5B3RA

Crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
214
Chain Sequence
LPDLKIEKLEKGVYVHTSFEGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of Metallo-beta-Lactamase IMP-18
pubmed doi rcsb
molecule keywords IMP-18
molecule tags Hydrolase
source organism Pseudomonas aeruginosa
total genus 69
structure length 214
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b3rA00
4ZEJA 4GCWA 3DH8A 5AYAA 2BFZA 2GFJA 3IEMA 1E5DA 3FAIA 4XWTA 1ZTCA 2GFKA 3R2UA 3MD7A 2OHIA 3ZWFA 4C1CA 4EY2A 2YCBA 4HL1A 5KILA 2QJSA 5K4MA 1QH5A 3IOFA 4GYQA 3SRXA 1YCFA 1M2XA 4GYUA 4UAMA 4RM5A 3T9MA 2BG6A 2R2DA 2FU7A 3I14A 4U4LA 1VMEA 3SFPA 2BFKA 2YNVB 3SBLA 2ZWRA 4FR7A 3KNRA 4TYTA 2YNWA 1BMCA 4EYBA 3I15A 3PY6A 5A0VA 2OHHA 3QH8A 1DD6A 4RAWA 1KO3A 2M5DA 2WYMC 2YNTA 5A5ZA 2FM6A 2M5CA 2WHGA 3PG4A 2A7MA 1HLKA 4AD9A 5EH9A 4HL2A 1X8HA 4KEQA 3X2XA 4Z5YA 2DOOA 5K0WA 5B15A 3DHBA 1ZKPA 1L9YA 4F6HA 4C1HA 2Q9UA 3X30A 5LM6A 4EXSA 3BV6A 3P2UA 3IE1A 4UWOB 4RAMA 4NQ2A 2FHXA 3TP9A 3I0VA 4RBSA 4ZO2A 2WYLA 4Z67A 2YZ3A 2BR6A 1X8IA 1WRAA 2P4ZA 2HB9A 2Q0IA 5IQKA 4D1UA 1X8GA 3VQZA 3X2ZA 4TZFA 2Y8BA 1JJEA 3AJ3A 5HIPA 4DILA 2Y87A 1DDKA 4UWRB 4ZNBA 4PVTA 5ACXA 2I7XA 4Z5ZA 5ACVA 4J5FA 3F9OA 1K07A 4Z60A 4RL2A 2BMIA 2BG8A 3JXPA 2GCUA 4EXYA 4UWPB 5AXOA 3KL7A 2E7YA 2XR1A 1YCHA 4XWWA 5LSCA 5KIKA 5EHTA 4FSBA 1WUPA 4NQ6A 2Q42A 3T3NA 4C09A 4KEPA 5EW0A 1P9EA 3RKJA 2ZO4A 1KR3A 2AIOA 4V0HA 5EVDA 3ESHA 5K4KA 3IELA 4F6ZA 3I11A 4UWSB 4JO0A 4NQ4A 2P97A 1VGNA 4ZO3A 5EV8A 2YNUA 2FK6A 3L6NA 5EVBA 3ZQ4A 3AF6A 5AXRA 1XTOA 3WXCA 2QINA 4HKYA 4C1EA 5A87A 2I7TA 3IDZA 5LMCA 2WRSA 2H6AA 4BP0A 2FU8A 4P62A 5HH4A 4AWZA 1Y44A 5FQCA 4Z7RA 3BK1A 4BZ3A 2WYMA 1A7TA 3I13A 2BFZB 3IOGA 5EVKA 1WW1A 2YNVA 3SD9A 5ACSA 3IE2A 2QDTA 2P18A 4AX0B 1A8TA 4B87A 2OHJA 2VW8A 3H3EA 1VJNA 1BC2A 5LCFA 5LCAA 3AF5A 3PY5A 4EYLA 5K4NA 5ACUA 4D1VA 3X2YA 2NXAA 4AWYB 4DIKA 1ZNBA 2BFLA 3ZR9A 3DHCA 5B1UA 3BK2A 4TZBA 5HH6A 4FEKA 2ZNBA 4TZEA 3Q6VA 4LE6A 5LLDA 2I7VA 3BC2A 4UBQA 2BG2A 4H0DA 5LCHA 2QEDA 5HIQA 1WUOA 4AX1B 1XM8A 2DKFA 4YSLA 5ACWA 4XUKA 2BTNA 5ACQA 4C1GA 4NQ5A 2YNTB 3ADRA 5B3RA 4TYFA 2XF4A 3SPUA 5HIOA 1KO2A 3ZNBA 4UA4A 3DHAA 1BVTA 1SMLA 1MQOA 4EFZA 4EYFA 5AHRA 