5B3RA

Crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
214
Chain Sequence
b'LPDLKIEKLEKGVYVHTSFEGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of Metallo-beta-Lactamase IMP-18
pubmed doi rcsb
molecule keywords IMP-18
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 69
structure length 214
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b3rA00
2NZFA 5DPXA 4NQ2A 1A7TA 5HH4A 5LLDA 5LCHA 4Z5YA 2WYMA 5A0TA 2Y8AA 1JJEA 1KR3A 2ZNBA 2YNWA 5LS3A 4F6ZA 2YNVB 2NYPA 1X8HA 3DHCA 5ACVA 5K4KA 5AHRA 1DDKA 3X2XA 4XWWA 4WD6A 5B3RA 5ACPA 4UA4A 4F6HA 1XM8A 3Q6VA 3ZR9A 3SFPA 3X2ZA 5LM6A 4ZO3A 2BTNA 2Q0JA 4TZFA 5HISA 4AWZA 5EV8A 4RL0A 2YNTA 3IOFA 4ZNBA 5LMCA 4TZ9A 4Z67A 4EYBA 1WW1A 2YCBA 2FHXA 4J5FA 5ACUA 3IEKA 2YNUA 2OHHA 4UWPB 4BZ3A 2Y8BA 5A5ZA 4C1EA 3ZNBA 4YSLA 3FAIA 2GMNA 2P4ZA 5AXRA 1DXKA 4AX0B 5EWAA 4TZEA 1WUPA 4EXYA 1BC2A 5EVBA 5FQAA 1QH5A 2P97A 4NQ5A 4Z7RA 2XF4A 4FEKA 1JT1A 5KILA 4C1HA 3I13A 5KIKA 2BMIA 2GCUA 2QEDA 2YNVA 3DH8A 3T9MA 1YCGA 4EYLA 4P62A 3AJ3A 1A8TA 3X30A 2OHJA 2H6AA 3A4YA 4AWYB 5EVKA 1YCHA 3L6NA 2BC2A 1X8IA 3G1PA 5HIOA 3KNSA 2BR6A 4PVOA 3RPCA 2BFKA 4D1TA 3PY6A 2BG8B 2FU9A 2I7XA 2QJSA 5ACWA 4XWTA 2DKFA 1Y44A 4EY2A 3IE1A 3IEMA 3BK2A 4GYUA 3BV6A 4D1VA 4NQ4A 3AF6A 2NXAA 2UYXA 3I15A 2Q0IA 2DOOA 5FQCA 3F9OA 1WUOA 1MQOA 3JXPA 5EHTA 2A7MA 5ACQA 4D02A 3FCZA 3TP9A 4KEQA 4O98A 2VW8A 2M5DA 4DILA 5ACTA 2WYMC 1VMEA 2OHIA 4HL2A 1KO3A 1HLKA 4C1FA 2GFKA 4UAMA 2NZEA 5A87A 3SRXA 4RBSA 1L9YA 1ZKPA 1XTOA 4C1CA 5EH9A 3SW3A 1ZTCA 4HKYA 1P9EA 4PVTA 4BP0A 5LCAA 2BG8A 4UBQA 2BG2A 4CHLA 5K4NA 4C1GA 2YZ3A 2AZ4A 3SBLA 5HH5A 1KO2A 2CBNA 2AIOA 2FM6A 3X2YA 3ESHA 5B15A 2ZZIA 4HL1A 2FU7A 4C09A 2Y87A 4U4LA 2XR1A 1JJTA 5FQBA 2BFZB 4EYFA 2GFJA 4NQ6A 5K0WA 4RAWA 4JO0A 3VPEA 5K4MA 3QH8A 2FU6A 3I14A 3SD9A 4FSBA 2BGAA 4GYQA 5EV6A 3P2UA 2I7TA 1BVTA 3I0VA 3IDZA 3DHAA 2Q42A 3RKJA 3DHBA 4YSKA 3SPUA 2ZO4A 1VJNA 1K07A 5B1UA 2BG6A 1BMCA 4UWSB 1M2XA 1E5DA 3KL7A 3PY5A 2WHGA 4AD9A 2WRSA 1X8GA 3IELA 3T3NA 4Z6XA 2E7YA 5ACSA 3RKKA 3BC2A 2R2DA 4H0DA 5A0VA 1SMLA 1WRAA 4DIKA 1YCFA 3IOGA 3S0ZA 5AHOA 5IQKA 4B87A 4YSBA 4EXSA 2BG7A 4TYFA 2QDTA 5EVDA 4V0HA 5HH6A 1VGNA 5AXOA 2QDSA 1QH3A 3MD7A 2Q9UA 