5B40B

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITCPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40B00
5AVCC 5B31G 4ZUXD 2HIOC 2AROC 3KXBB 2CV5C 3NQUB 3AYWB 3MGPC 3W99B 1P3BC 4H9PA 5B0ZC 3W99A 1P3GC 3MGQD 3REKA 5AV8A 2FJ7C 1KX3B 5CPIC 1JFIA 4H9NA 4J8XD 3C1CB 4KUDD 5B31B 5KDMB 2NQBB 4EO5B 3REJB 5KDMA 4H9QA 2NQBA 3W97D 2IO5C 2NZDC 4CAYB 3AZNB 1P3IC 3W98C 3MVDD 2RVQD 3AFAD 3REIB 3X1SB 3AZNA 4WU8A 3REIA 1M19C 5CHLB 5B24C 1P3OC 4H9RA 1HQ3D 3C1BA 1U35D 3VH5T 3B6FA 4J8WC 3LZ0B 1S32B 3REHA 1P3MA 5CP6C 3AZFD 5BT1D 4XZQD 1H3OA 3X1UB 1KX5B 3MGSB 1ID3A 1TZYA 4JJNA 3MGSA 1KX4C 5BO0A 3AV1A 2F8NH 5AV9D 5JA4B 2L5AA 5GT3C 3AZJC 1P3PC 5JA4A 3VH5W 3LELD 5CPKB 5JRGD 4J8VC 3LZ1C 5CPKA 5AY8B 3A6ND 4UUZA 3O62B 3V9RA 4QLCD 5B1MC 5AY8A 3W96D 4DRBA 4J8XB 3MNNA 4WU9B 5GSUD 3B6GC 4XUJD 3KWQB 1M1AD 5B0YC 1P3KD 3KWQA 3AN2A 4Z66D 4J8UB 3WAAB 5B33D 3AFAB 4H9OB 4J8UA 3WAAA 1WWIA 3AZEC 1P3LD 1R4VA 4NE5A 5AV6C 1P34D 4YS3A 1ZLAB 3NQJB 1U35B 3AZHB 1M18A 3NQJA 3RELB 5B31C 3UTAD 1F66B 3AV2A 4R8PA 1F66A 3WKJD 3AZFB 4Z5TD 2PYOC 4XZQB 3AZIB 1KU5A 3MGRC 3AZIA 5BNXA 1AOIC 2F8ND 3X1VC 1BFMA 3LJAC 5AVCA 3W99D 4M6BA 5B2IC 5B40B 1EQZC 5DNMC 3WTPB 5AV8D 2CV5A 3UTBB 4QLCB 3MGPA 1P3BA 1P3GA 1P3FC 4XUJB 1M1AB 1P3KB 4ZUXC 2FJ7A 4ZBJB 2NQBD 3UT9B 3REJD 4Z66B 2BYMB 5CPIA 3WA9C 3UT9A 4H9SC 2BYMA 2YFVA 5B33B 1B6WA 3AZND 5B1LB 3REID 5B1LA 3MGQC 5G49A 4WZSB 2NZDA 1P3IA 4NE3A 3W98A 5B2JB 3AZGB 4HGAB 5E5AC 3AZGA 1M19A 3UTAB 4KUDC 3AZLB 5B24A 5B32B 3REHD 3W97C 1S32D 4Z5TB 3VH6A 5B32A 4X23B 4X23A 4J8WA 3MVDC 2RVQC 1TZYD 3X1UD 1KX5D 3MGSD 3AV1D 1HQ3C 4H9PB 3REKB 3B0BA 5CPKD 5AV8B 3AZFC 5BT1C 5AY8D 1JFIB 4H9NB 3O62D 3MNND 5AV5A 3TU4C 4WU9D 4H9QB 3AZKB 4NE6A 3KWQD 5CPJB 3AZKA 1TAFA 5CPJA 3X1TB 2HUEB 5AV9C 4J8UD 3X1TA 1P3AB 3B6GA 5BS7C 4WU8B 5B0YA 3WAAD 3LELC 1P3AA 5JRGC 5AVBB 4H9RB 3A6NC 4LD9B 3C1BB 5AVBA 3AZMC 3W96C 5DNNB 5F99B 3KSYA 1ZLAD 4LD9A 3B6FB 5C3IC 5F99A 5DNNA 3AZEA 1M18D 5AV6A 5GSUC 3AZHD 4KGCB 3RELD 3REHB 1P3MB 3AV2D 4R8PD 1F66D 4KGCA 3AZID 1H3OB 2BYKB 1ID3B 1TZYB 1P3LC 4JJNB 2BYKA 3KUYC 5BO0B 2PYOA 1P34C 3B0CT 3AV1B 4G92B 3X1VA 5GXQC 5GT0C 4UUZB 3LJAA 5B40D 4AWLB 3V9RB 3WKJC 3WTPD 3MNNB 3UTBD 5B2IA 2FJ7D 3AN2B 5CPID 3UT9D 3B0CW 4WNNA 3B0DB 1P3FA 3KXBC 4NFTA 4G91B 4ZUXA 3W99C 3AYWC 5B1LD 3WA9A 4YS3B 3W98D 2CWEA 1KX3C 5B2JD 1M19D 3AZGD 1M18B 3C1CC 3AZLD 3AV2B 2NQBC 4EO5C 4R8PB 3REJC 5B32D 5E5AA 4X23D 4J8WD 4KUDA 5BNXB 3AZNC 3W97A 3REIC 3X1SC 3R45A 4YM6B 4YM6A 2LY8A 5AVCB 2HIOB 2HIOA 3VH5A 2AROB 3LZ0C 1HQ3A 3REKD 2CV5B 1S32C 2AROA 3MGPB 1P3BB 5B0ZB 1P3GB 5AV5D 1BH9A 5B0ZA 1BH8A 3VH6W 2FJ7B 3X1UC 4CSRA 1KX5C 3MGSC 3AZKD 5CPIB 5CPJD 5B32G 2YFVB 1ULYA 2YFWB 3X1TD 3TU4A 5B0YD 2YFWA 1P3AD 4WU8D 5G49B 2IO5B 5CPKC 1P3IB 2NZDB 3W98B 5AVBD 5AY8C 4LD9D 3C1BD 3O62C 1M19B 5F99D 5DNND 4J8XC 5B24B 5AV6D 5JRGA 3B6FD 4WU9C 3A6NA 1P3OA 3KWQC 4KGCD 3AZMA 1P3MD 4J8WB 5GSUA 4J8UC 3WAAC 3AFAC 5BNVA 5CP6B 3WTPE 1ID3D 2PYOD 5CP6A 4JJND 1N1JA 1ZLAC 1M18C 1U35C 3KUYA 1KX4B 3AZHC 3RELC 1KX4A 1F66C 5GT3B 3AZJB 1P3PB 4XZQC 5GT3A 3AZJA 3AZIC 5FUGA 5AV5B 1P3PA 5GXQA 4J8VB 3LZ1B 5GT0A 1HTAA 4J8VA 3LZ1A 3WKJA 5B1MB 1TAFB 5B1MA 3AN2D 2F8NA 1P3FD 3B6GB 5B0YB 3WA9D 5B40C 4YS3D 3WTPC 3KXBA 1F1EA 4DRAA 4QLCC 3NQUA 3UTBC 3AYWA 3AZEB 2JSSA 5AV6B 4XUJC 1M1AC 1P3KC 4ZBJC 1KX3A 3UT9C 5E5AD 4Z66C 3C1CA 4E45A 5B31A 5B33C 3REJA 2PYOB 5B1LC 2F8NK 4YM6D 3MGRB 1AOIB 4CAYA 1A7WA 3MGRA 1AOIA 5B2JC 5AVCD 3AZGC 3X1VB 4HGAC 3X1SA 2HIOD 3UTAC 3AZLC 3LJAB 2AROD 5B32C 2CV5D 4Z5TC 3MGPD 4X23C 4Z2MH 1P3BD 5B2IB 5B0ZD 1P3GD 1EQZB 5DNMB 3LZ0A 1S32A 1EQZA 5DNMA 4WNNB 1P3FB 3TU4D 4ZUXB 3X1UA 1KX5A 3WA9B 3REKC 2NZDD 4H9SA 1P3ID 5AV8C 5AV5C 3MGQB 5B24D 3MGQA 1P3OD 3AZMD 3AZKC 3O62A 5CPJC 5E5AB 4KUDB 4J8XA 3X1TC 2HUEC 4WU9A 3W97B 3VH6T 1P3AC 4WU8C 4E44A 3R45B 5CP6D 5AVBC 3MVDB 4LD9C 3C1BC 3MVDA 3AFAA 4H9OA 5DNNC 5F99C 1Q9CA 3KUYD 3B6FC 1KX4D 1HQ3B 4KGCC 3REHC 1P3MC 1ZLAA 4KHAB 5GT3D 3AZJD 1P3PD 1U35A 1BH9B 4KHAA 3AZHA 1BH8B 5GXQD 3RELA 5GT0D 4J8VD 4CSRB 3LZ1D 1ID3C 1TZYC 4WV4B 4JJNC 3AZFA 5B1MD 4XZQA 3AV1C 4G92C 3TU4B 3B6GD 5AV9B 4AWLC 3KXBD 5AV9A 3AYWD 3LELB 5BS7A 3MNNC 5JRGB 3LELA 3AZED 3A6NB 1P3OB 5B40A 1B67A 4Z2MG 3AZMB 3W96B 3WTPA 3UTBA 4QLCA 3AN2C 1KX3D 3W96A 5C3IB 5GSUB 3C1CD 3B0DC 5B31D 5BNVB 4XUJA 1M1AA 4G91C 1P3KA 4Z66A 4YS3C 1N1JB 1WWSA 3MGRD 5B33A 1AOID 2F8NG 3X1SD 1P3LB 3KUYB 3X1VD 1P34B 1P3LA 1P34A 3LJAD 3AV2C 4R8PC 5B2JA 5FUGB 5GXQB 3UTAA 5GT0B 5B2ID 3LZ0D 3AZLA 3WKJB 1EQZD 5DNMD 4Z5TA 4YM6C 2F8NB