3VPEA 2BGAA 5EV6A 4D1TA 4YSBA 1JT1A 5ACPA 4C1FA 4YSKA 2GMNA 4D02A 3SW3A 2FHXB 3T3OA 2ZZIA 4C1DA 4Z6XA 2NZEA 2UYXA 1DXKA 5FQAA 2CBNA 5LS3A 1JJTA 5FQBA 2Y8AA 5HISA 2NZFA 3IE0A 3S0ZA 3FCZA 5A0TA 3A4YA 5ACTA 5AHOA 2FU9A 3RKKA 3IEKA 3G1PA 2BG8B 2P1EA 4TZ9A 3RPCA 4PVOA 4CHLA 1YCGA 2FU6A 3LVZA 2NYPA 5LE1A 4O98A 2BG7A 4RL0A 4D1WA 2BC2A 3KNSA 2GKLA 2QDSA 5EWAA 5ACRA 4WD6A 1QH3A 5DPXA 5AEBA 4J5HA 2Q0JA 2BIBA 2AZ4A 5HH5A
chains in the Genus database with same CATH superfamily
4ZEJA 4GCWA 3DH8A 5AYAA 2BFZA 2GFJA 3IEMA 1E5DA 3FAIA 4XWTA 1ZTCA 2GFKA 3R2UA 3MD7A 2OHIA 3ZWFA 4C1CA 4EY2A 2YCBA 4HL1A 5KILA 2QJSA 5K4MA 1QH5A 3IOFA 4GYQA 3SRXA 1YCFA 1M2XA 4GYUA 4UAMA 4RM5A 3T9MA 2BG6A 2R2DA 2FU7A 3I14A 4U4LA 1VMEA 3SFPA 2BFKA 2YNVB 3SBLA 2ZWRA 4FR7A 3KNRA 4TYTA 2CFZA 2YNWA 1BMCA 4EYBA 3I15A 3PY6A 5A0VA 2OHHA 3QH8A 1DD6A 2YHEA 4RAWA 1KO3A 2M5DA 2WYMC 2YNTA 5A5ZA 2FM6A 2M5CA 2WHGA 3PG4A 4NURA 2A7MA 1HLKA 4AD9A 5EH9A 4HL2A 1X8HA 4KEQA 3X2XA 4Z5YA 2DOOA 5K0WA 5B15A 3DHBA 1ZKPA 1L9YA 4F6HA 4C1HA 2Q9UA 3X30A 5LM6A 4EXSA 3BV6A 3P2UA 3IE1A 4UWOB 4RAMA 4NQ2A 2FHXA 3TP9A 3I0VA 4RBSA 4ZO2A 2WYLA 4Z67A 2YZ3A 2BR6A 1X8IA 1WRAA 2P4ZA 2HB9A 2Q0IA 5IQKA 4D1UA 1X8GA 3VQZA 3X2ZA 4TZFA 2Y8BA 1JJEA 3AJ3A 5HIPA 4DILA 2Y87A 1DDKA 4UWRB 4ZNBA 4PVTA 5ACXA 2I7XA 4Z5ZA 5ACVA 4J5FA 3F9OA 1K07A 4Z60A 4RL2A 2BMIA 2BG8A 3JXPA 2GCUA 4EXYA 4UWPB 5AXOA 3KL7A 2E7YA 2XR1A 1YCHA 4XWWA 5LSCA 5KIKA 5EHTA 4FSBA 1WUPA 4NQ6A 2Q42A 3T3NA 4C09A 4KEPA 5EW0A 1P9EA 3RKJA 2ZO4A 1KR3A 2AIOA 4V0HA 5EVDA 3ESHA 5K4KA 3IELA 4F6ZA 3I11A 4UWSB 4JO0A 4NQ4A 2P97A 1VGNA 4ZO3A 5EV8A 2YNUA 2FK6A 3L6NA 5EVBA 3ZQ4A 3AF6A 5AXRA 1XTOA 3WXCA 2QINA 4HKYA 4C1EA 5A87A 2I7TA 3IDZA 5LMCA 2WRSA 2H6AA 4BP0A 2FU8A 4P62A 5HH4A 4AWZA 2CG3A 1Y44A 5FQCA 4Z7RA 3BK1A 4BZ3A 2WYMA 1A7TA 3I13A 2BFZB 3IOGA 5EVKA 1WW1A 2YNVA 3SD9A 5ACSA 3IE2A 2QDTA 2P18A 4AX0B 1A8TA 4B87A 2OHJA 2VW8A 3H3EA 1VJNA 1BC2A 5LCFA 5LCAA 3AF5A 5AJLA 3PY5A 4EYLA 5K4NA 5ACUA 4D1VA 3X2YA 2NXAA 4AWYB 4DIKA 1ZNBA 2BFLA 3ZR9A 3DHCA 5B1UA 3BK2A 4TZBA 5HH6A 4FEKA 2ZNBA 4TZEA 3Q6VA 4LE6A 5LLDA 2I7VA 3BC2A 4UBQA 2BG2A 4H0DA 5LCHA 4AV7A 5AIJA 2QEDA 5HIQA 1WUOA 4AX1B 1XM8A 2DKFA 4YSLA 5ACWA 4XUKA 2BTNA 