4Z5ZA 4Z60A 4TZBA 4ZO2A 2BFZA 3WXCA 2FK6A 2FU8A 3ADRA 5ACRA 3LVZA 2ZWRA 4XUKA 2I7VA 3VQZA 4J5HA 2M5CA 1ZNBA 4UWRB 5LE1A 4ZEJA 5LCFA 4C1DA 3H3EA 2BFLA 4KEPA 5AYAA 3R2UA 3ZWFA 3T3OA 4D1UA 2QINA 4AX1B 3IE0A 2HB9A 3PG4A 4D1WA 4RL2A 2YNTB 1DD6A 5AEBA 2BIBA 3AF5A 4TYTA 4UWOB 4EFZA 2FHXB 2GKLA 3I11A 4RAMA 2WYLA 3ZQ4A 5ACXA 3KNRA 5LSCA 5HIQA 2P1EA 5HIPA 4LE6A 4GCWA 4RM5A 4FR7A 5EW0A 3BK1A 3IE2A 2P18A
chains in the Genus database with same CATH superfamily
2NZFA 5DPXA 4NQ2A 1A7TA 5HH4A 5LLDA 5LCHA 4Z5YA 2WYMA 5A0TA 2Y8AA 1JJEA 1KR3A 2ZNBA 2YNWA 5LS3A 4F6ZA 2YNVB 2NYPA 1X8HA 3DHCA 5ACVA 5K4KA 5AHRA 1DDKA 3X2XA 4XWWA 4WD6A 5B3RA 5ACPA 4UA4A 4F6HA 1XM8A 3Q6VA 3ZR9A 3SFPA 3X2ZA 5LM6A 4ZO3A 2BTNA 2Q0JA 4TZFA 5HISA 4AWZA 5EV8A 4RL0A 2YNTA 3IOFA 4ZNBA 5LMCA 4TZ9A 4Z67A 4EYBA 1WW1A 2YCBA 2FHXA 4NURA 4J5FA 5ACUA 3IEKA 2YNUA 2OHHA 4UWPB 4BZ3A 2Y8BA 5A5ZA 4C1EA 3ZNBA 4YSLA 3FAIA 2GMNA 2P4ZA 5AXRA 1DXKA 4AX0B 5EWAA 4TZEA 1WUPA 4EXYA 1BC2A 5EVBA 5FQAA 1QH5A 2P97A 4NQ5A 4Z7RA 2XF4A 4FEKA 1JT1A 5KILA 4C1HA 3I13A 5KIKA 2BMIA 2GCUA 2QEDA 2YNVA 3DH8A 3T9MA 1YCGA 4EYLA 4P62A 3AJ3A 1A8TA 3X30A 2OHJA 2H6AA 3A4YA 4AWYB 5EVKA 1YCHA 3L6NA 2BC2A 1X8IA 3G1PA 5HIOA 3KNSA 2BR6A 4PVOA 3RPCA 2BFKA 4D1TA 3PY6A 2BG8B 2FU9A 2I7XA 2QJSA 5ACWA 4XWTA 2DKFA 1Y44A 4EY2A 3IE1A 3IEMA 3BK2A 4GYUA 3BV6A 4D1VA 4NQ4A 3AF6A 2NXAA 2UYXA 3I15A 2Q0IA 2DOOA 5FQCA 3F9OA 2CG2A 1WUOA 1MQOA 3JXPA 5EHTA 2A7MA 5ACQA 4D02A 3FCZA 3TP9A 4KEQA 4O98A 2VW8A 2M5DA 2CG3A 4DILA 5ACTA 2WYMC 1VMEA 2OHIA 4HL2A 1KO3A 1HLKA 4C1FA 2GFKA 4UAMA 2NZEA 5A87A 3SRXA 4RBSA 1L9YA 2YHEA 1ZKPA 1XTOA 4C1CA 5EH9A 3SW3A 1ZTCA 4HKYA 1P9EA 4PVTA 4BP0A 5LCAA 2BG8A 4UBQA 2BG2A 4CHLA 5K4NA 4C1GA 2YZ3A 2AZ4A 3SBLA 5HH5A 1KO2A 2CBNA 2AIOA 2FM6A 2CFZA 3X2YA 3ESHA 5B15A 2ZZIA 4HL1A 2FU7A 4C09A 2Y87A 4U4LA 2XR1A 1JJTA 5FQBA 2BFZB 4EYFA 2GFJA 4NQ6A 5K0WA 4RAWA 4JO0A 3VPEA 5K4MA 3QH8A 2FU6A 3I14A 3SD9A 4FSBA 2BGAA 4GYQA 4PDXA 5EV6A 3P2UA 2I7TA 1BVTA 3I0VA 3IDZA 3DHAA 2Q42A 3RKJA 3DHBA 4YSKA 3SPUA 2ZO4A 4AV7A 1VJNA 1K07A 5A23A 5B1UA 2BG6A 1BMCA 4UWSB 1M2XA 1E5DA 3KL7A 5AIJA 3PY5A 2WHGA 4AD9A 2WRSA 1X8GA 3IELA 3T3NA 4Z6XA 2E7YA 5ACSA 3RKKA 3BC2A 2R2DA 4H0DA 5A0VA 1SMLA 