chains in the Genus database with same CATH superfamily
5AVCC 5B31G 4ZUXD 2HIOC 2AROC 3KXBB 2CV5C 3NQUB 3AYWB 3MGPC 3W99B 1P3BC 4H9PA 5B0ZC 3W99A 1P3GC 3MGQD 3REKA 5AV8A 2FJ7C 1KX3B 3EPLA 5CPIC 1JFIA 4H9NA 4J8XD 3C1CB 4KUDD 2ZY3A 5B31B 5KDMB 2NQBB 4EO5B 3REJB 5KDMA 4H9QA 2NQBA 3W97D 2IO5C 2NZDC 4CAYB 3AZNB 1P3IC 3KFUG 3H0LC 3W98C 3MVDD 2RVQD 3AFAD 3REIB 3X1SB 3AZNA 4WU8A 3REIA 1M19C 5CHLB 5B24C 1P3OC 4H9RA 1HQ3D 3C1BA 1U35D 3VH5T 3B6FA 4J8WC 3A1KA 3LZ0B 1S32B 2ZM5A 3REHA 1P3MA 5CP6C 3AZFD 5BT1D 4XZQD 1H3OA 3X1UB 1KX5B 3MGSB 1ID3A 1TZYA 4DQYB 4JJNA 3MGSA 1KX4C 5BO0A 3AV1A 2F8NH 5AV9D 5JA4B 2L5AA 5GT3C 3AZJC 1P3PC 5JA4A 3VH5W 3LELD 5CPKB 5JRGD 4J8VC 3LZ1C 5CPKA 5AY8B 3A6ND 4UUZA 3O62B 3V9RA 4QLCD 5B1MC 5AY8A 3W96D 4DRBA 4J8XB 3MNNA 4WU9B 5GSUD 3B6GC 4XUJD 3KWQB 1M1AD 5B0YC 1P3KD 3KWQA 3AN2A 4Z66D 4J8UB 3WAAB 5B33D 3AFAB 4H9OB 4J8UA 3WAAA 1WWIA 3AZEC 1P3LD 1R4VA 4NE5A 5AV6C 1P34D 4YS3A 1ZLAB 3NQJB 1U35B 3AZHB 1M18A 3NQJA 3RELB 5B31C 3UTAD 1F66B 3AV2A 4R8PA 1F66A 3WKJD 2XD5A 4Z5TD 3AZFB 2PYOC 4XZQB 3AZIB 1KU5A 3MGRC 3AZIA 5BNXA 1AOIC 2F8ND 3X1VC 1BFMA 3LJAC 5AVCA 2JCHA 3W99D 4M6BA 5B2IC 5B40B 1EQZC 5DNMC 3WTPB 5AV8D 2CV5A 3UTBB 4QLCB 3MGPA 1P3BA 1P3GA 1P3FC 4XUJB 3H0RC 1M1AB 1P3KB 4ZUXC 2FJ7A 4ZBJB 2NQBD 2JE5A 3REJD 4Z66B 2BYMB 3UT9B 5CPIA 3WA9C 1Z2CB 3UT9A 4H9SC 2BYMA 2YFVA 5B33B 1B6WA 3AZND 4UPKA 5B1LB 3REID 5B1LA 3MGQC 5G49A 4WZSB 2NZDA 1P3IA 4NE3A 3W98A 5B2JB 3AZGB 4HGAB 2J8PA 5E5AC 3AZGA 1M19A 3UTAB 4KUDC 3AZLB 5B24A 5B32B 3REHD 3W97C 1S32D 1W2EA 4Z5TB 3VH6A 5B32A 4X23B 4X23A 4J8WA 3MVDC 2RVQC 2UWXA 1TZYD 3X1UD 1KX5D 3MGSD 3AV1D 1HQ3C 4H9PB 2ZY2A 3REKB 3B0BA 5CPKD 5AV8B 3AZFC 5BT1C 5AY8D 1JFIB 4H9NB 3O62D 3MNND 5AV5A 3TU4C 4WU9D 4H9QB 3AZKB 4NE6A 3KWQD 5CPJB 3AZKA 1TAFA 5CPJA 3X1TB 2HUEB 5AV9C 4J8UD 3X1TA 1P3AB 3B6GA 5BS7C 4WU8B 5B0YA 3WAAD 3LELC 1P3AA 5JRGC 5AVBB 4H9RB 3A6NC 4LD9B 3C1BB 5AVBA 3AZMC 3W96C 5DNNB 5F99B 3KSYA 1ZLAD 4LD9A 3B6FB 5C3IC 5F99A 5DNNA 3AZEA 1M18D 5AV6A 5GSUC 3AZHD 4KGCB 3RELD 3REHB 1P3MB 3AV2D 4R8PD 1F66D 4KGCA 2Y2JA 3AZID 1H3OB 2BYKB 1ID3B 3A1IA 1TZYB 1P3LC 4JJNB 2BYKA 3KUYC 2Y2GA 5BO0B 1P34C 2PYOA 3B0CT 3AV1B 4G92B 3X1VA 5GXQC 5GT0C 2Y2MA 4UUZB 3LJAA 5B40D 4AWLB 3V9RB 3WKJC 3WTPD 3MNNB 3UTBD 5B2IA 1PZRA 2FJ7D 3AN2B 5CPID 3UT9D 3B0CW 3F6TA 4WNNA 3B0DB 1P3FA 3KXBC 4NFTA 4G91B 4ZUXA 3W99C 3AYWC 5B1LD 3WA9A 4YS3B 3W98D 2CWEA 1KX3C 5B2JD 1M19D 3AZGD 1M18B 2F2AC 2DQNC 3C1CC 3AZLD 3AV2B 2NQBC 4EO5C 4R8PB 3REJC 5B32D 5E5AA 4X23D 4J8WD 4KUDA 5BNXB 3AZNC 3W97A 3REIC 3X1SC 3R45A 4YM6B 4YM6A 2LY8A 5AVCB 2HIOB 2HIOA 2Y2LA 3VH5A 2AROB 3LZ0C 1HQ3A 3REKD 2G5HC 2CV5B 1S32C 2AROA 3MGPB 1P3BB 5B0ZB 1P3GB 5AV5D 1BH9A 5B0ZA 1BH8A 3VH6W 2BG1A 2FJ7B 3X1UC 4CSRA 1KX5C 3MGSC 3AZKD 5CPIB 5CPJD 5B32G 2YFVB 1ULYA 2YFWB 3X1TD 3TU4A 5B0YD 2YFWA 2Y2QA 1P3AD 4WU8D 5G49B 2IO5B 5CPKC 1P3IB 2NZDB 3W98B 5AVBD 3AL0C 5AY8C 4LD9D 3C1BD 3O62C 1M19B 4WJ3C 5F99D 5DNND 4J8XC 5B24B 5AV6D 5JRGA 3B6FD 3P5JB 4WU9C 3A6NA 1P3OA 3KWQC 4KGCD 3AZMA 1P3MD 4J8WB 5GSUA 4J8UC 3WAAC 3AFAC 5BNVA 5CP6B 3WTPE 1ID3D 2PYOD 5CP6A 4JJND 3EPHA 1N1JA 3H0MC 1ZLAC 2ZY5A 1M18C 1U35C 3KUYA 1KX4B 3AZHC 3RELC 1KX4A 1F66C 5GT3B 3AZJB 1P3PB 4XZQC 5GT3A 2DF4C 3AZJA 5FUGA 5AV5B 3AZIC 1P3PA 3IP4C 2Y2OA 5GXQA 2RIQA 3LZ1B 5GT0A 4J8VB 1HTAA 4J8VA 3LZ1A 3WKJA 5B1MB 1TAFB 5B1MA 3AN2D 2F8NA 1P3FD 3B6GB 5B0YB 2Y2KA 3WA9D 2W8SA 5B40C 4YS3D 3WTPC 3KXBA 1F1EA 4DRAA 4QLCC 3NQUA 3UTBC 3AYWA 3AZEB 2JSSA 5AV6B 4XUJC 1M1AC 1P3KC 4ZBJC 1KX3A 3UT9C 5E5AD 4Z66C 3C1CA 4E45A 5B31A 5B33C 3REJA 2PYOB 5B1LC 3EG5B 2F8NK 4YM6D 3MGRB 1AOIB 4CAYA 1A7WA 3MGRA 1AOIA 5B2JC 5AVCD 3AZGC 3X1VB 4HGAC 3X1SA 2HIOD 3UTAC 3AZLC 3LJAB 2AROD 5B32C 3EPJA 2CV5D 4Z5TC 2Y2IA 3MGPD 4X23C 4Z2MH 1P3BD 5B2IB 5B0ZD 1P3GD 1EQZB 5DNMB 3LZ0A 1S32A 1EQZA 3FDDA 5DNMA 4WNNB 1P3FB 3TU4D 4ZUXB 3X1UA 1KX5A 3WA9B 3REKC 2NZDD 4H9SA 1P3ID 5AV8C 2XD1A 2FFFB 5AV5C 3MGQB 5B24D 3MGQA 1P3OD 3AZMD 3AZKC 3O62A 5CPJC 5E5AB 4KUDB 4J8XA 3X1TC 2HUEC 4WU9A 3W97B 3VH6T 1P3AC 4WU8C 4E44A 3R45B 5CP6D 1T3UA 5AVBC 3MVDB 3EPKA 4LD9C 3C1BC 3MVDA 3AFAA 4H9OA 5DNNC 5F99C 1Q9CA 3KUYD 3B6FC 1KX4D 1HQ3B 4KGCC 3REHC 1P3MC 1ZLAA 4KHAB 5GT3D 3AZJD 1P3PD 1U35A 1BH9B 4KHAA 3AZHA 1BH8B 5GXQD 3RELA 5GT0D 4J8VD 4CSRB 3LZ1D 1ID3C 1TZYC 4WV4B 4JJNC 3AZFA 5B1MD 4XZQA 3AV1C 4G92C 3TU4B 2Y2NA 3B6GD 5AV9B 4AWLC 3KXBD 5AV9A 2G5IC 3AYWD 3LELB 5BS7A 3MNNC 5JRGB 3LELA 3AZED 3A6NB 1P3OB 5B40A 1B67A 4Z2MG 3AZMB 3W96B 3WTPA 3UTBA 4QLCA 3AN2C 1KX3D 3W96A 5C3IB 2ZY4A 5GSUB 3C1CD 3B0DC 5B31D 5BNVB 4XUJA 1M1AA 4G91C 1P3KA 4Z66A 4YS3C 1N1JB 1WWSA 3MGRD 5B33A 1AOID 2F8NG 3X1SD 1P3LB 3KUYB 3X1VD 1P34B 2Y2HA 1P3LA 1P34A 2VQRA 3LJAD 3AV2C 4R8PC 5B2JA 5FUGB 5GXQB 3UTAA 5GT0B 4YM6C 5B2ID 3LZ0D 3AZLA 3WKJB 1EQZD 5DNMD 4Z5TA 2Y2PA 2F8NB