5ACQA 4C1GA 4NQ5A 2YNTB 3ADRA 5B3RA 4TYFA 2XF4A 3SPUA 5HIOA 1KO2A 3ZNBA 4UA4A 3DHAA 1BVTA 1SMLA 1MQOA 4EFZA 2CG2A 4EYFA 5AHRA 3VPEA 2BGAA 5EV6A 4D1TA 4YSBA 1JT1A 5ACPA 4C1FA 4YSKA 2GMNA 4D02A 3SW3A 2FHXB 3T3OA 2ZZIA 4C1DA 4Z6XA 2NZEA 2UYXA 1DXKA 5FQAA 2CBNA 5LS3A 1JJTA 5FQBA 5A23A 2Y8AA 5HISA 4PDXA 2NZFA 3IE0A 3S0ZA 3FCZA 5A0TA 3A4YA 5ACTA 5AHOA 2FU9A 3RKKA 3IEKA 4AXHA 3G1PA 2BG8B 2P1EA 4TZ9A 3RPCA 4PVOA 4CHLA 1YCGA 2FU6A 3LVZA 2NYPA 5LE1A 4O98A 2BG7A 4RL0A 4D1WA 2BC2A 3KNSA 2GKLA 2QDSA 5EWAA 2CFUA 5ACRA 4WD6A 1QH3A 5DPXA 5AEBA 4J5HA 2Q0JA 2BIBA 2AZ4A 5HH5A
chains in the Genus database with same CATH topology
4ZEJA 4GCWA 3DH8A 5AYAA 2BFZA 2GFJA 3IEMA 1E5DA 3FAIA 4XWTA 1ZTCA 2GFKA 3R2UA 3MD7A 2OHIA 3ZWFA 4C1CA 4EY2A 2YCBA 4HL1A 5KILA 2QJSA 5K4MA 1QH5A 3IOFA 4GYQA 3SRXA 1YCFA 1M2XA 4GYUA 4UAMA 4RM5A 3T9MA 2BG6A 2R2DA 2FU7A 3I14A 4U4LA 1VMEA 3SFPA 2BFKA 2YNVB 3SBLA 2ZWRA 4FR7A 3KNRA 4TYTA 2YNWA 1BMCA 4EYBA 3I15A 3PY6A 5A0VA 2OHHA 3QH8A 1DD6A 4RAWA 1KO3A 2M5DA 2WYMC 2YNTA 5A5ZA 2FM6A 2M5CA 2WHGA 3PG4A 2A7MA 1HLKA 4AD9A 5EH9A 4HL2A 1X8HA 4KEQA 3X2XA 4Z5YA 2DOOA 5K0WA 5B15A 3DHBA 1ZKPA 1L9YA 4F6HA 4C1HA 2Q9UA 3X30A 5LM6A 4EXSA 3BV6A 3P2UA 3IE1A 4UWOB 4RAMA 4NQ2A 2FHXA 3TP9A 3I0VA 4RBSA 4ZO2A 2WYLA 4Z67A 2YZ3A 2BR6A 1X8IA 1WRAA 2P4ZA 2HB9A 2Q0IA 5IQKA 4D1UA 1X8GA 3VQZA 3X2ZA 4TZFA 2Y8BA 1JJEA 3AJ3A 5HIPA 4DILA 2Y87A 1DDKA 4UWRB 4ZNBA 4PVTA 5ACXA 2I7XA 4Z5ZA 5ACVA 4J5FA 3F9OA 1K07A 4Z60A 4RL2A 2BMIA 2BG8A 3JXPA 2GCUA 4EXYA 4UWPB 5AXOA 3KL7A 2E7YA 2XR1A 1YCHA 4XWWA 5LSCA 5KIKA 5EHTA 4FSBA 1WUPA 4NQ6A 2Q42A 3T3NA 4C09A 4KEPA 5EW0A 1P9EA 3RKJA 2ZO4A 1KR3A 2AIOA 4V0HA 5EVDA 3ESHA 5K4KA 3IELA 4F6ZA 3I11A 4UWSB 4JO0A 4NQ4A 2P97A 1VGNA 4ZO3A 5EV8A 2YNUA 2FK6A 3L6NA 5EVBA 3ZQ4A 3AF6A 5AXRA 1XTOA 3WXCA 2QINA 4HKYA 4C1EA 5A87A 2I7TA 3IDZA 5LMCA 2WRSA 2H6AA 4BP0A 2FU8A 4P62A 5HH4A 4AWZA 1Y44A 5FQCA 4Z7RA 3BK1A 4BZ3A 2WYMA 1A7TA 3I13A 2BFZB 3IOGA 5EVKA 1WW1A 2YNVA 3SD9A 5ACSA 3IE2A 2QDTA 2P18A 4AX0B 1A8TA 4B87A 2OHJA 2VW8A 3H3EA 1VJNA 1BC2A 5LCFA 5LCAA 3AF5A 3PY5A 4EYLA 5K4NA 5ACUA 4D1VA 3X2YA 2NXAA 4AWYB 4DIKA 1ZNBA 2BFLA 3ZR9A 3DHCA 5B1UA 3BK2A 4TZBA 5HH6A 4FEKA 2ZNBA 4TZEA 3Q6VA 4LE6A 