1WRAA 4DIKA 1YCFA 3IOGA 3S0ZA 5AHOA 5IQKA 2CFUA 4B87A 4YSBA 4EXSA 2BG7A 4TYFA 2QDTA 5EVDA 4V0HA 5HH6A 1VGNA 5AXOA 2QDSA 1QH3A 3MD7A 2Q9UA 4Z5ZA 4Z60A 4TZBA 4ZO2A 2BFZA 3WXCA 2FK6A 2FU8A 3ADRA 5ACRA 3LVZA 2ZWRA 4XUKA 2I7VA 3VQZA 4J5HA 2M5CA 1ZNBA 5AJLA 4UWRB 5LE1A 4ZEJA 5LCFA 4C1DA 3H3EA 2BFLA 4KEPA 5AYAA 3R2UA 3ZWFA 3T3OA 4D1UA 2QINA 4AX1B 3IE0A 2HB9A 3PG4A 4D1WA 4RL2A 2YNTB 1DD6A 5AEBA 2BIBA 3AF5A 4TYTA 4UWOB 4EFZA 2FHXB 2GKLA 3I11A 4RAMA 2WYLA 3ZQ4A 5ACXA 3KNRA 5LSCA 5HIQA 2P1EA 5HIPA 4LE6A 4GCWA 4RM5A 4AXHA 4FR7A 5EW0A 3BK1A 3IE2A 2P18A
chains in the Genus database with same CATH topology
2NZFA 5DPXA 4NQ2A 1A7TA 5HH4A 5LLDA 5LCHA 4Z5YA 2WYMA 5A0TA 2Y8AA 1JJEA 1KR3A 2ZNBA 2YNWA 5LS3A 4F6ZA 2YNVB 2NYPA 1X8HA 3DHCA 5ACVA 5K4KA 5AHRA 1DDKA 3X2XA 4XWWA 4WD6A 5B3RA 5ACPA 4UA4A 4F6HA 1XM8A 3Q6VA 3ZR9A 3SFPA 3X2ZA 5LM6A 4ZO3A 2BTNA 2Q0JA 4TZFA 5HISA 4AWZA 5EV8A 4RL0A 2YNTA 3IOFA 4ZNBA 5LMCA 4TZ9A 4Z67A 4EYBA 1WW1A 2YCBA 2FHXA 4J5FA 5ACUA 3IEKA 2YNUA 2OHHA 4UWPB 4BZ3A 2Y8BA 5A5ZA 4C1EA 3ZNBA 4YSLA 3FAIA 2GMNA 2P4ZA 5AXRA 1DXKA 4AX0B 5EWAA 4TZEA 1WUPA 4EXYA 1BC2A 5EVBA 5FQAA 1QH5A 2P97A 4NQ5A 4Z7RA 2XF4A 4FEKA 1JT1A 5KILA 4C1HA 3I13A 5KIKA 2BMIA 2GCUA 2QEDA 2YNVA 3DH8A 3T9MA 1YCGA 4EYLA 4P62A 3AJ3A 1A8TA 3X30A 2OHJA 2H6AA 3A4YA 4AWYB 5EVKA 1YCHA 3L6NA 2BC2A 1X8IA 3G1PA 5HIOA 3KNSA 2BR6A 4PVOA 3RPCA 2BFKA 4D1TA 3PY6A 2BG8B 2FU9A 2I7XA 2QJSA 5ACWA 4XWTA 2DKFA 1Y44A 4EY2A 3IE1A 3IEMA 3BK2A 4GYUA 3BV6A 4D1VA 4NQ4A 3AF6A 2NXAA 2UYXA 3I15A 2Q0IA 2DOOA 5FQCA 3F9OA 1WUOA 1MQOA 3JXPA 5EHTA 2A7MA 5ACQA 4D02A 3FCZA 3TP9A 4KEQA 4O98A 2VW8A 2M5DA 4DILA 5ACTA 2WYMC 1VMEA 2OHIA 4HL2A 1KO3A 1HLKA 4C1FA 2GFKA 4UAMA 2NZEA 5A87A 3SRXA 4RBSA 1L9YA 1ZKPA 1XTOA 4C1CA 5EH9A 3SW3A 1ZTCA 4HKYA 1P9EA 4PVTA 4BP0A 5LCAA 2BG8A 4UBQA 2BG2A 4CHLA 5K4NA 4C1GA 2YZ3A 2AZ4A 3SBLA 5HH5A 1KO2A 2CBNA 2AIOA 2FM6A 3X2YA 3ESHA 5B15A 2ZZIA 4HL1A 2FU7A 4C09A 2Y87A 4U4LA 2XR1A 1JJTA 5FQBA 2BFZB 4EYFA 2GFJA 4NQ6A 5K0WA 4RAWA 4JO0A 3VPEA 5K4MA 3QH8A 2FU6A 3I14A 3SD9A 4FSBA 2BGAA 4GYQA 5EV6A 3P2UA 2I7TA 1BVTA 3I0VA 3IDZA 3DHAA 2Q42A 3RKJA 3DHBA 4YSKA 3SPUA 2ZO4A 1VJNA 1K07A 5B1UA 2BG6A 1BMCA 4UWSB 1M2XA 1E5DA 3KL7A 