chains in the Genus database with same CATH topology
5AVCC 5B31G 4ZUXD 2HIOC 2AROC 3KXBB 2CV5C 3NQUB 3AYWB 3MGPC 3W99B 1P3BC 4H9PA 5B0ZC 3W99A 1P3GC 3MGQD 3REKA 5AV8A 2FJ7C 1KX3B 3EPLA 5CPIC 1JFIA 4H9NA 4J8XD 3C1CB 4KUDD 2ZY3A 5B31B 5KDMB 2NQBB 4EO5B 3REJB 5KDMA 4H9QA 2NQBA 3W97D 2IO5C 2NZDC 4CAYB 3AZNB 1P3IC 3KFUG 3H0LC 3W98C 3MVDD 2RVQD 3AFAD 3REIB 3X1SB 3AZNA 4WU8A 3REIA 1M19C 5CHLB 5B24C 1P3OC 4H9RA 1HQ3D 3C1BA 1U35D 3VH5T 3B6FA 4J8WC 3A1KA 3LZ0B 1S32B 2ZM5A 3REHA 1P3MA 5CP6C 3AZFD 5BT1D 4XZQD 1H3OA 3X1UB 1KX5B 3MGSB 1ID3A 1TZYA 4DQYB 4JJNA 3MGSA 1KX4C 5BO0A 3AV1A 2F8NH 5AV9D 5JA4B 2L5AA 5GT3C 3AZJC 1P3PC 5JA4A 3VH5W 3LELD 5CPKB 5JRGD 4J8VC 3LZ1C 5CPKA 5AY8B 3A6ND 4UUZA 3O62B 3V9RA 4QLCD 5B1MC 5AY8A 3W96D 4DRBA 4J8XB 3MNNA 4WU9B 5GSUD 3B6GC 4XUJD 3KWQB 1M1AD 5B0YC 1P3KD 3KWQA 3AN2A 4Z66D 4J8UB 3WAAB 5B33D 3AFAB 4H9OB 4J8UA 3WAAA 1WWIA 3AZEC 1P3LD 1R4VA 4NE5A 5AV6C 1P34D 4YS3A 1ZLAB 3NQJB 1U35B 3AZHB 1M18A 3NQJA 3RELB 5B31C 3UTAD 1F66B 3AV2A 4R8PA 1F66A 3WKJD 2XD5A 4Z5TD 3AZFB 2PYOC 4XZQB 3AZIB 1KU5A 3MGRC 3AZIA 5BNXA 1AOIC 2F8ND 3X1VC 1BFMA 3LJAC 5AVCA 2JCHA 3W99D 4M6BA 5B2IC 5B40B 1EQZC 5DNMC 3WTPB 5AV8D 2CV5A 3UTBB 4QLCB 3MGPA 1P3BA 1P3GA 1P3FC 4XUJB 3H0RC 1M1AB 1P3KB 4ZUXC 2FJ7A 4ZBJB 2NQBD 2JE5A 3REJD 4Z66B 2BYMB 3UT9B 5CPIA 3WA9C 1Z2CB 3UT9A 4H9SC 2BYMA 2YFVA 5B33B 1B6WA 3AZND 4UPKA 5B1LB 3REID 5B1LA 3MGQC 5G49A 4WZSB 2NZDA 1P3IA 4NE3A 3W98A 5B2JB 3AZGB 4HGAB 2J8PA 5E5AC 3AZGA 1M19A 3UTAB 4KUDC 3AZLB 5B24A 5B32B 3REHD 3W97C 1S32D 1W2EA 4Z5TB 3VH6A 5B32A 4X23B 4X23A 4J8WA 3MVDC 2RVQC 2UWXA 1TZYD 3X1UD 1KX5D 3MGSD 3AV1D 1HQ3C 4H9PB 2ZY2A 3REKB 3B0BA 5CPKD 5AV8B 3AZFC 5BT1C 5AY8D 1JFIB 4H9NB 3O62D 3MNND 5AV5A 3TU4C 4WU9D 4H9QB 3AZKB 4NE6A 3KWQD 5CPJB 3AZKA 1TAFA 5CPJA 3X1TB 2HUEB 5AV9C 4J8UD 3X1TA 1P3AB 3B6GA 5BS7C 4WU8B 5B0YA 3WAAD 3LELC 1P3AA 5JRGC 5AVBB 4H9RB 3A6NC 4LD9B 3C1BB 5AVBA 3AZMC 3W96C 5DNNB 5F99B 3KSYA 1ZLAD 4LD9A 3B6FB 5C3IC 5F99A 5DNNA 3AZEA 1M18D 5AV6A 5GSUC 3AZHD 4KGCB 3RELD 3REHB 1P3MB 3AV2D 4R8PD 1F66D 4KGCA 2Y2JA 3AZID 1H3OB 2BYKB 1ID3B 3A1IA 1TZYB 1P3LC 4JJNB 2BYKA 3KUYC 2Y2GA 5BO0B 1P34C 2PYOA 3B0CT 3AV1B 4G92B 3X1VA 5GXQC 5GT0C 2Y2MA 4UUZB 3LJAA 5B40D 4AWLB 3V9RB 3WKJC 3WTPD 3MNNB 3UTBD 5B2IA 1PZRA 2FJ7D 3AN2B 5CPID 3UT9D 3B0CW 3F6TA 4WNNA 3B0DB 1P3FA 3KXBC 4NFTA 4G91B 4ZUXA 3W99C 3AYWC 5B1LD 3WA9A 4YS3B 3W98D 2CWEA 1KX3C 5B2JD 1M19D 3AZGD 1M18B 2F2AC 2DQNC 3C1CC 3AZLD 3AV2B 2NQBC 4EO5C 4R8PB 3REJC 5B32D 5E5AA 4X23D 4J8WD 4KUDA 5BNXB 3AZNC 3W97A 3REIC 3X1SC 3R45A 4YM6B 4YM6A 2LY8A 5AVCB 2HIOB 2HIOA 2Y2LA 3VH5A 2AROB 3LZ0C 1HQ3A 3REKD 2G5HC 2CV5B 1S32C 2AROA 3MGPB 1P3BB 5B0ZB 1P3GB 5AV5D 1BH9A 5B0ZA 1BH8A 3VH6W 2BG1A 2FJ7B 3X1UC 4CSRA 1KX5C 3MGSC 3AZKD 5CPIB 5CPJD 5B32G 2YFVB 1ULYA 2YFWB 3X1TD 3TU4A 5B0YD 2YFWA 2Y2QA 1P3AD 4WU8D 5G49B 2IO5B 5CPKC 1P3IB 2NZDB 3W98B 5AVBD 3AL0C 5AY8C 4LD9D 3C1BD 3O62C 1M19B 4WJ3C 5F99D 5DNND 4J8XC 5B24B 5AV6D 5JRGA 3B6FD 3P5JB 4WU9C 3A6NA 1P3OA 3KWQC 4KGCD 3AZMA 1P3MD 4J8WB 5GSUA 4J8UC 3WAAC 3AFAC 5BNVA 5CP6B 3WTPE 1ID3D 2PYOD 5CP6A 4JJND 3EPHA 1N1JA 3H0MC 1ZLAC 2ZY5A 1M18C 1U35C 3KUYA 1KX4B 3AZHC 3RELC 1KX4A 1F66C 5GT3B 3AZJB 1P3PB 4XZQC 5GT3A 2DF4C 3AZJA 5FUGA 5AV5B 3AZIC 1P3PA 3IP4C 2Y2OA 5GXQA 2RIQA 3LZ1B 5GT0A 4J8VB 1HTAA 4J8VA 3LZ1A 3WKJA 5B1MB 1TAFB 5B1MA 3AN2D 2F8NA 1P3FD 3B6GB 5B0YB 2Y2KA 3WA9D 2W8SA 5B40C 4YS3D 3WTPC 3KXBA 1F1EA 4DRAA 4QLCC 3NQUA 3UTBC 3AYWA 3AZEB 2JSSA 5AV6B 4XUJC 1M1AC 1P3KC 4ZBJC 1KX3A 3UT9C 5E5AD 4Z66C 3C1CA 4E45A 5B31A 5B33C 3REJA 2PYOB 5B1LC 3EG5B 2F8NK 4YM6D 3MGRB 1AOIB 4CAYA 1A7WA 3MGRA 1AOIA 5B2JC 5AVCD 3AZGC 3X1VB 4HGAC 3X1SA 2HIOD 3UTAC 3AZLC 3LJAB 2AROD 5B32C 3EPJA 2CV5D 4Z5TC 2Y2IA 3MGPD 4X23C 4Z2MH 1P3BD 5B2IB 5B0ZD 1P3GD 1EQZB 5DNMB 3LZ0A 1S32A 1EQZA 3FDDA 5DNMA 4WNNB 1P3FB 3TU4D 4ZUXB 3X1UA 1KX5A 