5LLDA 2I7VA 3BC2A 4UBQA 2BG2A 4H0DA 5LCHA 2QEDA 5HIQA 1WUOA 4AX1B 1XM8A 2DKFA 4YSLA 5ACWA 4XUKA 2BTNA 5ACQA 4C1GA 4NQ5A 2YNTB 3ADRA 5B3RA 4TYFA 2XF4A 3SPUA 5HIOA 1KO2A 3ZNBA 4UA4A 3DHAA 1BVTA 1SMLA 1MQOA 4EFZA 4EYFA 5AHRA 3VPEA 2BGAA 5EV6A 4D1TA 4YSBA 1JT1A 5ACPA 4C1FA 4YSKA 2GMNA 4D02A 3SW3A 2FHXB 3T3OA 2ZZIA 4C1DA 4Z6XA 2NZEA 2UYXA 1DXKA 5FQAA 2CBNA 5LS3A 1JJTA 5FQBA 2Y8AA 5HISA 2NZFA 3IE0A 3S0ZA 3FCZA 5A0TA 3A4YA 5ACTA 5AHOA 2FU9A 3RKKA 3IEKA 3G1PA 2BG8B 2P1EA 4TZ9A 3RPCA 4PVOA 4CHLA 1YCGA 2FU6A 3LVZA 2NYPA 5LE1A 4O98A 2BG7A 4RL0A 4D1WA 2BC2A 3KNSA 2GKLA 2QDSA 5EWAA 5ACRA 4WD6A 1QH3A 5DPXA 5AEBA 4J5HA 2Q0JA 2BIBA 2AZ4A 5HH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEJ A;  4GCW A;  3DH8 A;  5AYA A;  2BFZ A;  2GFJ A;  3IEM A;  1E5D A;  3FAI A;  4XWT A;  1ZTC A;  2GFK A;  3R2U A;  3MD7 A;  2OHI A;  3ZWF A;  4C1C A;  4EY2 A;  2YCB A;  4HL1 A;  5KIL A;  2QJS A;  5K4M A;  1QH5 A;  3IOF A;  4GYQ A;  3SRX A;  1YCF A;  1M2X A;  4GYU A;  4UAM A;  4RM5 A;  3T9M A;  2BG6 A;  2R2D A;  2FU7 A;  3I14 A;  4U4L A;  1VME A;  3SFP A;  2BFK A;  2YNV B;  3SBL A;  2ZWR A;  4FR7 A;  3KNR A;  4TYT A;  2YNW A;  1BMC A;  4EYB A;  3I15 A;  3PY6 A;  5A0V A;  2OHH A;  3QH8 A;  1DD6 A;  4RAW A;  1KO3 A;  2M5D A;  2WYM C;  2YNT A;  5A5Z A;  2FM6 A;  2M5C A;  2WHG A;  3PG4 A;  2A7M A;  1HLK A;  4AD9 A;  5EH9 A;  4HL2 A;  1X8H A;  4KEQ A;  3X2X A;  4Z5Y A;  2DOO A;  5K0W A;  5B15 A;  3DHB A;  1ZKP A;  1L9Y A;  4F6H A;  4C1H A;  2Q9U A;  3X30 A;  5LM6 A;  4EXS A;  3BV6 A;  3P2U A;  3IE1 A;  4UWO B;  4RAM A;  4NQ2 A;  2FHX A;  3TP9 A;  3I0V A;  4RBS A;  4ZO2 A;  2WYL A;  4Z67 A;  2YZ3 A;  2BR6 A;  1X8I A;  1WRA A;  2P4Z A;  2HB9 A;  2Q0I A;  5IQK A;  4D1U A;  1X8G A;  3VQZ A;  3X2Z A;  4TZF A;  2Y8B A;  1JJE A;  3AJ3 A;  5HIP A;  4DIL A;  2Y87 A;  1DDK A;  4UWR B;  4ZNB A;  4PVT A;  5ACX A;  2I7X A;  4Z5Z A;  5ACV A;  4J5F A;  3F9O A;  1K07 A;  4Z60 A;  4RL2 A;  2BMI A;  2BG8 A;  3JXP A;  2GCU A;  4EXY A;  4UWP B;  5AXO A;  3KL7 A;  2E7Y A;  2XR1 A;  1YCH A;  4XWW A;  5LSC A;  5KIK A;  5EHT A;  4FSB A;  1WUP A;  4NQ6 A;  2Q42 A;  3T3N A;  4C09 A;  4KEP A;  5EW0 A;  1P9E A;  3RKJ A;  2ZO4 