5B40B

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
b'NIQGITCPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40B00
3X1SD 5BO0B 3WKJC 4NE3A 3WTPA 4XZQA 3AN2A 4ZUXC 3KWQB 4H9NA 5CP6A 4CAYB 2HUEC 1AOIA 5B2JD 4YM6A 3UT9C 3AZJB 5B0ZC 4Z66D 2FJ7B 4WNNA 2NQBD 1M19A 3AV2B 2F8NH 1ZLAC 5E5AB 5B1MD 5GT0B 3NQJB 3MNNB 1P3PC 3MGQD 1KX3C 3WKJA 3A6ND 3LELC 4J8VB 3MGSB 5AY8D 1P3AD 3VH6A 1Q9CA 3MGRA 1P3OD 3W96C 4QLCD 5B0ZA 3REKA 3X1UD 2AROB 1P34A 1ZLAA 3TU4B 3W97B 1KX4B 1P3MD 3C1BC 5B33C 1EQZD 1B67A 3B6FD 3W99D 5AV6B 1P3KC 5CPIC 5CPKD 3AYWD 3KXBD 4WU8D 5GXQB 3W96A 3X1TA 2F8NB 1JFIB 3MGPB 3X1VB 4KGCA 5AV5B 3AZIA 4ZBJB 2NZDA 5B32C 1HQ3B 4WU9B 1KX5D 1ID3D 5GT3C 1B6WA 3KUYD 3AZHB 1M1AC 3LZ1A 4H9SA 2PYOD 3AZLC 3UTBC 1N1JB 5B1LB 1F66B 1P3BC 4J8VC 5AV9B 5CPIA 4X23D 5C3IB 5DNMB 2HIOB 3W98C 1U35D 3AZJA 4H9PB 3REJB 5B32A 5E5AA 3R45B 5GT0A 5B2JC 4J8UD 1M18D 3MNNA 2NQBC 4XZQB 3LZ0B 3AZLA 3AN2B 5B1MC 3KSYA 4KHAA 3MGSA 4J8VA 4JJNB 1P3FD 3WAAD 3MGQC 3B6GD 2IO5B 2AROA 5AY8C 1P3AC 1P3OC 1BH9A 1P3ID 3W97A 5GSUD 4QLCC 5B2IB 3WKJB 3REHD 3AZFC 4H9RA 4ZUXB 4LD9D 3AV1D 4J8WC 2HUEB 3UT9B 4CSRA 5CPJC 5B0ZB 5GXQA 1ZLAB 3B6FC 3W99C 3AYWC 1P3AA 4WU8C 1P3OA 1P3PB 4WZSB 4HGAC 5BNVA 4E44A 5AVCD 3WA9D 1KX3B 3LELB 3AZFA 1F1EA 3AZHA 1KX5C 5B1LA 1ID3C 4J8WA 1R4VA 2LY8A 3W96B 5AV9A 4JJNC 5CPJA 5DNMA 2HIOA 1HTAA 5B40D 5BS7C 3AZMD 1WWSA 3B6FA 3W99A 3AZED 4KUDD 3AFAC 3REJA 4X23C 5B31C 4Z5TC 3R45A 3LJAD 5B33B 3B0DC 3C1BB 1S32C 3KWQD 3UTAD 3LZ0A 3AZGD 5CPIB 1P3KB 1KX5A 2F8NK 4G92C 4J8UC 4JJNA 2FJ7D 3AV2D 1P3LD 3AFAA 5B32B 4X23A 3VH5W 1P3FC 5B31A 4Z5TA 4H9QA 5GT3B 4XUJC 5AVBD 5G49B 1M1AB 4NFTA 5B2IA 1S32A 3AZLB 3UTBB 3C1CC 1P3BB 4KHAB 4ZUXA 4J8UA 3W98B 3X1SB 3REHC 5JRGD 4YS3D 4J8XD 3UT9A 3AZNC 2JSSA 5DNND 5B32G 3AV1C 3O62D 3REIC 4LD9C 1BH9B 1P3FA 5AV8D 5B2JB 4XUJA 1P3PA 2NQBB 2BYKA 1TZYC 4H9RB 1KX3A 5B1MB 3LELA 5B24D 3C1CA 2F8ND 4CSRB 3MGQB 4NE5A 3MGPD 1P3GC 5AV5D 3AZNA 5AY8B 1P3AB 1HQ3D 3REIA 1P3OB 5B0YD 5BNVB 4QLCB 3X1UB 5B40C 3AZFB 4AWLC 1F66D 1H3OB 3AZEC 1TZYA 4KUDC 5B33A 3VH5T 3C1BA 2CV5D 4J8WB 1P3KA 5CPJB 3LJAC 4WV4B 3X1SC 1P3GA 2F8NG 3B6FB 3W99B 3UTAC 3AZGC 5CPKB 3AYWB 4WU8B 3AZKD 5BT1D 4HGAB 3WTPD 1TAFB 5GT3A 1P3LC 4Z66C 3AN2D 5G49A 1M1AA 5CP6D 4KUDA 3UTBA 1KX5B 1ID3B 1AOID 4YM6D 4Z2MH 1P3BA 5AVBC 1M19D 3W98A 3X1SA 3A6NC 3AFAB 4X23B 5B31B 4Z5TB 4H9QB 1U35B 3WKJD 5B2JA 5JRGC 4YS3C 4J8XC 1S32B 3B0DB 3X1UC 4Z66A 2NQBA 5DNNC 3O62C 3MGRD 5B1MA 5AV8C 4J8UB 4G92B 5B0ZD 2BYMA 3VH5A 3REKD 4NE6A 1P34D 3MGQA 1P3MC 3A6NA 1EQZC 5B24C 5B31G 4EO5C 5AY8A 5CPKC 1P3FB 3WAAB 3KXBC 4XUJB 5FUGB 4QLCA 2BYKB 3B0BA 3X1UA 3C1CB 1H3OA 3RELD 5AV8A 3X1TD 5B0YC 4KGCD 3KUYC 3REHB 3AZID 4UUZA 3WTPE 3MVDD 1P3MA 3AZNB 2NZDD 1EQZA 2PYOC 5F99D 5JA4A 3AV1B 2CV5C 3REIB 4R8PD 4LD9B 4E45A 5CPKA 3AYWA 3KXBA 4WU8A 3LZ1D 1U35C 1TAFA 1TZYB 5CPID 3B0CW 3AZKC 5BT1C 5B0YA 1ID3A 3WTPC 5AVCB 3AZJD 1P3GB 1M18C 3KUYA 3V9RB 5CP6C 5BS7A 5B32D 2PYOA 5E5AD 2YFVB 1AOIC 5GT0D 4YM6C 2CWEA 3MNND 1M19C 3WAAC 5B40B 3B6GC 1U35A 4AWLB 3AZEB 4KUDB 4J8VD 3MGSD 2RVQD 2YFWB 1P3IC 1BFMA 5GSUC 3LJAB 1M18A 2AROD 3UTAB 3MGRC 3TU4D 3AZGB 4M6BA 3W97D 3REKC 1KX4D 1P34C 3WAAA 3B6GA 1P3LB 4Z66B 5FUGA 1BH8A 5AV6D 2BYMB 5GXQD 5AVBB 1P3IA 5GSUA 5AVCC 3WA9C 3X1VD 3A6NB 3B0CT 3REHA 3RELC 1KU5A 3X1TC 4LD9A 5BNXB 4WU9D 3AV1A 4KGCC 3AZIC 