3WA9B 3REKC 2NZDD 4H9SA 1P3ID 5AV8C 2XD1A 2FFFB 5AV5C 3MGQB 5B24D 3MGQA 1P3OD 3AZMD 3AZKC 3O62A 5CPJC 5E5AB 4KUDB 4J8XA 3X1TC 2HUEC 4WU9A 3W97B 3VH6T 1P3AC 4WU8C 4E44A 3R45B 5CP6D 1T3UA 5AVBC 3MVDB 3EPKA 4LD9C 3C1BC 3MVDA 3AFAA 4H9OA 5DNNC 5F99C 1Q9CA 3KUYD 3B6FC 1KX4D 1HQ3B 4KGCC 3REHC 1P3MC 1ZLAA 4KHAB 5GT3D 3AZJD 1P3PD 1U35A 1BH9B 4KHAA 3AZHA 1BH8B 5GXQD 3RELA 5GT0D 4J8VD 4CSRB 3LZ1D 1ID3C 1TZYC 4WV4B 4JJNC 3AZFA 5B1MD 4XZQA 3AV1C 4G92C 3TU4B 2Y2NA 3B6GD 5AV9B 4AWLC 3KXBD 5AV9A 2G5IC 3AYWD 3LELB 5BS7A 3MNNC 5JRGB 3LELA 3AZED 3A6NB 1P3OB 5B40A 1B67A 4Z2MG 3AZMB 3W96B 3WTPA 3UTBA 4QLCA 3AN2C 1KX3D 3W96A 5C3IB 2ZY4A 5GSUB 3C1CD 3B0DC 5B31D 5BNVB 4XUJA 1M1AA 4G91C 1P3KA 4Z66A 4YS3C 1N1JB 1WWSA 3MGRD 5B33A 1AOID 2F8NG 3X1SD 1P3LB 3KUYB 3X1VD 1P34B 2Y2HA 1P3LA 1P34A 2VQRA 3LJAD 3AV2C 4R8PC 5B2JA 5FUGB 5GXQB 3UTAA 5GT0B 4YM6C 5B2ID 3LZ0D 3AZLA 3WKJB 1EQZD 5DNMD 4Z5TA 2Y2PA 2F8NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC C;  5B31 G;  4ZUX D;  2HIO C;  2ARO C;  3KXB B;  2CV5 C;  3NQU B;  3AYW B;  3MGP C;  3W99 B;  1P3B C;  4H9P A;  5B0Z C;  3W99 A;  1P3G C;  3MGQ D;  3REK A;  5AV8 A;  2FJ7 C;  1KX3 B;  5CPI C;  1JFI A;  4H9N A;  4J8X D;  3C1C B;  4KUD D;  5B31 B;  5KDM B;  2NQB B;  4EO5 B;  3REJ B;  5KDM A;  4H9Q A;  2NQB A;  3W97 D;  2IO5 C;  2NZD C;  4CAY B;  3AZN B;  1P3I C;  3W98 C;  3MVD D;  2RVQ D;  3AFA D;  3REI B;  3X1S B;  3AZN A;  4WU8 A;  3REI A;  1M19 C;  5CHL B;  5B24 C;  1P3O C;  4H9R A;  1HQ3 D;  3C1B A;  1U35 D;  3VH5 T;  3B6F A;  4J8W C;  3LZ0 B;  1S32 B;  3REH A;  1P3M A;  5CP6 C;  3AZF D;  5BT1 D;  4XZQ D;  1H3O A;  3X1U B;  1KX5 B;  3MGS B;  1ID3 A;  1TZY A;  4JJN A;  3MGS A;  1KX4 C;  5BO0 A;  3AV1 A;  2F8N H;  5AV9 D;  5JA4 B;  2L5A A;  5GT3 C;  3AZJ C;  1P3P C;  5JA4 A;  3VH5 W;  3LEL D;  5CPK B;  5JRG D;  4J8V C;  3LZ1 C;  5CPK A;  5AY8 B;  3A6N D;  4UUZ A;  3O62 B;  3V9R A;  4QLC D;  5B1M C;  5AY8 A;  3W96 D;  4DRB A;  4J8X B;  3MNN A;  4WU9 B;  5GSU D;  3B6G C;  4XUJ D;  3KWQ B;  1M1A D;  5B0Y C;  1P3K D;  3KWQ A;  3AN2 A;  4Z66 D;  4J8U B;  3WAA B;  5B33 D;  3AFA B;  4H9O B;  4J8U A;  3WAA A;  1WWI A;  3AZE C;  1P3L D;  1R4V A;  4NE5 A;  5AV6 C;  1P34 D;  4YS3 A;  1ZLA B;  3NQJ B;  1U35 B;  3AZH B;  1M18 A;  3NQJ A;  3REL B;  5B31 C;  3UTA D;  1F66 B;  3AV2 A;  4R8P A;  1F66 A;  3WKJ D;  3AZF B;  4Z5T D;  2PYO C;  4XZQ B;  3AZI B;  1KU5 A;  3MGR C;  3AZI A;  5BNX A;  1AOI C;  2F8N D;  3X1V C;  1BFM A;  3LJA C;  5AVC A;  3W99 D;  4M6B A;  5B2I C;  5B40 B;  1EQZ C;  5DNM C;  3WTP B;  5AV8 D;  2CV5 A;  3UTB B;  4QLC B;  3MGP A;  1P3B A;  1P3G A;  1P3F C;  4XUJ B;  1M1A B;  1P3K B;  4ZUX C;  2FJ7 A;  4ZBJ B;  2NQB D;  3UT9 B;  3REJ D;  4Z66 B;  2BYM B;  5CPI A;  3WA9 C;  3UT9 A;  4H9S C;  2BYM A;  2YFV A;  5B33 B;  1B6W A;  3AZN D;  5B1L B;  3REI D;  5B1L A;  3MGQ C;  5G49 A;  4WZS B;  2NZD A;  1P3I A;  4NE3 A;  3W98 A;  5B2J B;  3AZG B;  4HGA B;  5E5A C;  3AZG A;  1M19 A;  3UTA B;  4KUD C;  3AZL B;  5B24 A;  5B32 B;  3REH D;  3W97 C;  1S32 D;  4Z5T B;  3VH6 A;  5B32 A;  4X23 B;  4X23 A;  4J8W A;  3MVD C;  2RVQ C;  1TZY D;  3X1U D;  1KX5 D;  3MGS D;  3AV1 D;  1HQ3 C;  4H9P B;  3REK B;  3B0B A;  5CPK D;  5AV8 B;  3AZF C;  5BT1 C;  5AY8 D;  1JFI B;  4H9N B;  3O62 D;  3MNN D;  5AV5 A;  3TU4 C;  4WU9 D;  4H9Q B;  3AZK B;  4NE6 A;  3KWQ D;  5CPJ B;  3AZK A;  1TAF A;  5CPJ A;  3X1T B;  2HUE B;  5AV9 C;  4J8U D;  3X1T A;  1P3A B;  3B6G A;  5BS7 C;  4WU8 B;  5B0Y A;  3WAA D;  3LEL C;  1P3A A;  5JRG C;  5AVB B;  4H9R B;  3A6N C;  4LD9 B;  3C1B B;  5AVB A;  3AZM C;  3W96 C;  5DNN B;  5F99 B;  3KSY A;  1ZLA D;  4LD9 A;  3B6F B;  5C3I C;  5F99 A;  5DNN A;  3AZE A;  1M18 D;  5AV6 A;  5GSU C;  3AZH D;  4KGC B;  3REL D;  3REH B;  1P3M B;  3AV2 D;  4R8P D;  1F66 D;  4KGC A;  3AZI D;  1H3O B;  2BYK B;  1ID3 B;  1TZY B;  1P3L C;  4JJN B;  2BYK A;  3KUY C;  5BO0 B;  2PYO A;  1P34 C;  3B0C T;  3AV1 B;  4G92 B;  3X1V A;  5GXQ C;  5GT0 C;  4UUZ B;  3LJA A;  5B40 D;  4AWL B;  3V9R B;  3WKJ C;  3WTP D;  3MNN B;  3UTB D;  5B2I A;  2FJ7 D;  3AN2 B;  5CPI D;  3UT9 D;  3B0C W;  4WNN A;  3B0D B;  1P3F A;  3KXB C;  4NFT A;  4G91 B;  4ZUX A;  3W99 C;  3AYW C;  5B1L D;  3WA9 A;  4YS3 B;  3W98 D;  2CWE A;  1KX3 C;  5B2J D;  1M19 D;  3AZG D;  1M18 B;  3C1C C;  3AZL D;  3AV2 B;  2NQB C;  4EO5 C;  