3PY5A 2WHGA 4AD9A 2WRSA 1X8GA 3IELA 3T3NA 4Z6XA 2E7YA 5ACSA 3RKKA 3BC2A 2R2DA 4H0DA 5A0VA 1SMLA 1WRAA 4DIKA 1YCFA 3IOGA 3S0ZA 5AHOA 5IQKA 4B87A 4YSBA 4EXSA 2BG7A 4TYFA 2QDTA 5EVDA 4V0HA 5HH6A 1VGNA 5AXOA 2QDSA 1QH3A 3MD7A 2Q9UA 4Z5ZA 4Z60A 4TZBA 4ZO2A 2BFZA 3WXCA 2FK6A 2FU8A 3ADRA 5ACRA 3LVZA 2ZWRA 4XUKA 2I7VA 3VQZA 4J5HA 2M5CA 1ZNBA 4UWRB 5LE1A 4ZEJA 5LCFA 4C1DA 3H3EA 2BFLA 4KEPA 5AYAA 3R2UA 3ZWFA 3T3OA 4D1UA 2QINA 4AX1B 3IE0A 2HB9A 3PG4A 4D1WA 4RL2A 2YNTB 1DD6A 5AEBA 2BIBA 3AF5A 4TYTA 4UWOB 4EFZA 2FHXB 2GKLA 3I11A 4RAMA 2WYLA 3ZQ4A 5ACXA 3KNRA 5LSCA 5HIQA 2P1EA 5HIPA 4LE6A 4GCWA 4RM5A 4FR7A 5EW0A 3BK1A 3IE2A 2P18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZF A;  5DPX A;  4NQ2 A;  1A7T A;  5HH4 A;  5LLD A;  5LCH A;  4Z5Y A;  2WYM A;  5A0T A;  2Y8A A;  1JJE A;  1KR3 A;  2ZNB A;  2YNW A;  5LS3 A;  4F6Z A;  2YNV B;  2NYP A;  1X8H A;  3DHC A;  5ACV A;  5K4K A;  5AHR A;  1DDK A;  3X2X A;  4XWW A;  4WD6 A;  5B3R A;  5ACP A;  4UA4 A;  4F6H A;  1XM8 A;  3Q6V A;  3ZR9 A;  3SFP A;  3X2Z A;  5LM6 A;  4ZO3 A;  2BTN A;  2Q0J A;  4TZF A;  5HIS A;  4AWZ A;  5EV8 A;  4RL0 A;  2YNT A;  3IOF A;  4ZNB A;  5LMC A;  4TZ9 A;  4Z67 A;  4EYB A;  1WW1 A;  2YCB A;  2FHX A;  4J5F A;  5ACU A;  3IEK A;  2YNU A;  2OHH A;  4UWP B;  4BZ3 A;  2Y8B A;  5A5Z A;  4C1E A;  3ZNB A;  4YSL A;  3FAI A;  2GMN A;  2P4Z A;  5AXR A;  1DXK A;  4AX0 B;  5EWA A;  4TZE A;  1WUP A;  4EXY A;  1BC2 A;  5EVB A;  5FQA A;  1QH5 A;  2P97 A;  4NQ5 A;  4Z7R A;  2XF4 A;  4FEK A;  1JT1 A;  5KIL A;  4C1H A;  3I13 A;  5KIK A;  2BMI A;  2GCU A;  2QED A;  2YNV A;  3DH8 A;  3T9M A;  1YCG A;  4EYL A;  4P62 A;  3AJ3 A;  1A8T A;  3X30 A;  2OHJ A;  2H6A A;  3A4Y A;  4AWY B;  5EVK A;  1YCH A;  3L6N A;  2BC2 A;  1X8I A;  3G1P A;  5HIO A;  3KNS A;  2BR6 A;  4PVO A;  3RPC A;  2BFK A;  4D1T A;  3PY6 A;  2BG8 B;  2FU9 A;  2I7X A;  2QJS A;  5ACW A;  4XWT A;  2DKF A;  1Y44 A;  4EY2 A;  3IE1 A;  3IEM A;  3BK2 A;  4GYU A;  3BV6 A;  4D1V A;  4NQ4 A;  3AF6 A;  2NXA A;  2UYX A;  3I15 A;  2Q0I A;  2DOO A;  5FQC A;  3F9O A;  1WUO A;  1MQO A;  3JXP A;  5EHT A;  2A7M A;  5ACQ A;  4D02 A;  3FCZ A;  3TP9 A;  4KEQ A;  4O98 A;  2VW8 A;  2M5D