A;  1KR3 A;  2AIO A;  4V0H A;  5EVD A;  3ESH A;  5K4K A;  3IEL A;  4F6Z A;  3I11 A;  4UWS B;  4JO0 A;  4NQ4 A;  2P97 A;  1VGN A;  4ZO3 A;  5EV8 A;  2YNU A;  2FK6 A;  3L6N A;  5EVB A;  3ZQ4 A;  3AF6 A;  5AXR A;  1XTO A;  3WXC A;  2QIN A;  4HKY A;  4C1E A;  5A87 A;  2I7T A;  3IDZ A;  5LMC A;  2WRS A;  2H6A A;  4BP0 A;  2FU8 A;  4P62 A;  5HH4 A;  4AWZ A;  1Y44 A;  5FQC A;  4Z7R A;  3BK1 A;  4BZ3 A;  2WYM A;  1A7T A;  3I13 A;  2BFZ B;  3IOG A;  5EVK A;  1WW1 A;  2YNV A;  3SD9 A;  5ACS A;  3IE2 A;  2QDT A;  2P18 A;  4AX0 B;  1A8T A;  4B87 A;  2OHJ A;  2VW8 A;  3H3E A;  1VJN A;  1BC2 A;  5LCF A;  5LCA A;  3AF5 A;  3PY5 A;  4EYL A;  5K4N A;  5ACU A;  4D1V A;  3X2Y A;  2NXA A;  4AWY B;  4DIK A;  1ZNB A;  2BFL A;  3ZR9 A;  3DHC A;  5B1U A;  3BK2 A;  4TZB A;  5HH6 A;  4FEK A;  2ZNB A;  4TZE A;  3Q6V A;  4LE6 A;  5LLD A;  2I7V A;  3BC2 A;  4UBQ A;  2BG2 A;  4H0D A;  5LCH A;  2QED A;  5HIQ A;  1WUO A;  4AX1 B;  1XM8 A;  2DKF A;  4YSL A;  5ACW A;  4XUK A;  2BTN A;  5ACQ A;  4C1G A;  4NQ5 A;  2YNT B;  3ADR A;  5B3R A;  4TYF A;  2XF4 A;  3SPU A;  5HIO A;  1KO2 A;  3ZNB A;  4UA4 A;  3DHA A;  1BVT A;  1SML A;  1MQO A;  4EFZ A;  4EYF A;  5AHR A;  3VPE A;  2BGA A;  5EV6 A;  4D1T A;  4YSB A;  1JT1 A;  5ACP A;  4C1F A;  4YSK A;  2GMN A;  4D02 A;  3SW3 A;  2FHX B;  3T3O A;  2ZZI A;  4C1D A;  4Z6X A;  2NZE A;  2UYX A;  1DXK A;  5FQA A;  2CBN A;  5LS3 A;  1JJT A;  5FQB A;  2Y8A A;  5HIS A;  2NZF A;  3IE0 A;  3S0Z A;  3FCZ A;  5A0T A;  3A4Y A;  5ACT A;  5AHO A;  2FU9 A;  3RKK A;  3IEK A;  3G1P A;  2BG8 B;  2P1E A;  4TZ9 A;  3RPC A;  4PVO A;  4CHL A;  1YCG A;  2FU6 A;  3LVZ A;  2NYP A;  5LE1 A;  4O98 A;  2BG7 A;  4RL0 A;  4D1W A;  2BC2 A;  3KNS A;  2GKL A;  2QDS A;  5EWA A;  5ACR A;  4WD6 A;  1QH3 A;  5DPX A;  5AEB A;  4J5H A;  2Q0J A;  2BIB A;  2AZ4 A;  5HH5 A; 
#chains in the Genus database with same CATH topology