4R8P B;  3REJ C;  5B32 D;  5E5A A;  4X23 D;  4J8W D;  4KUD A;  5BNX B;  3AZN C;  3W97 A;  3REI C;  3X1S C;  3R45 A;  4YM6 B;  4YM6 A;  2LY8 A;  5AVC B;  2HIO B;  2HIO A;  3VH5 A;  2ARO B;  3LZ0 C;  1HQ3 A;  3REK D;  2CV5 B;  1S32 C;  2ARO A;  3MGP B;  1P3B B;  5B0Z B;  1P3G B;  5AV5 D;  1BH9 A;  5B0Z A;  1BH8 A;  3VH6 W;  2FJ7 B;  3X1U C;  4CSR A;  1KX5 C;  3MGS C;  3AZK D;  5CPI B;  5CPJ D;  5B32 G;  2YFV B;  1ULY A;  2YFW B;  3X1T D;  3TU4 A;  5B0Y D;  2YFW A;  1P3A D;  4WU8 D;  5G49 B;  2IO5 B;  5CPK C;  1P3I B;  2NZD B;  3W98 B;  5AVB D;  5AY8 C;  4LD9 D;  3C1B D;  3O62 C;  1M19 B;  5F99 D;  5DNN D;  4J8X C;  5B24 B;  5AV6 D;  5JRG A;  3B6F D;  4WU9 C;  3A6N A;  1P3O A;  3KWQ C;  4KGC D;  3AZM A;  1P3M D;  4J8W B;  5GSU A;  4J8U C;  3WAA C;  3AFA C;  5BNV A;  5CP6 B;  3WTP E;  1ID3 D;  2PYO D;  5CP6 A;  4JJN D;  1N1J A;  1ZLA C;  1M18 C;  1U35 C;  3KUY A;  1KX4 B;  3AZH C;  3REL C;  1KX4 A;  1F66 C;  5GT3 B;  3AZJ B;  1P3P B;  4XZQ C;  5GT3 A;  3AZJ A;  3AZI C;  5FUG A;  5AV5 B;  1P3P A;  5GXQ A;  4J8V B;  3LZ1 B;  5GT0 A;  1HTA A;  4J8V A;  3LZ1 A;  3WKJ A;  5B1M B;  1TAF B;  5B1M A;  3AN2 D;  2F8N A;  1P3F D;  3B6G B;  5B0Y B;  3WA9 D;  5B40 C;  4YS3 D;  3WTP C;  3KXB A;  1F1E A;  4DRA A;  4QLC C;  3NQU A;  3UTB C;  3AYW A;  3AZE B;  2JSS A;  5AV6 B;  4XUJ C;  1M1A C;  1P3K C;  4ZBJ C;  1KX3 A;  3UT9 C;  5E5A D;  4Z66 C;  3C1C A;  4E45 A;  5B31 A;  5B33 C;  3REJ A;  2PYO B;  5B1L C;  2F8N K;  4YM6 D;  3MGR B;  1AOI B;  4CAY A;  1A7W A;  3MGR A;  1AOI A;  5B2J C;  5AVC D;  3AZG C;  3X1V B;  4HGA C;  3X1S A;  2HIO D;  3UTA C;  3AZL C;  3LJA B;  2ARO D;  5B32 C;  2CV5 D;  4Z5T C;  3MGP D;  4X23 C;  4Z2M H;  1P3B D;  5B2I B;  5B0Z D;  1P3G D;  1EQZ B;  5DNM B;  3LZ0 A;  1S32 A;  1EQZ A;  5DNM A;  4WNN B;  1P3F B;  3TU4 D;  4ZUX B;  3X1U A;  1KX5 A;  3WA9 B;  3REK C;  2NZD D;  4H9S A;  1P3I D;  5AV8 C;  5AV5 C;  3MGQ B;  5B24 D;  3MGQ A;  1P3O D;  3AZM D;  3AZK C;  3O62 A;  5CPJ C;  5E5A B;  4KUD B;  4J8X A;  3X1T C;  2HUE C;  4WU9 A;  3W97 B;  3VH6 T;  1P3A C;  4WU8 C;  4E44 A;  3R45 B;  5CP6 D;  5AVB C;  3MVD B;  4LD9 C;  3C1B C;  3MVD A;  3AFA A;  4H9O A;  5DNN C;  5F99 C;  1Q9C A;  3KUY D;  3B6F C;  1KX4 D;  1HQ3 B;  4KGC C;  3REH C;  1P3M C;  1ZLA A;  4KHA B;  5GT3 D;  3AZJ D;  1P3P D;  1U35 A;  1BH9 B;  4KHA A;  3AZH A;  1BH8 B;  5GXQ D;  3REL A;  5GT0 D;  4J8V D;  4CSR B;  3LZ1 D;  1ID3 C;  1TZY C;  4WV4 B;  4JJN C;  3AZF A;  5B1M D;  4XZQ A;  3AV1 C;  4G92 C;  3TU4 B;  3B6G D;  5AV9 B;  4AWL C;  3KXB D;  5AV9 A;  3AYW D;  3LEL B;  5BS7 A;  3MNN C;  5JRG B;  3LEL A;  3AZE D;  3A6N B;  1P3O B;  5B40 A;  1B67 A;  4Z2M G;  3AZM B;  3W96 B;  3WTP A;  3UTB A;  4QLC A;  3AN2 C;  1KX3 D;  3W96 A;  5C3I B;  5GSU B;  3C1C D;  3B0D C;  5B31 D;  5BNV B;  4XUJ A;  1M1A A;  4G91 C;  1P3K A;  4Z66 A;  4YS3 C;  1N1J B;  1WWS A;  3MGR D;  5B33 A;  1AOI D;  2F8N G;  3X1S D;  1P3L B;  3KUY B;  3X1V D;  1P34 B;  1P3L A;  1P34 A;  3LJA D;  3AV2 C;  4R8P C;  5B2J A;  5FUG B;  5GXQ B;  3UTA A;  5GT0 B;  5B2I D;  3LZ0 D;  3AZL A;  3WKJ B;  1EQZ D;  5DNM D;  4Z5T A;  4YM6 C;  2F8N B; 
#chains in the Genus database with same CATH topology
 5AVC C;  5B31 G;  4ZUX D;  2HIO C;  2ARO C;  3KXB B;  2CV5 C;  3NQU B;  3AYW B;  3MGP C;  3W99 B;  1P3B C;  4H9P A;  5B0Z C;  3W99 A;  1P3G C;  3MGQ D;  3REK A;  5AV8 A;  2FJ7 C;  1KX3 B;  3EPL A;  5CPI C;  1JFI A;  4H9N A;  4J8X D;  3C1C B;  4KUD D;  2ZY3 A;  5B31 B;  5KDM B;  2NQB B;  4EO5 B;  3REJ B;  5KDM A;  4H9Q A;  2NQB A;  3W97 D;  2IO5 C;  2NZD C;  4CAY B;  3AZN B;  1P3I C;  3KFU G;  3H0L C;  3W98 C;  3MVD D;  2RVQ D;  3AFA D;  3REI B;  3X1S B;  3AZN A;  4WU8 A;  3REI A;  1M19 C;  5CHL B;  5B24 C;  1P3O C;  4H9R A;  1HQ3 D;  3C1B A;  1U35 D;  3VH5 T;  3B6F A;  4J8W C;  3A1K A;  3LZ0 B;  1S32 B;  2ZM5 A;  3REH A;  1P3M A;  5CP6 C;  3AZF D;  5BT1 D;  4XZQ D;  1H3O A;  3X1U B;  1KX5 B;  3MGS B;  1ID3 A;  1TZY A;  4DQY B;  4JJN A;  3MGS A;  1KX4 C;  5BO0 A;  3AV1 A;  2F8N H;  5AV9 D;  5JA4 B;  2L5A A;  5GT3 C;  3AZJ C;  1P3P C;  5JA4 A;  3VH5 W;  3LEL D;  5CPK B;  5JRG D;  4J8V C;  3LZ1 C;  5CPK A;  5AY8 B;  3A6N D;  4UUZ A;  3O62 B;  3V9R A;  4QLC D;  5B1M C;  5AY8 A;  3W96 D;  4DRB A;  4J8X B;  3MNN A;  4WU9 B;  5GSU D;  3B6G C;  4XUJ D;  3KWQ B;  1M1A D;  5B0Y C;  1P3K