A;  4DIL A;  5ACT A;  2WYM C;  1VME A;  2OHI A;  4HL2 A;  1KO3 A;  1HLK A;  4C1F A;  2GFK A;  4UAM A;  2NZE A;  5A87 A;  3SRX A;  4RBS A;  1L9Y A;  1ZKP A;  1XTO A;  4C1C A;  5EH9 A;  3SW3 A;  1ZTC A;  4HKY A;  1P9E A;  4PVT A;  4BP0 A;  5LCA A;  2BG8 A;  4UBQ A;  2BG2 A;  4CHL A;  5K4N A;  4C1G A;  2YZ3 A;  2AZ4 A;  3SBL A;  5HH5 A;  1KO2 A;  2CBN A;  2AIO A;  2FM6 A;  3X2Y A;  3ESH A;  5B15 A;  2ZZI A;  4HL1 A;  2FU7 A;  4C09 A;  2Y87 A;  4U4L A;  2XR1 A;  1JJT A;  5FQB A;  2BFZ B;  4EYF A;  2GFJ A;  4NQ6 A;  5K0W A;  4RAW A;  4JO0 A;  3VPE A;  5K4M A;  3QH8 A;  2FU6 A;  3I14 A;  3SD9 A;  4FSB A;  2BGA A;  4GYQ A;  5EV6 A;  3P2U A;  2I7T A;  1BVT A;  3I0V A;  3IDZ A;  3DHA A;  2Q42 A;  3RKJ A;  3DHB A;  4YSK A;  3SPU A;  2ZO4 A;  1VJN A;  1K07 A;  5B1U A;  2BG6 A;  1BMC A;  4UWS B;  1M2X A;  1E5D A;  3KL7 A;  3PY5 A;  2WHG A;  4AD9 A;  2WRS A;  1X8G A;  3IEL A;  3T3N A;  4Z6X A;  2E7Y A;  5ACS A;  3RKK A;  3BC2 A;  2R2D A;  4H0D A;  5A0V A;  1SML A;  1WRA A;  4DIK A;  1YCF A;  3IOG A;  3S0Z A;  5AHO A;  5IQK A;  4B87 A;  4YSB A;  4EXS A;  2BG7 A;  4TYF A;  2QDT A;  5EVD A;  4V0H A;  5HH6 A;  1VGN A;  5AXO A;  2QDS A;  1QH3 A;  3MD7 A;  2Q9U A;  4Z5Z A;  4Z60 A;  4TZB A;  4ZO2 A;  2BFZ A;  3WXC A;  2FK6 A;  2FU8 A;  3ADR A;  5ACR A;  3LVZ A;  2ZWR A;  4XUK A;  2I7V A;  3VQZ A;  4J5H A;  2M5C A;  1ZNB A;  4UWR B;  5LE1 A;  4ZEJ A;  5LCF A;  4C1D A;  3H3E A;  2BFL A;  4KEP A;  5AYA A;  3R2U A;  3ZWF A;  3T3O A;  4D1U A;  2QIN A;  4AX1 B;  3IE0 A;  2HB9 A;  3PG4 A;  4D1W A;  4RL2 A;  2YNT B;  1DD6 A;  5AEB A;  2BIB A;  3AF5 A;  4TYT A;  4UWO B;  4EFZ A;  2FHX B;  2GKL A;  3I11 A;  4RAM A;  2WYL A;  3ZQ4 A;  5ACX A;  3KNR A;  5LSC A;  5HIQ A;  2P1E A;  5HIP A;  4LE6 A;  4GCW A;  4RM5 A;  4FR7 A;  5EW0 A;  3BK1 A;  3IE2 A;  2P18 A; 
#chains in the Genus database with same CATH topology