3AZFD 5JRGB 4YS3B 4G91C 3MVDC 4J8XB 3AZHD 2NZDC 3AZMC 5DNNB 5F99C 5B1LD 3O62B 4J8WD 4R8PC 5AV9D 5AV8B 1A7WA 5CPJD 5DNMD 3LZ1C 2HIOD 4H9SC 4UUZB 5AVCA 1P3MB 3WA9A 3REJD 1EQZB 5B24B 5JA4B 3KWQC 3RELA 4EO5B 3NQUA 2YFVA 3KXBB 3AZJC 2FJ7C 3MVDA 3AV2C 5B40A 4XZQD 3LZ0D 3AZMA 5E5AC 5F99A 5GT0C 4R8PA 3AZEA 5KDMB 3MNNC 4JJND 5B0YB 4H9OB 3V9RA 2YFWA 5BO0A 3KUYB 3LJAA 3MGSC 3AFAD 2PYOB 2CV5B 2RVQC 4DRBA 4Z5TD 5B31D 3KWQA 1ULYA 3UTAA 3AZGA 4CAYA 5B2ID 1S32D 5CHLB 2AROC 2FJ7A 3AV2A 3TU4C 1P3LA 3VH6W 4ZUXD 3AZKB 3NQJA 3W97C 1KX4C 3WTPB 3UT9D 1M18B 5AVBA 4H9NB 5CP6B 1ZLAD 5AV6C 1AOIB 4YM6B 4XUJD 5GXQC 1P3PD 4WNNB 1M19B 1WWIA 5BNXA 3MGPC 3B6GB 3X1VC 1KX3D 5AV5C 3LELD 3C1CD 5JRGA 4YS3A 4J8XA 4ZBJC 3TU4A 1BH8B 4DRAA 5DNNA 1HQ3C 4WU9C 3O62A 1P3IB 1KX4A 3W96D 2L5AA 5GSUB 3AZHC 3AZND 5B1LC 3REID 1F66C 3MGRB 5AV6A 5AV9C 5B24A 5C3IC 5DNMC 3REKB 2HIOC 1P34B 1JFIA 2F8NA 3MGPA 3X1VA 1TZYD 5B33D 5AV5A 3C1BD 3REJC 4Z2MG 1P3KD 1HQ3A 4WU9A 1P3GD 5KDMA 4H9OA 3WA9B 4XZQC 3VH6T 3LZ0C 1N1JA 3AN2C 1F66A 3RELB 3NQUB 3X1TB 2CV5A 4KGCB 5GT3D 2IO5C 3AZIB 4G91B 3MVDB 1M1AD 4H9PA 2NZDB 3AZMB 3AZLD 5F99B 3UTBD 4R8PB 1P3BD 3W98D 3AZKA 3LZ1B 5B2IC
chains in the Genus database with same CATH superfamily
3X1SD 5BO0B 3WKJC 4NE3A 3WTPA 4XZQA 3AN2A 4ZUXC 3KWQB 4H9NA 5CP6A 4CAYB 2HUEC 1AOIA 5B2JD 4YM6A 3UT9C 3AZJB 5B0ZC 3AL0C 4Z66D 2FJ7B 4WNNA 2NQBD 3A1KA 1M19A 3AV2B 2F8NH 1ZLAC 5E5AB 2Y2NA 5B1MD 5GT0B 3NQJB 3MNNB 1P3PC 3MGQD 2J8PA 1KX3C 3WKJA 3A6ND 3LELC 4J8VB 2G5HC 3MGSB 5AY8D 1P3AD 3VH6A 1Q9CA 3MGRA 1P3OD 3W96C 4QLCD 5B0ZA 3REKA 3X1UD 2AROB 2Y2IA 1P34A 1ZLAA 3TU4B 3W97B 1KX4B 2ZY4A 1P3MD 3C1BC 5B33C 1EQZD 1B67A 3B6FD 3W99D 5AV6B 1P3KC 5CPIC 5CPKD 3AYWD 3KXBD 4WU8D 5GXQB 3W96A 3X1TA 2F8NB 1JFIB 3MGPB 3X1VB 4KGCA 5AV5B 3AZIA 4ZBJB 2NZDA 5B32C 1HQ3B 4WU9B 1KX5D 1ID3D 2Y2LA 1B6WA 5GT3C 3KUYD 3AZHB 1M1AC 3LZ1A 4H9SA 2PYOD 3AZLC 3UTBC 1N1JB 5B1LB 2Y2MA 1F66B 1P3BC 3P5JB 5AV9B 4J8VC 5CPIA 4X23D 5C3IB 5DNMB 2HIOB 3W98C 1U35D 3AZJA 4H9PB 3REJB 5B32A 5E5AA 3R45B 5GT0A 5B2JC 4J8UD 1M18D 3MNNA 2ZY2A 2NQBC 4XZQB 3LZ0B 3AZLA 3AN2B 5B1MC 2DF4C 3KSYA 4KHAA 3MGSA 4J8VA 4JJNB 1P3FD 3WAAD 2DQNC 3MGQC 3B6GD 2IO5B 3EPJA 2Y2KA 2AROA 5AY8C 1P3AC 1P3OC 1BH9A 1P3ID 3W97A 5GSUD 4QLCC 5B2IB 3WKJB 3REHD 3AZFC 4H9RA 4UPKA 4ZUXB 2ZM5A 4LD9D 3AV1D 4J8WC 2HUEB 3UT9B 4CSRA 5CPJC 5B0ZB 5GXQA 2ZY3A 1ZLAB 3B6FC 3W99C 3AYWC 1P3AA 4WU8C 1P3OA 1P3PB 4WZSB 4HGAC 5BNVA 4E44A 5AVCD 3WA9D 1KX3B 3LELB 3AZFA 1F1EA 3AZHA 2JCHA 3IP4C 1KX5C 5B1LA 1ID3C 4J8WA 1R4VA 2LY8A 3W96B 5AV9A 4JJNC 5CPJA 5DNMA 2HIOA 1HTAA 5B40D 5BS7C 3AZMD 1WWSA 3B6FA 3W99A 3AZED 4KUDD 3AFAC 3REJA 4X23C 5B31C 4Z5TC 3R45A 3H0LC 3LJAD 5B33B 3B0DC 3C1BB 1S32C 3KWQD 3UTAD 3LZ0A 3AZGD 2Y2HA 5CPIB 1P3KB 1KX5A 4G92C 4J8UC 2F8NK 4JJNA 2FJ7D 3AV2D 1P3LD 3AFAA 5B32B 4X23A 3VH5W 1P3FC 5B31A 4Z5TA 4H9QA 5GT3B 4XUJC 5AVBD 5G49B 1M1AB 4NFTA 5B2IA 1S32A 3AZLB 3UTBB 3C1CC 1P3BB 4KHAB 4ZUXA 4J8UA 3W98B 3X1SB 3REHC 5JRGD 4YS3D 4J8XD 3UT9A 3AZNC 2JSSA 5DNND 5B32G 3AV1C 3O62D 3REIC 4LD9C 1BH9B 1P3FA 5AV8D 5B2JB 4XUJA 1P3PA 2NQBB 1Z2CB 2BYKA 1TZYC 4H9RB 1KX3A 5B1MB 3LELA 2ZY5A 5B24D 3C1CA 4WJ3C 2F8ND 4CSRB 3MGQB 4NE5A 3MGPD 1P3GC 5AV5D 3AZNA 5AY8B 1P3AB 1HQ3D 2Y2PA 3REIA 1P3OB 2F2AC 5B0YD 5BNVB 4QLCB 3X1UB 5B40C 3AZFB 4AWLC 1F66D 3KFUG 1H3OB 3AZEC 1TZYA 4KUDC 5B33A 