 4ZEJ A;  4GCW A;  3DH8 A;  5AYA A;  2BFZ A;  2GFJ A;  3IEM A;  1E5D A;  3FAI A;  4XWT A;  1ZTC A;  2GFK A;  3R2U A;  3MD7 A;  2OHI A;  3ZWF A;  4C1C A;  4EY2 A;  2YCB A;  4HL1 A;  5KIL A;  2QJS A;  5K4M A;  1QH5 A;  3IOF A;  4GYQ A;  3SRX A;  1YCF A;  1M2X A;  4GYU A;  4UAM A;  4RM5 A;  3T9M A;  2BG6 A;  2R2D A;  2FU7 A;  3I14 A;  4U4L A;  1VME A;  3SFP A;  2BFK A;  2YNV B;  3SBL A;  2ZWR A;  4FR7 A;  3KNR A;  4TYT A;  2CFZ A;  2YNW A;  1BMC A;  4EYB A;  3I15 A;  3PY6 A;  5A0V A;  2OHH A;  3QH8 A;  1DD6 A;  2YHE A;  4RAW A;  1KO3 A;  2M5D A;  2WYM C;  2YNT A;  5A5Z A;  2FM6 A;  2M5C A;  2WHG A;  3PG4 A;  4NUR A;  2A7M A;  1HLK A;  4AD9 A;  5EH9 A;  4HL2 A;  1X8H A;  4KEQ A;  3X2X A;  4Z5Y A;  2DOO A;  5K0W A;  5B15 A;  3DHB A;  1ZKP A;  1L9Y A;  4F6H A;  4C1H A;  2Q9U A;  3X30 A;  5LM6 A;  4EXS A;  3BV6 A;  3P2U A;  3IE1 A;  4UWO B;  4RAM A;  4NQ2 A;  2FHX A;  3TP9 A;  3I0V A;  4RBS A;  4ZO2 A;  2WYL A;  4Z67 A;  2YZ3 A;  2BR6 A;  1X8I A;  1WRA A;  2P4Z A;  2HB9 A;  2Q0I A;  5IQK A;  4D1U A;  1X8G A;  3VQZ A;  3X2Z A;  4TZF A;  2Y8B A;  1JJE A;  3AJ3 A;  5HIP A;  4DIL A;  2Y87 A;  1DDK A;  4UWR B;  4ZNB A;  4PVT A;  5ACX A;  2I7X A;  4Z5Z A;  5ACV A;  4J5F A;  3F9O A;  1K07 A;  4Z60 A;  4RL2 A;  2BMI A;  2BG8 A;  3JXP A;  2GCU A;  4EXY A;  4UWP B;  5AXO A;  3KL7 A;  2E7Y A;  2XR1 A;  1YCH A;  4XWW A;  5LSC A;  5KIK A;  5EHT A;  4FSB A;  1WUP A;  4NQ6 A;  2Q42 A;  3T3N A;  4C09 A;  4KEP A;  5EW0 A;  1P9E A;  3RKJ A;  2ZO4 A;  1KR3 A;  2AIO A;  4V0H A;  5EVD A;  3ESH A;  5K4K A;  3IEL A;  4F6Z A;  3I11 A;  4UWS B;  4JO0 A;  4NQ4 A;  2P97 A;  1VGN A;  4ZO3 A;  5EV8 A;  2YNU A;  2FK6 A;  3L6N A;  5EVB A;  3ZQ4 A;  3AF6 A;  5AXR A;  1XTO A;  3WXC A;  2QIN A;  4HKY A;  4C1E A;  5A87 A;  2I7T A;  3IDZ A;  5LMC A;  2WRS A;  2H6A A;  4BP0 A;  2FU8 A;  4P62 A;  5HH4 A;  4AWZ A;  2CG3 A;  1Y44 A;  5FQC A;  4Z7R A;  3BK1 A;  4BZ3 A;  2WYM A;  1A7T A;  3I13 A;  2BFZ B;  3IOG A;  5EVK A;  1WW1 A;  2YNV A;  3SD9 A;  5ACS A;  3IE2 A;  2QDT A;  2P18 A;  4AX0 B;  1A8T A;  4B87 A;  2OHJ A;  2VW8 A;  3H3E A;  1VJN A;  1BC2 A;  5LCF A;  5LCA A;  3AF5 A;  5AJL A;  3PY5 A;  4EYL A;  5K4N A;  5ACU A;  4D1V A;  3X2Y A;  2NXA A;  4AWY B;  4DIK A;  1ZNB A;  2BFL A;  3ZR9 A;  3DHC A;  5B1U A;  3BK2 A;  4TZB A;  5HH6 A;  4FEK A;  2ZNB A;  4TZE A;  3Q6V A;  4LE6 A;  5LLD A;  2I7V A;  3BC2 A;  4UBQ A;  2BG2 A;  4H0D A;  5LCH A;  4AV7 A;  5AIJ A;  2QED A;  5HIQ A;  1WUO