ZNB A;  4PVO A;  4UWS B;  4ZEJ A;  2OHI A;  2FU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...