3VH5T 3C1BA 2CV5D 4J8WB 1P3KA 5CPJB 2W8SA 3LJAC 4WV4B 3X1SC 1P3GA 2F8NG 3B6FB 3W99B 3UTAC 3AZGC 5CPKB 3AYWB 4WU8B 3AZKD 2BG1A 5BT1D 4HGAB 3WTPD 1TAFB 5GT3A 1P3LC 4Z66C 3AN2D 5G49A 1M1AA 5CP6D 4KUDA 3F6TA 3H0MC 3UTBA 1KX5B 1ID3B 1AOID 3EPHA 4YM6D 4Z2MH 1P3BA 5AVBC 2UWXA 1M19D 3W98A 3X1SA 3A6NC 3AFAB 4X23B 5B31B 4Z5TB 4H9QB 1U35B 3WKJD 5B2JA 5JRGC 4YS3C 4J8XC 1S32B 3B0DB 3X1UC 4Z66A 2NQBA 5DNNC 3O62C 3MGRD 5B1MA 5AV8C 4J8UB 4G92B 5B0ZD 2BYMA 3VH5A 3REKD 4NE6A 1P34D 3MGQA 1P3MC 3A6NA 1EQZC 5B24C 5B31G 4EO5C 5AY8A 5CPKC 1P3FB 3WAAB 3KXBC 4XUJB 5FUGB 4QLCA 2BYKB 3B0BA 3X1UA 3C1CB 2Y2QA 1H3OA 3RELD 5AV8A 3X1TD 5B0YC 4KGCD 3KUYC 3REHB 3AZID 4UUZA 3WTPE 3MVDD 1P3MA 3AZNB 2NZDD 1EQZA 2PYOC 5F99D 5JA4A 3AV1B 2CV5C 3REIB 4R8PD 4LD9B 4E45A 5CPKA 3AYWA 3KXBA 4WU8A 3LZ1D 1U35C 1TAFA 1TZYB 5CPID 3B0CW 3AZKC 2Y2JA 5BT1C 5B0YA 1ID3A 3WTPC 5AVCB 3AZJD 1P3GB 1M18C 3KUYA 3V9RB 5CP6C 5BS7A 5B32D 2PYOA 5E5AD 3EG5B 2YFVB 1AOIC 5GT0D 4YM6C 2CWEA 3MNND 1M19C 3WAAC 5B40B 3B6GC 1U35A 4AWLB 3EPKA 3AZEB 4KUDB 4J8VD 3MGSD 2RVQD 2YFWB 1P3IC 1BFMA 5GSUC 3LJAB 1M18A 2AROD 3UTAB 3MGRC 3TU4D 3AZGB 4M6BA 3W97D 3REKC 1KX4D 1P34C 3WAAA 3B6GA 1P3LB 2XD5A 4Z66B 5FUGA 1BH8A 5AV6D 2BYMB 5GXQD 5AVBB 1P3IA 3A1IA 5GSUA 5AVCC 3WA9C 3X1VD 3A6NB 3B0CT 3REHA 3RELC 1KU5A 3X1TC 4LD9A 5BNXB 4WU9D 3AV1A 4KGCC 3AZIC 3AZFD 5JRGB 4YS3B 4G91C 3MVDC 4J8XB 3AZHD 2NZDC 3AZMC 5DNNB 5F99C 5B1LD 3O62B 4J8WD 4R8PC 5AV9D 2JE5A 1A7WA 5AV8B 5CPJD 5DNMD 3LZ1C 2HIOD 4H9SC 4UUZB 5AVCA 1P3MB 3WA9A 3REJD 1EQZB 5B24B 5JA4B 3KWQC 3RELA 4EO5B 3NQUA 2YFVA 3KXBB 3AZJC 2FJ7C 3MVDA 3AV2C 5B40A 4XZQD 2Y2OA 3LZ0D 3AZMA 5E5AC 5F99A 5GT0C 4R8PA 3AZEA 5KDMB 3MNNC 4JJND 5B0YB 4H9OB 3V9RA 2YFWA 5BO0A 3KUYB 3LJAA 3MGSC 3AFAD 2PYOB 2CV5B 2RVQC 4DRBA 4Z5TD 5B31D 3KWQA 1ULYA 2Y2GA 3UTAA 4CAYA 3AZGA 5B2ID 1S32D 5CHLB 2AROC 2FJ7A 3AV2A 3TU4C 1P3LA 3VH6W 4ZUXD 3AZKB 3NQJA 3W97C 1KX4C 3WTPB 3UT9D 1T3UA 1M18B 5AVBA 4H9NB 5CP6B 1ZLAD 5AV6C 1AOIB 4YM6B 4XUJD 5GXQC 1P3PD 4WNNB 1M19B 1WWIA 5BNXA 3MGPC 3B6GB 3X1VC 1KX3D 5AV5C 3LELD 3C1CD 5JRGA 4YS3A 4J8XA 2VQRA 4ZBJC 3TU4A 1BH8B 4DRAA 2XD1A 5DNNA 1HQ3C 4WU9C 3O62A 1P3IB 1KX4A 3W96D 2L5AA 5GSUB 3AZHC 2FFFB 3AZND 5B1LC 3REID 1F66C 3MGRB 5AV6A 3FDDA 3H0RC 5AV9C 5B24A 5C3IC 5DNMC 3REKB 2HIOC 2RIQA 3EPLA 1P34B 1JFIA 2F8NA 3MGPA 3X1VA 1TZYD 5B33D 5AV5A 3C1BD 3REJC 2G5IC 1W2EA 4Z2MG 1P3KD 1HQ3A 4WU9A 1P3GD 5KDMA 4H9OA 3WA9B 4XZQC 3VH6T 3LZ0C 1N1JA 3AN2C 1F66A 3RELB 4DQYB 3NQUB 1PZRA 3X1TB 2CV5A 4KGCB 5GT3D 2IO5C 3AZIB 4G91B 3MVDB 1M1AD 4H9PA 2NZDB 3AZMB 3AZLD 5F99B 3UTBD 4R8PB 1P3BD 3W98D 3AZKA 3LZ1B 5B2IC
chains in the Genus database with same CATH topology
3X1SD 5BO0B 3WKJC 4NE3A 3WTPA 4XZQA 3AN2A 4ZUXC 3KWQB 4H9NA 5CP6A 4CAYB 2HUEC 1AOIA 5B2JD 4YM6A 3UT9C 3AZJB 5B0ZC 3AL0C 4Z66D 2FJ7B 4WNNA 2NQBD 3A1KA 1M19A 3AV2B 2F8NH 1ZLAC 5E5AB 2Y2NA 5B1MD 5GT0B 3NQJB 3MNNB 1P3PC 3MGQD 2J8PA 1KX3C 3WKJA 3A6ND 3LELC 4J8VB 2G5HC 3MGSB 5AY8D 1P3AD 3VH6A 1Q9CA 3MGRA 1P3OD 3W96C 4QLCD 5B0ZA 3REKA 3X1UD 2AROB 2Y2IA 1P34A 1ZLAA 3TU4B 3W97B 1KX4B 2ZY4A 1P3MD 3C1BC 5B33C 1EQZD 1B67A 3B6FD 3W99D 5AV6B 1P3KC 5CPIC 5CPKD 3AYWD 3KXBD 4WU8D 5GXQB 3W96A 3X1TA 2F8NB 1JFIB 3MGPB 3X1VB 4KGCA 5AV5B 3AZIA 4ZBJB 2NZDA 5B32C 1HQ3B 4WU9B 1KX5D 1ID3D 2Y2LA 1B6WA 5GT3C 3KUYD 3AZHB 1M1AC 3LZ1A 4H9SA 2PYOD 3AZLC 