 2NZF A;  5DPX A;  4NQ2 A;  1A7T A;  5HH4 A;  5LLD A;  5LCH A;  4Z5Y A;  2WYM A;  5A0T A;  2Y8A A;  1JJE A;  1KR3 A;  2ZNB A;  2YNW A;  5LS3 A;  4F6Z A;  2YNV B;  2NYP A;  1X8H A;  3DHC A;  5ACV A;  5K4K A;  5AHR A;  1DDK A;  3X2X A;  4XWW A;  4WD6 A;  5B3R A;  5ACP A;  4UA4 A;  4F6H A;  1XM8 A;  3Q6V A;  3ZR9 A;  3SFP A;  3X2Z A;  5LM6 A;  4ZO3 A;  2BTN A;  2Q0J A;  4TZF A;  5HIS A;  4AWZ A;  5EV8 A;  4RL0 A;  2YNT A;  3IOF A;  4ZNB A;  5LMC A;  4TZ9 A;  4Z67 A;  4EYB A;  1WW1 A;  2YCB A;  2FHX A;  4NUR A;  4J5F A;  5ACU A;  3IEK A;  2YNU A;  2OHH A;  4UWP B;  4BZ3 A;  2Y8B A;  5A5Z A;  4C1E A;  3ZNB A;  4YSL A;  3FAI A;  2GMN A;  2P4Z A;  5AXR A;  1DXK A;  4AX0 B;  5EWA A;  4TZE A;  1WUP A;  4EXY A;  1BC2 A;  5EVB A;  5FQA A;  1QH5 A;  2P97 A;  4NQ5 A;  4Z7R A;  2XF4 A;  4FEK A;  1JT1 A;  5KIL A;  4C1H A;  3I13 A;  5KIK A;  2BMI A;  2GCU A;  2QED A;  2YNV A;  3DH8 A;  3T9M A;  1YCG A;  4EYL A;  4P62 A;  3AJ3 A;  1A8T A;  3X30 A;  2OHJ A;  2H6A A;  3A4Y A;  4AWY B;  5EVK A;  1YCH A;  3L6N A;  2BC2 A;  1X8I A;  3G1P A;  5HIO A;  3KNS A;  2BR6 A;  4PVO A;  3RPC A;  2BFK A;  4D1T A;  3PY6 A;  2BG8 B;  2FU9 A;  2I7X A;  2QJS A;  5ACW A;  4XWT A;  2DKF A;  1Y44 A;  4EY2 A;  3IE1 A;  3IEM A;  3BK2 A;  4GYU A;  3BV6 A;  4D1V A;  4NQ4 A;  3AF6 A;  2NXA A;  2UYX A;  3I15 A;  2Q0I A;  2DOO A;  5FQC A;  3F9O A;  2CG2 A;  1WUO A;  1MQO A;  3JXP A;  5EHT A;  2A7M A;  5ACQ A;  4D02 A;  3FCZ A;  3TP9 A;  4KEQ A;  4O98 A;  2VW8 A;  2M5D A;  2CG3 A;  4DIL A;  5ACT A;  2WYM C;  1VME A;  2OHI A;  4HL2 A;  1KO3 A;  1HLK A;  4C1F A;  2GFK A;  4UAM A;  2NZE A;  5A87 A;  3SRX A;  4RBS A;  1L9Y A;  2YHE A;  1ZKP A;  1XTO A;  4C1C A;  5EH9 A;  3SW3 A;  1ZTC A;  4HKY A;  1P9E A;  4PVT A;  4BP0 A;  5LCA A;  2BG8 A;  4UBQ A;  2BG2 A;  4CHL A;  5K4N A;  4C1G A;  2YZ3 A;  2AZ4 A;  3SBL A;  5HH5 A;  1KO2 A;  2CBN A;  2AIO A;  2FM6 A;  2CFZ A;  3X2Y A;  3ESH A;  5B15 A;  2ZZI A;  4HL1 A;  2FU7 A;  4C09 A;  2Y87 A;  4U4L A;  2XR1 A;  1JJT A;  5FQB A;  2BFZ B;  4EYF A;  2GFJ A;  4NQ6 A;  5K0W A;  4RAW A;  4JO0 A;  3VPE A;  5K4M A;  3QH8 A;  2FU6 A;  3I14 A;  3SD9 A;  4FSB A;  2BGA A;  4GYQ A;  4PDX A;  5EV6 A;  3P2U A;  2I7T A;  1BVT A;  3I0V A;  3IDZ A;  3DHA A;  2Q42 A;  3RKJ A;  3DHB A;  4YSK A;  3SPU A;  2ZO4 A;  4AV7 A;  1VJN A;  1K07 A;  5A23 A;  5B1U A;  2BG6 A;  1BMC A;  4UWS B;  1M2X A;  1E5D A;  3KL7 A;  5AIJ A;  3PY5 A;  2WHG A;  4AD9 A;  2WRS A;  1X8G A;  3IEL A;  