A;  4AX1 B;  1XM8 A;  2DKF A;  4YSL A;  5ACW A;  4XUK A;  2BTN A;  5ACQ A;  4C1G A;  4NQ5 A;  2YNT B;  3ADR A;  5B3R A;  4TYF A;  2XF4 A;  3SPU A;  5HIO A;  1KO2 A;  3ZNB A;  4UA4 A;  3DHA A;  1BVT A;  1SML A;  1MQO A;  4EFZ A;  2CG2 A;  4EYF A;  5AHR A;  3VPE A;  2BGA A;  5EV6 A;  4D1T A;  4YSB A;  1JT1 A;  5ACP A;  4C1F A;  4YSK A;  2GMN A;  4D02 A;  3SW3 A;  2FHX B;  3T3O A;  2ZZI A;  4C1D A;  4Z6X A;  2NZE A;  2UYX A;  1DXK A;  5FQA A;  2CBN A;  5LS3 A;  1JJT A;  5FQB A;  5A23 A;  2Y8A A;  5HIS A;  4PDX A;  2NZF A;  3IE0 A;  3S0Z A;  3FCZ A;  5A0T A;  3A4Y A;  5ACT A;  5AHO A;  2FU9 A;  3RKK A;  3IEK A;  4AXH A;  3G1P A;  2BG8 B;  2P1E A;  4TZ9 A;  3RPC A;  4PVO A;  4CHL A;  1YCG A;  2FU6 A;  3LVZ A;  2NYP A;  5LE1 A;  4O98 A;  2BG7 A;  4RL0 A;  4D1W A;  2BC2 A;  3KNS A;  2GKL A;  2QDS A;  5EWA A;  2CFU A;  5ACR A;  4WD6 A;  1QH3 A;  5DPX A;  5AEB A;  4J5H A;  2Q0J A;  2BIB A;  2AZ4 A;  5HH5 A; 
#chains in the Genus database with same CATH homology
 4ZEJ A;  4GCW A;  3DH8 A;  5AYA A;  2BFZ A;  2GFJ A;  3IEM A;  1E5D A;  3FAI A;  4XWT A;  1ZTC A;  2GFK A;  3R2U A;  3MD7 A;  2OHI A;  3ZWF A;  4C1C A;  4EY2 A;  2YCB A;  4HL1 A;  5KIL A;  2QJS A;  5K4M A;  1QH5 A;  3IOF A;  4GYQ A;  3SRX A;  1YCF A;  1M2X A;  4GYU A;  4UAM A;  4RM5 A;  3T9M A;  2BG6 A;  2R2D A;  2FU7 A;  3I14 A;  4U4L A;  1VME A;  3SFP A;  2BFK A;  2YNV B;  3SBL A;  2ZWR A;  4FR7 A;  3KNR A;  4TYT A;  2YNW A;  1BMC A;  4EYB A;  3I15 A;  3PY6 A;  5A0V A;  2OHH A;  3QH8 A;  1DD6 A;  4RAW A;  1KO3 A;  2M5D A;  2WYM C;  2YNT A;  5A5Z A;  2FM6 A;  2M5C A;  2WHG A;  3PG4 A;  2A7M A;  1HLK A;  4AD9 A;  5EH9 A;  4HL2 A;  1X8H A;  4KEQ A;  3X2X A;  4Z5Y A;  2DOO A;  5K0W A;  5B15 A;  3DHB A;  1ZKP A;  1L9Y A;  4F6H A;  4C1H A;  2Q9U A;  3X30 A;  5LM6 A;  4EXS A;  3BV6 A;  3P2U A;  3IE1 A;  4UWO B;  4RAM A;  4NQ2 A;  2FHX A;  3TP9 A;  3I0V A;  4RBS A;  4ZO2 A;  2WYL A;  4Z67 A;  2YZ3 A;  2BR6 A;  1X8I A;  1WRA A;  2P4Z A;  2HB9 A;  2Q0I A;  5IQK A;  4D1U A;  1X8G A;  3VQZ A;  3X2Z A;  4TZF A;  2Y8B A;  1JJE A;  3AJ3 A;  5HIP A;  4DIL A;  2Y87 A;  1DDK A;  4UWR B;  4ZNB A;  4PVT A;  5ACX A;  2I7X A;  4Z5Z A;  