3UTBC 1N1JB 5B1LB 2Y2MA 1F66B 1P3BC 3P5JB 5AV9B 4J8VC 5CPIA 4X23D 5C3IB 5DNMB 2HIOB 3W98C 1U35D 3AZJA 4H9PB 3REJB 5B32A 5E5AA 3R45B 5GT0A 5B2JC 4J8UD 1M18D 3MNNA 2ZY2A 2NQBC 4XZQB 3LZ0B 3AZLA 3AN2B 5B1MC 2DF4C 3KSYA 4KHAA 3MGSA 4J8VA 4JJNB 1P3FD 3WAAD 2DQNC 3MGQC 3B6GD 2IO5B 3EPJA 2Y2KA 2AROA 5AY8C 1P3AC 1P3OC 1BH9A 1P3ID 3W97A 5GSUD 4QLCC 5B2IB 3WKJB 3REHD 3AZFC 4H9RA 4UPKA 4ZUXB 2ZM5A 4LD9D 3AV1D 4J8WC 2HUEB 3UT9B 4CSRA 5CPJC 5B0ZB 5GXQA 2ZY3A 1ZLAB 3B6FC 3W99C 3AYWC 1P3AA 4WU8C 1P3OA 1P3PB 4WZSB 4HGAC 5BNVA 4E44A 5AVCD 3WA9D 1KX3B 3LELB 3AZFA 1F1EA 3AZHA 2JCHA 3IP4C 1KX5C 5B1LA 1ID3C 4J8WA 1R4VA 2LY8A 3W96B 5AV9A 4JJNC 5CPJA 5DNMA 2HIOA 1HTAA 5B40D 5BS7C 3AZMD 1WWSA 3B6FA 3W99A 3AZED 4KUDD 3AFAC 3REJA 4X23C 5B31C 4Z5TC 3R45A 3H0LC 3LJAD 5B33B 3B0DC 3C1BB 1S32C 3KWQD 3UTAD 3LZ0A 3AZGD 2Y2HA 5CPIB 1P3KB 1KX5A 4G92C 4J8UC 2F8NK 4JJNA 2FJ7D 3AV2D 1P3LD 3AFAA 5B32B 4X23A 3VH5W 1P3FC 5B31A 4Z5TA 4H9QA 5GT3B 4XUJC 5AVBD 5G49B 1M1AB 4NFTA 5B2IA 1S32A 3AZLB 3UTBB 3C1CC 1P3BB 4KHAB 4ZUXA 4J8UA 3W98B 3X1SB 3REHC 5JRGD 4YS3D 4J8XD 3UT9A 3AZNC 2JSSA 5DNND 5B32G 3AV1C 3O62D 3REIC 4LD9C 1BH9B 1P3FA 5AV8D 5B2JB 4XUJA 1P3PA 2NQBB 1Z2CB 2BYKA 1TZYC 4H9RB 1KX3A 5B1MB 3LELA 2ZY5A 5B24D 3C1CA 4WJ3C 2F8ND 4CSRB 3MGQB 4NE5A 3MGPD 1P3GC 5AV5D 3AZNA 5AY8B 1P3AB 1HQ3D 2Y2PA 3REIA 1P3OB 2F2AC 5B0YD 5BNVB 4QLCB 3X1UB 5B40C 3AZFB 4AWLC 1F66D 3KFUG 1H3OB 3AZEC 1TZYA 4KUDC 5B33A 3VH5T 3C1BA 2CV5D 4J8WB 1P3KA 5CPJB 2W8SA 3LJAC 4WV4B 3X1SC 1P3GA 2F8NG 3B6FB 3W99B 3UTAC 3AZGC 5CPKB 3AYWB 4WU8B 3AZKD 2BG1A 5BT1D 4HGAB 3WTPD 1TAFB 5GT3A 1P3LC 4Z66C 3AN2D 5G49A 1M1AA 5CP6D 4KUDA 3F6TA 3H0MC 3UTBA 1KX5B 1ID3B 1AOID 3EPHA 4YM6D 4Z2MH 1P3BA 5AVBC 2UWXA 1M19D 3W98A 3X1SA 3A6NC 3AFAB 4X23B 5B31B 4Z5TB 4H9QB 1U35B 3WKJD 5B2JA 5JRGC 4YS3C 4J8XC 1S32B 3B0DB 3X1UC 4Z66A 2NQBA 5DNNC 3O62C 3MGRD 5B1MA 5AV8C 4J8UB 4G92B 5B0ZD 2BYMA 3VH5A 3REKD 4NE6A 1P34D 3MGQA 1P3MC 3A6NA 1EQZC 5B24C 5B31G 4EO5C 5AY8A 5CPKC 1P3FB 3WAAB 3KXBC 4XUJB 5FUGB 4QLCA 2BYKB 3B0BA 3X1UA 3C1CB 2Y2QA 1H3OA 3RELD 5AV8A 3X1TD 5B0YC 4KGCD 3KUYC 3REHB 3AZID 4UUZA 3WTPE 3MVDD 1P3MA 3AZNB 2NZDD 1EQZA 2PYOC 5F99D 5JA4A 3AV1B 2CV5C 3REIB 4R8PD 4LD9B 4E45A 5CPKA 3AYWA 3KXBA 4WU8A 3LZ1D 1U35C 1TAFA 1TZYB 5CPID 3B0CW 3AZKC 2Y2JA 5BT1C 5B0YA 1ID3A 3WTPC 5AVCB 3AZJD 1P3GB 1M18C 3KUYA 3V9RB 5CP6C 5BS7A 5B32D 2PYOA 5E5AD 3EG5B 2YFVB 1AOIC 5GT0D 4YM6C 2CWEA 3MNND 1M19C 3WAAC 5B40B 3B6GC 1U35A 4AWLB 3EPKA 3AZEB 4KUDB 4J8VD 3MGSD 2RVQD 2YFWB 1P3IC 1BFMA 5GSUC 3LJAB 1M18A 2AROD 3UTAB 3MGRC 3TU4D 3AZGB 4M6BA 3W97D 3REKC 1KX4D 1P34C 3WAAA 3B6GA 1P3LB 2XD5A 4Z66B 5FUGA 1BH8A 5AV6D 2BYMB 5GXQD 5AVBB 1P3IA 3A1IA 5GSUA 5AVCC 3WA9C 3X1VD 3A6NB 3B0CT 3REHA 3RELC 1KU5A 3X1TC 4LD9A 5BNXB 4WU9D 3AV1A 4KGCC 3AZIC 3AZFD 5JRGB 4YS3B 4G91C 3MVDC 4J8XB 3AZHD 2NZDC 3AZMC 5DNNB 5F99C 5B1LD 3O62B 4J8WD 4R8PC 5AV9D 2JE5A 1A7WA 5AV8B 5CPJD 5DNMD 3LZ1C 2HIOD 4H9SC 4UUZB 5AVCA 1P3MB 3WA9A 3REJD 1EQZB 5B24B 5JA4B 3KWQC 3RELA 4EO5B 3NQUA 2YFVA 3KXBB 3AZJC 2FJ7C 3MVDA 3AV2C 5B40A 4XZQD 2Y2OA 3LZ0D 3AZMA 5E5AC 5F99A 5GT0C 4R8PA 3AZEA 5KDMB 3MNNC 4JJND 5B0YB 4H9OB 3V9RA 2YFWA 5BO0A 3KUYB 3LJAA 3MGSC 3AFAD 2PYOB 2CV5B 2RVQC 4DRBA 4Z5TD 5B31D 3KWQA 1ULYA 2Y2GA 3UTAA 4CAYA 3AZGA 5B2ID 1S32D 5CHLB 2AROC 2FJ7A 3AV2A 3TU4C 1P3LA 3VH6W 4ZUXD 