3T3N A;  4Z6X A;  2E7Y A;  5ACS A;  3RKK A;  3BC2 A;  2R2D A;  4H0D A;  5A0V A;  1SML A;  1WRA A;  4DIK A;  1YCF A;  3IOG A;  3S0Z A;  5AHO A;  5IQK A;  2CFU A;  4B87 A;  4YSB A;  4EXS A;  2BG7 A;  4TYF A;  2QDT A;  5EVD A;  4V0H A;  5HH6 A;  1VGN A;  5AXO A;  2QDS A;  1QH3 A;  3MD7 A;  2Q9U A;  4Z5Z A;  4Z60 A;  4TZB A;  4ZO2 A;  2BFZ A;  3WXC A;  2FK6 A;  2FU8 A;  3ADR A;  5ACR A;  3LVZ A;  2ZWR A;  4XUK A;  2I7V A;  3VQZ A;  4J5H A;  2M5C A;  1ZNB A;  5AJL A;  4UWR B;  5LE1 A;  4ZEJ A;  5LCF A;  4C1D A;  3H3E A;  2BFL A;  4KEP A;  5AYA A;  3R2U A;  3ZWF A;  3T3O A;  4D1U A;  2QIN A;  4AX1 B;  3IE0 A;  2HB9 A;  3PG4 A;  4D1W A;  4RL2 A;  2YNT B;  1DD6 A;  5AEB A;  2BIB A;  3AF5 A;  4TYT A;  4UWO B;  4EFZ A;  2FHX B;  2GKL A;  3I11 A;  4RAM A;  2WYL A;  3ZQ4 A;  5ACX A;  3KNR A;  5LSC A;  5HIQ A;  2P1E A;  5HIP A;  4LE6 A;  4GCW A;  4RM5 A;  4AXH A;  4FR7 A;  5EW0 A;  3BK1 A;  3IE2 A;  2P18 A; 
#chains in the Genus database with same CATH homology
 2NZF A;  5DPX A;  4NQ2 A;  1A7T A;  5HH4 A;  5LLD A;  5LCH A;  4Z5Y A;  2WYM A;  5A0T A;  2Y8A A;  1JJE A;  1KR3 A;  2ZNB A;  2YNW A;  5LS3 A;  4F6Z A;  2YNV B;  2NYP A;  1X8H A;  3DHC A;  5ACV A;  5K4K A;  5AHR A;  1DDK A;  3X2X A;  4XWW A;  4WD6 A;  5B3R A;  5ACP A;  4UA4 A;  4F6H A;  1XM8 A;  3Q6V A;  3ZR9 A;  3SFP A;  3X2Z A;  5LM6 A;  4ZO3 A;  2BTN A;  2Q0J A;  4TZF A;  5HIS A;  4AWZ A;  5EV8 A;  4RL0 A;  2YNT A;  3IOF A;  4ZNB A;  5LMC A;  4TZ9 A;  4Z67 A;  4EYB A;  1WW1 A;  2YCB A;  2FHX A;  4J5F A;  5ACU A;  3IEK A;  2YNU A;  2OHH A;  4UWP B;  4BZ3 A;  2Y8B A;  5A5Z A;  4C1E A;  3ZNB A;  4YSL A;  3FAI A;  2GMN A;  2P4Z A;  5AXR A;  1DXK A;  4AX0 B;  5EWA A;  4TZE A;  1WUP A;  4EXY A;  1BC2 A;  5EVB A;  5FQA A;  1QH5 A;  2P97 A;  4NQ5 A;  4Z7R A;  2XF4 A;  4FEK A;  1JT1 A;  5KIL A;  4C1H A;  3I13 A;  5KIK A;  2BMI A;  2GCU A;  2QED A;  2YNV A;  3DH8 A;  3T9M A;  1YCG A;  4EYL A;  4P62 A;  3AJ3 A;  1A8T A;  3X30 A;  2OHJ A;  2H6A A;  3A4Y A;  4AWY B;  5EVK A;  1YCH A;  3L6N A;  2BC2 A;  1X8I A;  3G1P A;  5HIO A;  3KNS A;  2BR6 A;  4PVO A;  3RPC A;  2BFK A;  4D1T A;  3PY6 A;  2BG8 B;  2FU9 A;  2I7X A;  2QJS A;  5ACW