D;  3KWQ A;  3AN2 A;  4Z66 D;  4J8U B;  3WAA B;  5B33 D;  3AFA B;  4H9O B;  4J8U A;  3WAA A;  1WWI A;  3AZE C;  1P3L D;  1R4V A;  4NE5 A;  5AV6 C;  1P34 D;  4YS3 A;  1ZLA B;  3NQJ B;  1U35 B;  3AZH B;  1M18 A;  3NQJ A;  3REL B;  5B31 C;  3UTA D;  1F66 B;  3AV2 A;  4R8P A;  1F66 A;  3WKJ D;  2XD5 A;  4Z5T D;  3AZF B;  2PYO C;  4XZQ B;  3AZI B;  1KU5 A;  3MGR C;  3AZI A;  5BNX A;  1AOI C;  2F8N D;  3X1V C;  1BFM A;  3LJA C;  5AVC A;  2JCH A;  3W99 D;  4M6B A;  5B2I C;  5B40 B;  1EQZ C;  5DNM C;  3WTP B;  5AV8 D;  2CV5 A;  3UTB B;  4QLC B;  3MGP A;  1P3B A;  1P3G A;  1P3F C;  4XUJ B;  3H0R C;  1M1A B;  1P3K B;  4ZUX C;  2FJ7 A;  4ZBJ B;  2NQB D;  2JE5 A;  3REJ D;  4Z66 B;  2BYM B;  3UT9 B;  5CPI A;  3WA9 C;  1Z2C B;  3UT9 A;  4H9S C;  2BYM A;  2YFV A;  5B33 B;  1B6W A;  3AZN D;  4UPK A;  5B1L B;  3REI D;  5B1L A;  3MGQ C;  5G49 A;  4WZS B;  2NZD A;  1P3I A;  4NE3 A;  3W98 A;  5B2J B;  3AZG B;  4HGA B;  2J8P A;  5E5A C;  3AZG A;  1M19 A;  3UTA B;  4KUD C;  3AZL B;  5B24 A;  5B32 B;  3REH D;  3W97 C;  1S32 D;  1W2E A;  4Z5T B;  3VH6 A;  5B32 A;  4X23 B;  4X23 A;  4J8W A;  3MVD C;  2RVQ C;  2UWX A;  1TZY D;  3X1U D;  1KX5 D;  3MGS D;  3AV1 D;  1HQ3 C;  4H9P B;  2ZY2 A;  3REK B;  3B0B A;  5CPK D;  5AV8 B;  3AZF C;  5BT1 C;  5AY8 D;  1JFI B;  4H9N B;  3O62 D;  3MNN D;  5AV5 A;  3TU4 C;  4WU9 D;  4H9Q B;  3AZK B;  4NE6 A;  3KWQ D;  5CPJ B;  3AZK A;  1TAF A;  5CPJ A;  3X1T B;  2HUE B;  5AV9 C;  4J8U D;  3X1T A;  1P3A B;  3B6G A;  5BS7 C;  4WU8 B;  5B0Y A;  3WAA D;  3LEL C;  1P3A A;  5JRG C;  5AVB B;  4H9R B;  3A6N C;  4LD9 B;  3C1B B;  5AVB A;  3AZM C;  3W96 C;  5DNN B;  5F99 B;  3KSY A;  1ZLA D;  4LD9 A;  3B6F B;  5C3I C;  5F99 A;  5DNN A;  3AZE A;  1M18 D;  5AV6 A;  5GSU C;  3AZH D;  4KGC B;  3REL D;  3REH B;  1P3M B;  3AV2 D;  4R8P D;  1F66 D;  4KGC A;  2Y2J A;  3AZI D;  1H3O B;  2BYK B;  1ID3 B;  3A1I A;  1TZY B;  1P3L C;  4JJN B;  2BYK A;  3KUY C;  2Y2G A;  5BO0 B;  1P34 C;  2PYO A;  3B0C T;  3AV1 B;  4G92 B;  3X1V A;  5GXQ C;  5GT0 C;  2Y2M A;  4UUZ B;  3LJA A;  5B40 D;  4AWL B;  3V9R B;  3WKJ C;  3WTP D;  3MNN B;  3UTB D;  5B2I A;  1PZR A;  2FJ7 D;  3AN2 B;  5CPI D;  3UT9 D;  3B0C W;  3F6T A;  4WNN A;  3B0D B;  1P3F A;  3KXB C;  4NFT A;  4G91 B;  4ZUX A;  3W99 C;  3AYW C;  5B1L D;  3WA9 A;  4YS3 B;  3W98 D;  2CWE A;  1KX3 C;  5B2J D;  1M19 D;  3AZG D;  1M18 B;  2F2A C;  2DQN C;  3C1C C;  3AZL D;  3AV2 B;  2NQB C;  4EO5 C;  4R8P B;  3REJ C;  5B32 D;  5E5A A;  4X23 D;  4J8W D;  4KUD A;  5BNX B;  3AZN C;  3W97 A;  3REI C;  3X1S C;  3R45 A;  4YM6 B;  4YM6 A;  2LY8 A;  5AVC B;  2HIO B;  2HIO A;  2Y2L A;  3VH5 A;  2ARO B;  3LZ0 C;  1HQ3 A;  3REK D;  2G5H C;  2CV5 B;  1S32 C;  2ARO A;  3MGP B;  1P3B B;  5B0Z B;  1P3G B;  5AV5 D;  1BH9 A;  5B0Z A;  1BH8 A;  3VH6 W;  2BG1 A;  2FJ7 B;  3X1U C;  4CSR A;  1KX5 C;  3MGS C;  3AZK D;  5CPI B;  5CPJ D;  5B32 G;  2YFV B;  1ULY A;  2YFW B;  3X1T D;  3TU4 A;  5B0Y D;  2YFW A;  2Y2Q A;  1P3A D;  4WU8 D;  5G49 B;  2IO5 B;  5CPK C;  1P3I B;  2NZD B;  3W98 B;  5AVB D;  3AL0 C;  5AY8 C;  4LD9 D;  3C1B D;  3O62 C;  1M19 B;  4WJ3 C;  5F99 D;  5DNN D;  4J8X C;  5B24 B;  5AV6 D;  5JRG A;  3B6F D;  3P5J B;  4WU9 C;  3A6N A;  1P3O A;  3KWQ C;  4KGC D;  3AZM A;  1P3M D;  4J8W B;  5GSU A;  4J8U C;  3WAA C;  3AFA C;  5BNV A;  5CP6 B;  3WTP E;  1ID3 D;  2PYO D;  5CP6 A;  4JJN D;  3EPH A;  1N1J A;  3H0M C;  1ZLA C;  2ZY5 A;  1M18 C;  1U35 C;  3KUY A;  1KX4 B;  3AZH C;  3REL C;  1KX4 A;  1F66 C;  5GT3 B;  3AZJ B;  1P3P B;  4XZQ C;  5GT3 A;  2DF4 C;  3AZJ A;  5FUG A;  5AV5 B;  3AZI C;  1P3P A;  3IP4 C;  2Y2O A;  5GXQ A;  2RIQ A;  3LZ1 B;  5GT0 A;  4J8V B;  1HTA A;  4J8V A;  3LZ1 A;  3WKJ A;  5B1M B;  1TAF B;  5B1M A;  3AN2 D;  2F8N A;  1P3F D;  3B6G B;  5B0Y B;  2Y2K A;  3WA9 D;  2W8S A;  5B40 C;  4YS3 D;  3WTP C;  3KXB A;  1F1E A;  4DRA A;  4QLC C;  3NQU A;  3UTB C;  3AYW A;  3AZE B;  2JSS A;  5AV6 B;  4XUJ C;  1M1A C;  1P3K C;  4ZBJ C;  1KX3 A;  3UT9 C;  5E5A D;  4Z66 C;  3C1C A;  4E45 A;  5B31 A;  5B33 C;  3REJ A;  2PYO B;  5B1L C;  3EG5 B;  2F8N K;  4YM6 D;  3MGR B;  1AOI B;  4CAY A;  1A7W A;  3MGR A;  1AOI A;  5B2J C;  5AVC D;  3AZG C;  3X1V B;  4HGA C;  3X1S A;  2HIO D;  3UTA C;  3AZL C;  3LJA B;  2ARO D;  5B32 C;  3EPJ A;  2CV5 D;  4Z5T C;  2Y2I A;  3MGP D;  4X23 C;  4Z2M H;  