3AZKB 3NQJA 3W97C 1KX4C 3WTPB 3UT9D 1T3UA 1M18B 5AVBA 4H9NB 5CP6B 1ZLAD 5AV6C 1AOIB 4YM6B 4XUJD 5GXQC 1P3PD 4WNNB 1M19B 1WWIA 5BNXA 3MGPC 3B6GB 3X1VC 1KX3D 5AV5C 3LELD 3C1CD 5JRGA 4YS3A 4J8XA 2VQRA 4ZBJC 3TU4A 1BH8B 4DRAA 2XD1A 5DNNA 1HQ3C 4WU9C 3O62A 1P3IB 1KX4A 3W96D 2L5AA 5GSUB 3AZHC 2FFFB 3AZND 5B1LC 3REID 1F66C 3MGRB 5AV6A 3FDDA 3H0RC 5AV9C 5B24A 5C3IC 5DNMC 3REKB 2HIOC 2RIQA 3EPLA 1P34B 1JFIA 2F8NA 3MGPA 3X1VA 1TZYD 5B33D 5AV5A 3C1BD 3REJC 2G5IC 1W2EA 4Z2MG 1P3KD 1HQ3A 4WU9A 1P3GD 5KDMA 4H9OA 3WA9B 4XZQC 3VH6T 3LZ0C 1N1JA 3AN2C 1F66A 3RELB 4DQYB 3NQUB 1PZRA 3X1TB 2CV5A 4KGCB 5GT3D 2IO5C 3AZIB 4G91B 3MVDB 1M1AD 4H9PA 2NZDB 3AZMB 3AZLD 5F99B 3UTBD 4R8PB 1P3BD 3W98D 3AZKA 3LZ1B 5B2IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S D;  5BO0 B;  3WKJ C;  4NE3 A;  3WTP A;  4XZQ A;  3AN2 A;  4ZUX C;  3KWQ B;  4H9N A;  5CP6 A;  4CAY B;  2HUE C;  1AOI A;  5B2J D;  4YM6 A;  3UT9 C;  3AZJ B;  5B0Z C;  4Z66 D;  2FJ7 B;  4WNN A;  2NQB D;  1M19 A;  3AV2 B;  2F8N H;  1ZLA C;  5E5A B;  5B1M D;  5GT0 B;  3NQJ B;  3MNN B;  1P3P C;  3MGQ D;  1KX3 C;  3WKJ A;  3A6N D;  3LEL C;  4J8V B;  3MGS B;  5AY8 D;  1P3A D;  3VH6 A;  1Q9C A;  3MGR A;  1P3O D;  3W96 C;  4QLC D;  5B0Z A;  3REK A;  3X1U D;  2ARO B;  1P34 A;  1ZLA A;  3TU4 B;  3W97 B;  1KX4 B;  1P3M D;  3C1B C;  5B33 C;  1EQZ D;  1B67 A;  3B6F D;  3W99 D;  5AV6 B;  1P3K C;  5CPI C;  5CPK D;  3AYW D;  3KXB D;  4WU8 D;  5GXQ B;  3W96 A;  3X1T A;  2F8N B;  1JFI B;  3MGP B;  3X1V B;  4KGC A;  5AV5 B;  3AZI A;  4ZBJ B;  2NZD A;  5B32 C;  1HQ3 B;  4WU9 B;  1KX5 D;  1ID3 D;  5GT3 C;  1B6W A;  3KUY D;  3AZH B;  1M1A C;  3LZ1 A;  4H9S A;  2PYO D;  3AZL C;  3UTB C;  1N1J B;  5B1L B;  1F66 B;  1P3B C;  4J8V C;  5AV9 B;  5CPI A;  4X23 D;  5C3I B;  5DNM B;  2HIO B;  3W98 C;  1U35 D;  3AZJ A;  4H9P B;  3REJ B;  5B32 A;  5E5A A;  3R45 B;  5GT0 A;  5B2J C;  4J8U D;  1M18 D;  3MNN A;  2NQB C;  4XZQ B;  3LZ0 B;  3AZL A;  3AN2 B;  5B1M C;  3KSY A;  4KHA A;  3MGS A;  4J8V A;  4JJN B;  1P3F D;  3WAA D;  3MGQ C;  3B6G D;  2IO5 B;  2ARO A;  5AY8 C;  1P3A C;  1P3O C;  1BH9 A;  1P3I D;  3W97 A;  5GSU D;  4QLC C;  5B2I B;  3WKJ B;  3REH D;  3AZF C;  4H9R A;  4ZUX B;  4LD9 D;  3AV1 D;  4J8W C;  2HUE B;  3UT9 B;  4CSR A;  5CPJ C;  5B0Z B;  5GXQ A;  1ZLA B;  3B6F C;  3W99 C;  3AYW C;  1P3A A;  4WU8 C;  1P3O A;  1P3P B;  4WZS B;  4HGA C;  5BNV A;  4E44 A;  5AVC D;  3WA9 D;  1KX3 B;  3LEL B;  3AZF A;  1F1E A;  3AZH A;  1KX5 C;  5B1L A;  1ID3 C;  4J8W A;  1R4V A;  2LY8 A;  3W96 B;  5AV9 A;  4JJN C;  5CPJ A;  5DNM A;  2HIO A;  1HTA A;  5B40 D;  5BS7 C;  3AZM D;  1WWS A;  3B6F A;  3W99 A;  3AZE D;  4KUD D;  3AFA C;  3REJ A;  4X23 C;  5B31 C;  4Z5T C;  3R45 A;  3LJA D;  5B33 B;  3B0D C;  3C1B B;  1S32 C;  3KWQ D;  3UTA D;  3LZ0 A;  3AZG D;  5CPI B;  1P3K B;  1KX5 A;  2F8N K;  4G92 C;  4J8U C;  4JJN A;  2FJ7 D;  3AV2 D;  1P3L D;  3AFA A;  5B32 B;  4X23 A;  3VH5 W;  1P3F C;  5B31 A;  4Z5T A;  4H9Q A;  5GT3 B;  4XUJ C;  5AVB D;  5G49 B;  1M1A B;  4NFT A;  5B2I A;  1S32 A;  3AZL B;  3UTB B;  3C1C C;  1P3B B;  4KHA B;  4ZUX A;  4J8U A;  3W98 B;  3X1S B;  3REH C;  5JRG D;  4YS3 D;  4J8X D;  3UT9 A;  3AZN C;  2JSS A;  5DNN D;  5B32 G;  3AV1 C;  3O62 D;  3REI C;  4LD9 C;  1BH9 B;  1P3F A;  5AV8 D;  5B2J B;  4XUJ A;  1P3P