A;  4XWT A;  2DKF A;  1Y44 A;  4EY2 A;  3IE1 A;  3IEM A;  3BK2 A;  4GYU A;  3BV6 A;  4D1V A;  4NQ4 A;  3AF6 A;  2NXA A;  2UYX A;  3I15 A;  2Q0I A;  2DOO A;  5FQC A;  3F9O A;  1WUO A;  1MQO A;  3JXP A;  5EHT A;  2A7M A;  5ACQ A;  4D02 A;  3FCZ A;  3TP9 A;  4KEQ A;  4O98 A;  2VW8 A;  2M5D A;  4DIL A;  5ACT A;  2WYM C;  1VME A;  2OHI A;  4HL2 A;  1KO3 A;  1HLK A;  4C1F A;  2GFK A;  4UAM A;  2NZE A;  5A87 A;  3SRX A;  4RBS A;  1L9Y A;  1ZKP A;  1XTO A;  4C1C A;  5EH9 A;  3SW3 A;  1ZTC A;  4HKY A;  1P9E A;  4PVT A;  4BP0 A;  5LCA A;  2BG8 A;  4UBQ A;  2BG2 A;  4CHL A;  5K4N A;  4C1G A;  2YZ3 A;  2AZ4 A;  3SBL A;  5HH5 A;  1KO2 A;  2CBN A;  2AIO A;  2FM6 A;  3X2Y A;  3ESH A;  5B15 A;  2ZZI A;  4HL1 A;  2FU7 A;  4C09 A;  2Y87 A;  4U4L A;  2XR1 A;  1JJT A;  5FQB A;  2BFZ B;  4EYF A;  2GFJ A;  4NQ6 A;  5K0W A;  4RAW A;  4JO0 A;  3VPE A;  5K4M A;  3QH8 A;  2FU6 A;  3I14 A;  3SD9 A;  4FSB A;  2BGA A;  4GYQ A;  5EV6 A;  3P2U A;  2I7T A;  1BVT A;  3I0V A;  3IDZ A;  3DHA A;  2Q42 A;  3RKJ A;  3DHB A;  4YSK A;  3SPU A;  2ZO4 A;  1VJN A;  1K07 A;  5B1U A;  2BG6 A;  1BMC A;  4UWS B;  1M2X A;  1E5D A;  3KL7 A;  3PY5 A;  2WHG A;  4AD9 A;  2WRS A;  1X8G A;  3IEL A;  3T3N A;  4Z6X A;  2E7Y A;  5ACS A;  3RKK A;  3BC2 A;  2R2D A;  4H0D A;  5A0V A;  1SML A;  1WRA A;  4DIK A;  1YCF A;  3IOG A;  3S0Z A;  5AHO A;  5IQK A;  4B87 A;  4YSB A;  4EXS A;  2BG7 A;  4TYF A;  2QDT A;  5EVD A;  4V0H A;  5HH6 A;  1VGN A;  5AXO A;  2QDS A;  1QH3 A;  3MD7 A;  2Q9U A;  4Z5Z A;  4Z60 A;  4TZB A;  4ZO2 A;  2BFZ A;  3WXC A;  2FK6 A;  2FU8 A;  3ADR A;  5ACR A;  3LVZ A;  2ZWR A;  4XUK A;  2I7V A;  3VQZ A;  4J5H A;  2M5C A;  1ZNB A;  4UWR B;  5LE1 A;  4ZEJ A;  5LCF A;  4C1D A;  3H3E A;  2BFL A;  4KEP A;  5AYA A;  3R2U A;  3ZWF A;  3T3O A;  4D1U A;  2QIN A;  4AX1 B;  3IE0 A;  2HB9 A;  3PG4 A;  4D1W A;  4RL2 A;  2YNT B;  1DD6 A;  5AEB A;  2BIB A;  3AF5 A;  4TYT A;  4UWO B;  4EFZ A;  2FHX B;  2GKL A;  3I11 A;  4RAM A;  2WYL A;  3ZQ4 A;  5ACX A;  3KNR A;  5LSC A;  5HIQ A;  2P1E A;  5HIP A;  4LE6 A;  4GCW A;  4RM5 A;  4FR7 A;  5EW0 A;  3BK1 A;  3IE2 A;  2P18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...