1P3B D;  5B2I B;  5B0Z D;  1P3G D;  1EQZ B;  5DNM B;  3LZ0 A;  1S32 A;  1EQZ A;  3FDD A;  5DNM A;  4WNN B;  1P3F B;  3TU4 D;  4ZUX B;  3X1U A;  1KX5 A;  3WA9 B;  3REK C;  2NZD D;  4H9S A;  1P3I D;  5AV8 C;  2XD1 A;  2FFF B;  5AV5 C;  3MGQ B;  5B24 D;  3MGQ A;  1P3O D;  3AZM D;  3AZK C;  3O62 A;  5CPJ C;  5E5A B;  4KUD B;  4J8X A;  3X1T C;  2HUE C;  4WU9 A;  3W97 B;  3VH6 T;  1P3A C;  4WU8 C;  4E44 A;  3R45 B;  5CP6 D;  1T3U A;  5AVB C;  3MVD B;  3EPK A;  4LD9 C;  3C1B C;  3MVD A;  3AFA A;  4H9O A;  5DNN C;  5F99 C;  1Q9C A;  3KUY D;  3B6F C;  1KX4 D;  1HQ3 B;  4KGC C;  3REH C;  1P3M C;  1ZLA A;  4KHA B;  5GT3 D;  3AZJ D;  1P3P D;  1U35 A;  1BH9 B;  4KHA A;  3AZH A;  1BH8 B;  5GXQ D;  3REL A;  5GT0 D;  4J8V D;  4CSR B;  3LZ1 D;  1ID3 C;  1TZY C;  4WV4 B;  4JJN C;  3AZF A;  5B1M D;  4XZQ A;  3AV1 C;  4G92 C;  3TU4 B;  2Y2N A;  3B6G D;  5AV9 B;  4AWL C;  3KXB D;  5AV9 A;  2G5I C;  3AYW D;  3LEL B;  5BS7 A;  3MNN C;  5JRG B;  3LEL A;  3AZE D;  3A6N B;  1P3O B;  5B40 A;  1B67 A;  4Z2M G;  3AZM B;  3W96 B;  3WTP A;  3UTB A;  4QLC A;  3AN2 C;  1KX3 D;  3W96 A;  5C3I B;  2ZY4 A;  5GSU B;  3C1C D;  3B0D C;  5B31 D;  5BNV B;  4XUJ A;  1M1A A;  4G91 C;  1P3K A;  4Z66 A;  4YS3 C;  1N1J B;  1WWS A;  3MGR D;  5B33 A;  1AOI D;  2F8N G;  3X1S D;  1P3L B;  3KUY B;  3X1V D;  1P34 B;  2Y2H A;  1P3L A;  1P34 A;  2VQR A;  3LJA D;  3AV2 C;  4R8P C;  5B2J A;  5FUG B;  5GXQ B;  3UTA A;  5GT0 B;  4YM6 C;  5B2I D;  3LZ0 D;  3AZL A;  3WKJ B;  1EQZ D;  5DNM D;  4Z5T A;  2Y2P A;  2F8N B; 
#chains in the Genus database with same CATH homology
 5AVC C;  5B31 G;  4ZUX D;  2HIO C;  2ARO C;  3KXB B;  2CV5 C;  3NQU B;  3AYW B;  3MGP C;  3W99 B;  1P3B C;  4H9P A;  5B0Z C;  3W99 A;  1P3G C;  3MGQ D;  3REK A;  5AV8 A;  2FJ7 C;  1KX3 B;  3EPL A;  5CPI C;  1JFI A;  4H9N A;  4J8X D;  3C1C B;  4KUD D;  2ZY3 A;  5B31 B;  5KDM B;  2NQB B;  4EO5 B;  3REJ B;  5KDM A;  4H9Q A;  2NQB A;  3W97 D;  2IO5 C;  2NZD C;  4CAY B;  3AZN B;  1P3I C;  3KFU G;  3H0L C;  3W98 C;  3MVD D;  2RVQ D;  3AFA D;  3REI B;  3X1S B;  3AZN A;  4WU8 A;  3REI A;  1M19 C;  5CHL B;  5B24 C;  1P3O C;  4H9R A;  1HQ3 D;  3C1B A;  1U35 D;  3VH5 T;  3B6F A;  4J8W C;  3A1K A;  3LZ0 B;  1S32 B;  2ZM5 A;  3REH A;  1P3M A;  5CP6 C;  3AZF D;  5BT1 D;  4XZQ D;  1H3O A;  3X1U B;  1KX5 B;  3MGS B;  1ID3 A;  1TZY A;  4DQY B;  4JJN A;  3MGS A;  1KX4 C;  5BO0 A;  3AV1 A;  2F8N H;  5AV9 D;  5JA4 B;  2L5A A;  5GT3 C;  3AZJ C;  1P3P C;  5JA4 A;  3VH5 W;  3LEL D;  5CPK B;  5JRG D;  4J8V C;  3LZ1 C;  5CPK A;  5AY8 B;  3A6N D;  4UUZ A;  3O62 B;  3V9R A;  4QLC D;  5B1M C;  5AY8 A;  3W96 D;  4DRB A;  4J8X B;  3MNN A;  4WU9 B;  5GSU D;  3B6G C;  4XUJ D;  3KWQ B;  1M1A D;  5B0Y C;  1P3K D;  3KWQ A;  3AN2 A;  4Z66 D;  4J8U B;  3WAA B;  5B33 D;  3AFA B;  4H9O B;  4J8U A;  3WAA A;  1WWI A;  3AZE C;  1P3L D;  1R4V A;  4NE5 A;  5AV6 C;  1P34 D;  4YS3 A;  1ZLA B;  3NQJ B;  1U35 B;  3AZH B;  1M18 A;  3NQJ A;  3REL B;  5B31 C;  3UTA D;  1F66 B;  3AV2 A;  4R8P A;  1F66 A;  3WKJ D;  2XD5 A;  4Z5T D;  3AZF B;  2PYO C;  4XZQ B;  3AZI B;  1KU5 A;  3MGR C;  3AZI A;  5BNX A;  1AOI C;  2F8N D;  3X1V C;  1BFM A;  3LJA C;  5AVC A;  2JCH A;  3W99 D;  4M6B A;  5B2I C;  5B40 B;  1EQZ C;  5DNM C;  3WTP B;  5AV8 D;  2CV5 A;  3UTB B;  4QLC B;  3MGP A;  1P3B A;  1P3G A;  1P3F C;  4XUJ B;  3H0R C;  1M1A B;  1P3K B;  4ZUX C;  2FJ7 A;  4ZBJ B;  2NQB D;  2JE5 A;  3REJ D;  4Z66 B;  2BYM B;  3UT9 B;  5CPI A;  3WA9 C;  1Z2C B;  3UT9 A;  4H9S C;  2BYM A;  2YFV A;  5B33 B;  1B6W A;  3AZN D;  4UPK A;  5B1L B;  3REI D;  5B1L A;  3MGQ C;  5G49 A;  4WZS B;  2NZD A;  1P3I A;  4NE3 A;  3W98 A;  5B2J B;  3AZG B;  4HGA B;  2J8P A;  5E5A C;  3AZG A;  1M19 A;  3UTA B;  4KUD C;  3AZL B;  5B24 A;  5B32 B;  3REH D;  3W97 C;  1S32 D;  1W2E A;  4Z5T B;  3VH6 A;  5B32 A;  4X23 B;  4X23 A;  4J8W A;  3MVD C;  2RVQ C;  2UWX A;  1TZY D;  3X1U D;  1KX5 D;  3MGS D;  3AV1 D;  1HQ3 C;  4H9P B;  2ZY2 A;  3REK B;  3B0B A;  5CPK D;  5AV8 B;  3AZF C;  5BT1 C;  5AY8 D;  1JFI B;  4H9N B;  3O62 D;  3MNN D;  5AV5 A;  3TU4 C;  4WU9 D;  4H9Q B;  3AZK B;  4NE6 A;  3KWQ D;  5CPJ B;  3AZK A;  1TAF A;  5CPJ A;  3X1T B;  2HUE B;  5AV9 C;  4J8U D;  3X1T A;  1P3A B;  3B6G A;  5BS7 C;  4WU8 B;  5B0Y A;  3WAA D;  3LEL C;  1P3A A;  5JRG C;  5AVB B;  4H9R B;  3A6N C;  