A;  2NQB B;  2BYK A;  1TZY C;  4H9R B;  1KX3 A;  5B1M B;  3LEL A;  5B24 D;  3C1C A;  2F8N D;  4CSR B;  3MGQ B;  4NE5 A;  3MGP D;  1P3G C;  5AV5 D;  3AZN A;  5AY8 B;  1P3A B;  1HQ3 D;  3REI A;  1P3O B;  5B0Y D;  5BNV B;  4QLC B;  3X1U B;  5B40 C;  3AZF B;  4AWL C;  1F66 D;  1H3O B;  3AZE C;  1TZY A;  4KUD C;  5B33 A;  3VH5 T;  3C1B A;  2CV5 D;  4J8W B;  1P3K A;  5CPJ B;  3LJA C;  4WV4 B;  3X1S C;  1P3G A;  2F8N G;  3B6F B;  3W99 B;  3UTA C;  3AZG C;  5CPK B;  3AYW B;  4WU8 B;  3AZK D;  5BT1 D;  4HGA B;  3WTP D;  1TAF B;  5GT3 A;  1P3L C;  4Z66 C;  3AN2 D;  5G49 A;  1M1A A;  5CP6 D;  4KUD A;  3UTB A;  1KX5 B;  1ID3 B;  1AOI D;  4YM6 D;  4Z2M H;  1P3B A;  5AVB C;  1M19 D;  3W98 A;  3X1S A;  3A6N C;  3AFA B;  4X23 B;  5B31 B;  4Z5T B;  4H9Q B;  1U35 B;  3WKJ D;  5B2J A;  5JRG C;  4YS3 C;  4J8X C;  1S32 B;  3B0D B;  3X1U C;  4Z66 A;  2NQB A;  5DNN C;  3O62 C;  3MGR D;  5B1M A;  5AV8 C;  4J8U B;  4G92 B;  5B0Z D;  2BYM A;  3VH5 A;  3REK D;  4NE6 A;  1P34 D;  3MGQ A;  1P3M C;  3A6N A;  1EQZ C;  5B24 C;  5B31 G;  4EO5 C;  5AY8 A;  5CPK C;  1P3F B;  3WAA B;  3KXB C;  4XUJ B;  5FUG B;  4QLC A;  2BYK B;  3B0B A;  3X1U A;  3C1C B;  1H3O A;  3REL D;  5AV8 A;  3X1T D;  5B0Y C;  4KGC D;  3KUY C;  3REH B;  3AZI D;  4UUZ A;  3WTP E;  3MVD D;  1P3M A;  3AZN B;  2NZD D;  1EQZ A;  2PYO C;  5F99 D;  5JA4 A;  3AV1 B;  2CV5 C;  3REI B;  4R8P D;  4LD9 B;  4E45 A;  5CPK A;  3AYW A;  3KXB A;  4WU8 A;  3LZ1 D;  1U35 C;  1TAF A;  1TZY B;  5CPI D;  3B0C W;  3AZK C;  5BT1 C;  5B0Y A;  1ID3 A;  3WTP C;  5AVC B;  3AZJ D;  1P3G B;  1M18 C;  3KUY A;  3V9R B;  5CP6 C;  5BS7 A;  5B32 D;  2PYO A;  5E5A D;  2YFV B;  1AOI C;  5GT0 D;  4YM6 C;  2CWE A;  3MNN D;  1M19 C;  3WAA C;  5B40 B;  3B6G C;  1U35 A;  4AWL B;  3AZE B;  4KUD B;  4J8V D;  3MGS D;  2RVQ D;  2YFW B;  1P3I C;  1BFM A;  5GSU C;  3LJA B;  1M18 A;  2ARO D;  3UTA B;  3MGR C;  3TU4 D;  3AZG B;  4M6B A;  3W97 D;  3REK C;  1KX4 D;  1P34 C;  3WAA A;  3B6G A;  1P3L B;  4Z66 B;  5FUG A;  1BH8 A;  5AV6 D;  2BYM B;  5GXQ D;  5AVB B;  1P3I A;  5GSU A;  5AVC C;  3WA9 C;  3X1V D;  3A6N B;  3B0C T;  3REH A;  3REL C;  1KU5 A;  3X1T C;  4LD9 A;  5BNX B;  4WU9 D;  3AV1 A;  4KGC C;  3AZI C;  3AZF D;  5JRG B;  4YS3 B;  4G91 C;  3MVD C;  4J8X B;  3AZH D;  2NZD C;  3AZM C;  5DNN B;  5F99 C;  5B1L D;  3O62 B;  4J8W D;  4R8P C;  5AV9 D;  5AV8 B;  1A7W A;  5CPJ D;  5DNM D;  3LZ1 C;  2HIO D;  4H9S C;  4UUZ B;  5AVC A;  1P3M B;  3WA9 A;  3REJ D;  1EQZ B;  5B24 B;  5JA4 B;  3KWQ C;  3REL A;  4EO5 B;  3NQU A;  2YFV A;  3KXB B;  3AZJ C;  2FJ7 C;  3MVD A;  3AV2 C;  5B40 A;  4XZQ D;  3LZ0 D;  3AZM A;  5E5A C;  5F99 A;  5GT0 C;  4R8P A;  3AZE A;  5KDM B;  3MNN C;  4JJN D;  5B0Y B;  4H9O B;  3V9R A;  2YFW A;  5BO0 A;  3KUY B;  3LJA A;  3MGS C;  3AFA D;  2PYO B;  2CV5 B;  2RVQ C;  4DRB A;  4Z5T D;  5B31 D;  3KWQ A;  1ULY A;  3UTA A;  3AZG A;  4CAY A;  5B2I D;  1S32 D;  5CHL B;  2ARO C;  2FJ7 A;  3AV2 A;  3TU4 C;  1P3L A;  3VH6 W;  4ZUX D;  3AZK B;  3NQJ A;  3W97 C;  1KX4 C;  3WTP B;  3UT9 D;  1M18 B;  5AVB A;  4H9N B;  5CP6 B;  1ZLA D;  5AV6 C;  1AOI B;  4YM6 B;  4XUJ D;  5GXQ C;  1P3P D;  4WNN B;  1M19 B;  1WWI A;  5BNX A;  3MGP C;  3B6G B;  3X1V C;  1KX3 D;  5AV5 C;  3LEL D;  3C1C D;  5JRG A;  4YS3 A;  4J8X A;  4ZBJ C;  3TU4 A;  