5ACV A;  4J5F A;  3F9O A;  1K07 A;  4Z60 A;  4RL2 A;  2BMI A;  2BG8 A;  3JXP A;  2GCU A;  4EXY A;  4UWP B;  5AXO A;  3KL7 A;  2E7Y A;  2XR1 A;  1YCH A;  4XWW A;  5LSC A;  5KIK A;  5EHT A;  4FSB A;  1WUP A;  4NQ6 A;  2Q42 A;  3T3N A;  4C09 A;  4KEP A;  5EW0 A;  1P9E A;  3RKJ A;  2ZO4 A;  1KR3 A;  2AIO A;  4V0H A;  5EVD A;  3ESH A;  5K4K A;  3IEL A;  4F6Z A;  3I11 A;  4UWS B;  4JO0 A;  4NQ4 A;  2P97 A;  1VGN A;  4ZO3 A;  5EV8 A;  2YNU A;  2FK6 A;  3L6N A;  5EVB A;  3ZQ4 A;  3AF6 A;  5AXR A;  1XTO A;  3WXC A;  2QIN A;  4HKY A;  4C1E A;  5A87 A;  2I7T A;  3IDZ A;  5LMC A;  2WRS A;  2H6A A;  4BP0 A;  2FU8 A;  4P62 A;  5HH4 A;  4AWZ A;  1Y44 A;  5FQC A;  4Z7R A;  3BK1 A;  4BZ3 A;  2WYM A;  1A7T A;  3I13 A;  2BFZ B;  3IOG A;  5EVK A;  1WW1 A;  2YNV A;  3SD9 A;  5ACS A;  3IE2 A;  2QDT A;  2P18 A;  4AX0 B;  1A8T A;  4B87 A;  2OHJ A;  2VW8 A;  3H3E A;  1VJN A;  1BC2 A;  5LCF A;  5LCA A;  3AF5 A;  3PY5 A;  4EYL A;  5K4N A;  5ACU A;  4D1V A;  3X2Y A;  2NXA A;  4AWY B;  4DIK A;  1ZNB A;  2BFL A;  3ZR9 A;  3DHC A;  5B1U A;  3BK2 A;  4TZB A;  5HH6 A;  4FEK A;  2ZNB A;  4TZE A;  3Q6V A;  4LE6 A;  5LLD A;  2I7V A;  3BC2 A;  4UBQ A;  2BG2 A;  4H0D A;  5LCH A;  2QED A;  5HIQ A;  1WUO A;  4AX1 B;  1XM8 A;  2DKF A;  4YSL A;  5ACW A;  4XUK A;  2BTN A;  5ACQ A;  4C1G A;  4NQ5 A;  2YNT B;  3ADR A;  5B3R A;  4TYF A;  2XF4 A;  3SPU A;  5HIO A;  1KO2 A;  3ZNB A;  4UA4 A;  3DHA A;  1BVT A;  1SML A;  1MQO A;  4EFZ A;  4EYF A;  5AHR A;  3VPE A;  2BGA A;  5EV6 A;  4D1T A;  4YSB A;  1JT1 A;  5ACP A;  4C1F A;  4YSK A;  2GMN A;  4D02 A;  3SW3 A;  2FHX B;  3T3O A;  2ZZI A;  4C1D A;  4Z6X A;  2NZE A;  2UYX A;  1DXK A;  5FQA A;  2CBN A;  5LS3 A;  1JJT A;  5FQB A;  2Y8A A;  5HIS A;  2NZF A;  3IE0 A;  3S0Z A;  3FCZ A;  5A0T A;  3A4Y A;  5ACT A;  5AHO A;  2FU9 A;  3RKK A;  3IEK A;  3G1P A;  2BG8 B;  2P1E A;  4TZ9 A;  3RPC A;  4PVO A;  4CHL A;  1YCG A;  2FU6 A;  3LVZ A;  2NYP A;  5LE1 A;  4O98 A;  2BG7 A;  4RL0 A;  4D1W A;  2BC2 A;  3KNS A;  2GKL A;  2QDS A;  5EWA A;  5ACR A;  4WD6 A;  1QH3 A;  5DPX A;  5AEB A;  4J5H A;  2Q0J A;  2BIB A;  2AZ4 A;  5HH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...