4LD9 B;  3C1B B;  5AVB A;  3AZM C;  3W96 C;  5DNN B;  5F99 B;  3KSY A;  1ZLA D;  4LD9 A;  3B6F B;  5C3I C;  5F99 A;  5DNN A;  3AZE A;  1M18 D;  5AV6 A;  5GSU C;  3AZH D;  4KGC B;  3REL D;  3REH B;  1P3M B;  3AV2 D;  4R8P D;  1F66 D;  4KGC A;  2Y2J A;  3AZI D;  1H3O B;  2BYK B;  1ID3 B;  3A1I A;  1TZY B;  1P3L C;  4JJN B;  2BYK A;  3KUY C;  2Y2G A;  5BO0 B;  1P34 C;  2PYO A;  3B0C T;  3AV1 B;  4G92 B;  3X1V A;  5GXQ C;  5GT0 C;  2Y2M A;  4UUZ B;  3LJA A;  5B40 D;  4AWL B;  3V9R B;  3WKJ C;  3WTP D;  3MNN B;  3UTB D;  5B2I A;  1PZR A;  2FJ7 D;  3AN2 B;  5CPI D;  3UT9 D;  3B0C W;  3F6T A;  4WNN A;  3B0D B;  1P3F A;  3KXB C;  4NFT A;  4G91 B;  4ZUX A;  3W99 C;  3AYW C;  5B1L D;  3WA9 A;  4YS3 B;  3W98 D;  2CWE A;  1KX3 C;  5B2J D;  1M19 D;  3AZG D;  1M18 B;  2F2A C;  2DQN C;  3C1C C;  3AZL D;  3AV2 B;  2NQB C;  4EO5 C;  4R8P B;  3REJ C;  5B32 D;  5E5A A;  4X23 D;  4J8W D;  4KUD A;  5BNX B;  3AZN C;  3W97 A;  3REI C;  3X1S C;  3R45 A;  4YM6 B;  4YM6 A;  2LY8 A;  5AVC B;  2HIO B;  2HIO A;  2Y2L A;  3VH5 A;  2ARO B;  3LZ0 C;  1HQ3 A;  3REK D;  2G5H C;  2CV5 B;  1S32 C;  2ARO A;  3MGP B;  1P3B B;  5B0Z B;  1P3G B;  5AV5 D;  1BH9 A;  5B0Z A;  1BH8 A;  3VH6 W;  2BG1 A;  2FJ7 B;  3X1U C;  4CSR A;  1KX5 C;  3MGS C;  3AZK D;  5CPI B;  5CPJ D;  5B32 G;  2YFV B;  1ULY A;  2YFW B;  3X1T D;  3TU4 A;  5B0Y D;  2YFW A;  2Y2Q A;  1P3A D;  4WU8 D;  5G49 B;  2IO5 B;  5CPK C;  1P3I B;  2NZD B;  3W98 B;  5AVB D;  3AL0 C;  5AY8 C;  4LD9 D;  3C1B D;  3O62 C;  1M19 B;  4WJ3 C;  5F99 D;  5DNN D;  4J8X C;  5B24 B;  5AV6 D;  5JRG A;  3B6F D;  3P5J B;  4WU9 C;  3A6N A;  1P3O A;  3KWQ C;  4KGC D;  3AZM A;  1P3M D;  4J8W B;  5GSU A;  4J8U C;  3WAA C;  3AFA C;  5BNV A;  5CP6 B;  3WTP E;  1ID3 D;  2PYO D;  5CP6 A;  4JJN D;  3EPH A;  1N1J A;  3H0M C;  1ZLA C;  2ZY5 A;  1M18 C;  1U35 C;  3KUY A;  1KX4 B;  3AZH C;  3REL C;  1KX4 A;  1F66 C;  5GT3 B;  3AZJ B;  1P3P B;  4XZQ C;  5GT3 A;  2DF4 C;  3AZJ A;  5FUG A;  5AV5 B;  3AZI C;  1P3P A;  3IP4 C;  2Y2O A;  5GXQ A;  2RIQ A;  3LZ1 B;  5GT0 A;  4J8V B;  1HTA A;  4J8V A;  3LZ1 A;  3WKJ A;  5B1M B;  1TAF B;  5B1M A;  3AN2 D;  2F8N A;  1P3F D;  3B6G B;  5B0Y B;  2Y2K A;  3WA9 D;  2W8S A;  5B40 C;  4YS3 D;  3WTP C;  3KXB A;  1F1E A;  4DRA A;  4QLC C;  3NQU A;  3UTB C;  3AYW A;  3AZE B;  2JSS A;  5AV6 B;  4XUJ C;  1M1A C;  1P3K C;  4ZBJ C;  1KX3 A;  3UT9 C;  5E5A D;  4Z66 C;  3C1C A;  4E45 A;  5B31 A;  5B33 C;  3REJ A;  2PYO B;  5B1L C;  3EG5 B;  2F8N K;  4YM6 D;  3MGR B;  1AOI B;  4CAY A;  1A7W A;  3MGR A;  1AOI A;  5B2J C;  5AVC D;  3AZG C;  3X1V B;  4HGA C;  3X1S A;  2HIO D;  3UTA C;  3AZL C;  3LJA B;  2ARO D;  5B32 C;  3EPJ A;  2CV5 D;  4Z5T C;  2Y2I A;  3MGP D;  4X23 C;  4Z2M H;  1P3B D;  5B2I B;  5B0Z D;  1P3G D;  1EQZ B;  5DNM B;  3LZ0 A;  1S32 A;  1EQZ A;  3FDD A;  5DNM A;  4WNN B;  1P3F B;  3TU4 D;  4ZUX B;  3X1U A;  1KX5 A;  3WA9 B;  3REK C;  2NZD D;  4H9S A;  1P3I D;  5AV8 C;  2XD1 A;  2FFF B;  5AV5 C;  3MGQ B;  5B24 D;  3MGQ A;  1P3O D;  3AZM D;  3AZK C;  3O62 A;  5CPJ C;  5E5A B;  4KUD B;  4J8X A;  3X1T C;  2HUE C;  4WU9 A;  3W97 B;  3VH6 T;  1P3A C;  4WU8 C;  4E44 A;  3R45 B;  5CP6 D;  1T3U A;  5AVB C;  3MVD B;  3EPK A;  4LD9 C;  3C1B C;  3MVD A;  3AFA A;  4H9O A;  5DNN C;  5F99 C;  1Q9C A;  3KUY D;  3B6F C;  1KX4 D;  1HQ3 B;  4KGC C;  3REH C;  1P3M C;  1ZLA A;  4KHA B;  5GT3 D;  3AZJ D;  1P3P D;  1U35 A;  1BH9 B;  4KHA A;  3AZH A;  1BH8 B;  5GXQ D;  3REL A;  5GT0 D;  4J8V D;  4CSR B;  3LZ1 D;  1ID3 C;  1TZY C;  4WV4 B;  4JJN C;  3AZF A;  5B1M D;  4XZQ A;  3AV1 C;  4G92 C;  3TU4 B;  2Y2N A;  3B6G D;  5AV9 B;  4AWL C;  3KXB D;  5AV9 A;  2G5I C;  3AYW D;  3LEL B;  5BS7 A;  3MNN C;  5JRG B;  3LEL A;  3AZE D;  3A6N B;  1P3O B;  5B40 A;  1B67 A;  4Z2M G;  3AZM B;  3W96 B;  3WTP A;  3UTB A;  4QLC A;  3AN2 C;  1KX3 D;  3W96 A;  5C3I B;  2ZY4 A;  5GSU B;  3C1C D;  3B0D C;  5B31 D;  5BNV B;  4XUJ A;  1M1A A;  4G91 C;  1P3K A;  4Z66 A;  4YS3 C;  1N1J B;  1WWS A;  3MGR D;  5B33 A;  1AOI D;  2F8N G;  3X1S D;  1P3L B;  3KUY B;  3X1V D;  1P34 B;  2Y2H A;  1P3L A;  1P34 A;  2VQR A;  3LJA D;  3AV2 C;  4R8P C;  5B2J A;  5FUG B;  5GXQ B;  3UTA A;  5GT0 B;  4YM6 C;  5B2I D;  3LZ0 D;  3AZL A;  3WKJ B;  1EQZ D;  5DNM D;  4Z5T A;  2Y2P A;  2F8N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...