1BH8 B;  4DRA A;  5DNN A;  1HQ3 C;  4WU9 C;  3O62 A;  1P3I B;  1KX4 A;  3W96 D;  2L5A A;  5GSU B;  3AZH C;  3AZN D;  5B1L C;  3REI D;  1F66 C;  3MGR B;  5AV6 A;  5AV9 C;  5B24 A;  5C3I C;  5DNM C;  3REK B;  2HIO C;  1P34 B;  1JFI A;  2F8N A;  3MGP A;  3X1V A;  1TZY D;  5B33 D;  5AV5 A;  3C1B D;  3REJ C;  4Z2M G;  1P3K D;  1HQ3 A;  4WU9 A;  1P3G D;  5KDM A;  4H9O A;  3WA9 B;  4XZQ C;  3VH6 T;  3LZ0 C;  1N1J A;  3AN2 C;  1F66 A;  3REL B;  3NQU B;  3X1T B;  2CV5 A;  4KGC B;  5GT3 D;  2IO5 C;  3AZI B;  4G91 B;  3MVD B;  1M1A D;  4H9P A;  2NZD B;  3AZM B;  3AZL D;  5F99 B;  3UTB D;  4R8P B;  1P3B D;  3W98 D;  3AZK A;  3LZ1 B;  5B2I C; 
#chains in the Genus database with same CATH topology
 3X1S D;  5BO0 B;  3WKJ C;  4NE3 A;  3WTP A;  4XZQ A;  3AN2 A;  4ZUX C;  3KWQ B;  4H9N A;  5CP6 A;  4CAY B;  2HUE C;  1AOI A;  5B2J D;  4YM6 A;  3UT9 C;  3AZJ B;  5B0Z C;  3AL0 C;  4Z66 D;  2FJ7 B;  4WNN A;  2NQB D;  3A1K A;  1M19 A;  3AV2 B;  2F8N H;  1ZLA C;  5E5A B;  2Y2N A;  5B1M D;  5GT0 B;  3NQJ B;  3MNN B;  1P3P C;  3MGQ D;  2J8P A;  1KX3 C;  3WKJ A;  3A6N D;  3LEL C;  4J8V B;  2G5H C;  3MGS B;  5AY8 D;  1P3A D;  3VH6 A;  1Q9C A;  3MGR A;  1P3O D;  3W96 C;  4QLC D;  5B0Z A;  3REK A;  3X1U D;  2ARO B;  2Y2I A;  1P34 A;  1ZLA A;  3TU4 B;  3W97 B;  1KX4 B;  2ZY4 A;  1P3M D;  3C1B C;  5B33 C;  1EQZ D;  1B67 A;  3B6F D;  3W99 D;  5AV6 B;  1P3K C;  5CPI C;  5CPK D;  3AYW D;  3KXB D;  4WU8 D;  5GXQ B;  3W96 A;  3X1T A;  2F8N B;  1JFI B;  3MGP B;  3X1V B;  4KGC A;  5AV5 B;  3AZI A;  4ZBJ B;  2NZD A;  5B32 C;  1HQ3 B;  4WU9 B;  1KX5 D;  1ID3 D;  2Y2L A;  1B6W A;  5GT3 C;  3KUY D;  3AZH B;  1M1A C;  3LZ1 A;  4H9S A;  2PYO D;  3AZL C;  3UTB C;  1N1J B;  5B1L B;  2Y2M A;  1F66 B;  1P3B C;  3P5J B;  5AV9 B;  4J8V C;  5CPI A;  4X23 D;  5C3I B;  5DNM B;  2HIO B;  3W98 C;  1U35 D;  3AZJ A;  4H9P B;  3REJ B;  5B32 A;  5E5A A;  3R45 B;  5GT0 A;  5B2J C;  4J8U D;  1M18 D;  3MNN A;  2ZY2 A;  2NQB C;  4XZQ B;  3LZ0 B;  3AZL A;  3AN2 B;  5B1M C;  2DF4 C;  3KSY A;  4KHA A;  3MGS A;  4J8V A;  4JJN B;  1P3F D;  3WAA D;  2DQN C;  3MGQ C;  3B6G D;  2IO5 B;  3EPJ A;  2Y2K A;  2ARO A;  5AY8 C;  1P3A C;  1P3O C;  1BH9 A;  1P3I D;  3W97 A;  5GSU D;  4QLC C;  5B2I B;  3WKJ B;  3REH D;  3AZF C;  4H9R A;  4UPK A;  4ZUX B;  2ZM5 A;  4LD9 D;  3AV1 D;  4J8W C;  2HUE B;  3UT9 B;  4CSR A;  5CPJ C;  5B0Z B;  5GXQ A;  2ZY3 A;  1ZLA B;  3B6F C;  3W99 C;  3AYW C;  1P3A A;  4WU8 C;  1P3O A;  1P3P B;  4WZS B;  4HGA C;  5BNV A;  4E44 A;  5AVC D;  3WA9 D;  1KX3 B;  3LEL B;  3AZF A;  1F1E A;  3AZH A;  2JCH A;  3IP4 C;  1KX5 C;  5B1L A;  1ID3 C;  4J8W A;  1R4V A;  2LY8 A;  3W96 B;  5AV9 A;  4JJN C;  5CPJ A;  5DNM A;  2HIO A;  1HTA A;  5B40 D;  5BS7 C;  3AZM D;  1WWS A;  3B6F A;  3W99 A;  3AZE D;  4KUD D;  3AFA C;  3REJ A;  4X23 C;  5B31 C;  4Z5T C;  3R45 A;  3H0L C;  3LJA D;  5B33 B;  3B0D C;  3C1B B;  1S32 C;  3KWQ D;  3UTA D;  3LZ0 A;  3AZG D;  2Y2H A;  5CPI B;  1P3K B;  1KX5 A;  4G92 C;  4J8U C;  2F8N K;  4JJN A;  2FJ7 D;  3AV2 D;  1P3L D;  3AFA A;  5B32 B;  4X23 A;  3VH5 W;  1P3F C;  5B31 A;  4Z5T A;  4H9Q A;  5GT3 B;  4XUJ C;  5AVB D;  5G49 B;  1M1A B;  4NFT A;  5B2I A;  1S32 A;  3AZL B;  3UTB B;  3C1C C;  1P3B B;  4KHA B;  4ZUX A;  4J8U A;  3W98 B;  3X1S B;  3REH C;  5JRG D;  4YS3 D;  4J8X D;  3UT9 A;  3AZN C;  2JSS A;  5DNN D;  5B32 G;  3AV1 C;  3O62 D;  3REI C;  4LD9 C;  1BH9 B;  1P3F A;  5AV8 D;  5B2J B;  4XUJ A;  1P3P A;  2NQB B;  1Z2C B;  2BYK A;  1TZY C;  4H9R B;  1KX3 A;  5B1M B;  3LEL A;  2ZY5 A;  5B24 D;  3C1C A;  4WJ3 C;  2F8N D;  4CSR B;  3MGQ B;  4NE5 A;  3MGP D;  1P3G C;  5AV5 D;  3AZN A;  5AY8 B;  1P3A B;  1HQ3 D;  2Y2P A;  3REI A;  1P3O B;  2F2A C;  5B0Y D;  5BNV B;  4QLC B;  3X1U B;  5B40 C;  3AZF B;  4AWL C;  1F66 D;  3KFU G;  1H3O B;  3AZE C;  1TZY A;  4KUD C;  5B33 A;  3VH5 T;  3C1B A;  2CV5 D;  4J8W B;  1P3K A;  5CPJ B;  2W8S A;  3LJA C;  4WV4 B;  3X1S C;  1P3G A;  2F8N G;  3B6F B;  3W99 B;  3UTA C;  3AZG C;  5CPK B;  3AYW B;  4WU8 B;  3AZK D;  2BG1 A;  5BT1 D;  4HGA B;  3WTP D;  1TAF B;  5GT3 A;  1P3L C;  4Z66 C;  3AN2 D;  5G49 A;  1M1A A;  5CP6 D;  4KUD A;  3F6T A;  3H0M C;  3UTB A;  1KX5 B;  1ID3 B;  1AOI D;  3EPH A;  4YM6 D;  4Z2M H;  1P3B A;  5AVB C;  2UWX A;  1M19 D;  3W98 A;  3X1S A;  3A6N C;  3AFA B;  4X23 B;  5B31 B;  4Z5T B;  4H9Q B;  1U35 B;  3WKJ D;  5B2J A;  5JRG C;  4YS3 C;  4J8X C;  1S32 B;  3B0D B;  3X1U C;  4Z66 A;  2NQB A;  5DNN C;  3O62 C;  3MGR D;  5B1M A;  5AV8 C;  4J8U B;  4G92 B;  5B0Z D;  2BYM A;  3VH5 A;  3REK D;  4NE6 A;  1P34 D;  3MGQ A;  1P3M C;  3A6N A;  1EQZ C;  5B24 C;  5B31 G;  4EO5 C;  5AY8 A;  5CPK C;  1P3F B;  3WAA B;  3KXB C;  4XUJ B;  5FUG B;  4QLC A;  2BYK B;  3B0B A;  3X1U A;  3C1C B;  2Y2Q A;  1H3O A;  3REL D;  5AV8 A;  3X1T D;  5B0Y C;  4KGC D;  3KUY C;  3REH B;  3AZI D;  4UUZ A;  3WTP E;  3MVD D;  1P3M A;  3AZN B;  2NZD D;  1EQZ A;  2PYO C;  5F99 D;  5JA4 A;  3AV1 B;  2CV5 C;  3REI B;  4R8P D;  4LD9 B;  4E45 A;  5CPK A;  3AYW A;  3KXB A;  4WU8 A;  3LZ1 D;  1U35 C;  1TAF A;  1TZY B;  5CPI D;  3B0C W;  3AZK C;  2Y2J A;  5BT1 C;  5B0Y A;  1ID3 A;  3WTP C;  5AVC B;  3AZJ D;  1P3G B;  1M18 C;  3KUY A;  3V9R B;  5CP6 C;  5BS7 A;  5B32 D;  2PYO A;  5E5A D;  3EG5 B;  2YFV B;  1AOI C;  5GT0 D;  4YM6 C;  2CWE A;  3MNN D;  1M19 C;  3WAA C;  5B40 B;  3B6G C;  1U35 A;  4AWL B;  3EPK A;  3AZE B;  4KUD B;  4J8V D;  3MGS D;  2RVQ D;  2YFW B;  1P3I C;  1BFM A;  5GSU C;  3LJA B;  1M18 A;  2ARO D;  3UTA B;  3MGR C;  3TU4 D;  3AZG B;  4M6B A;  3W97 D;  3REK C;  1KX4 D;  1P34 C;  3WAA A;  3B6G A;  1P3L B;  2XD5 A;  4Z66 B;  5FUG A;  1BH8 A;  5AV6 D;  2BYM B;  5GXQ D;  5AVB B;  1P3I A;  3A1I A;  5GSU A;  5AVC C;  3WA9 C;  3X1V D;  3A6N B;  3B0C T;  3REH A;  3REL C;  1KU5 A;  3X1T C;  4LD9 A;  5BNX B;  4WU9 D;  3AV1 A;  4KGC C;  3AZI C;  3AZF D;  5JRG B;  4YS3 B;  4G91 C;  3MVD C;  4J8X B;  3AZH D;  2NZD C;  3AZM C;  5DNN B;  5F99 C;  5B1L D;  3O62 B;  4J8W D;  4R8P C;  5AV9 D;  2JE5 A;  1A7W A;  5AV8 B;  5CPJ D;  5DNM D;  3LZ1 C;  2HIO D;  4H9S C;  4UUZ B;  5AVC A;  1P3M B;  3WA9 A;  3REJ D;  1EQZ B;  5B24 B;  5JA4 B;  3KWQ C;  3REL A;  4EO5 B;  3NQU A;  2YFV A;  3KXB B;  3AZJ C;  2FJ7 C;  3MVD A;  3AV2 C;  5B40 A;  4XZQ D;  2Y2O A;  3LZ0 D;  3AZM A;  5E5A C;  5F99 A;  5GT0 C;  4R8P A;  3AZE A;  5KDM B;  3MNN C;  4JJN D;  5B0Y B;  4H9O B;  3V9R A;  2YFW A;  5BO0 A;  3KUY B;  3LJA A;  3MGS C;  3AFA D;  2PYO B;  2CV5 B;  2RVQ C;  4DRB A;  4Z5T D;  5B31 D;  3KWQ A;  1ULY A;  2Y2G A;  3UTA A;  4CAY A;  3AZG A;  5B2I D;  1S32 D;  5CHL B;  2ARO C;  2FJ7 A;  3AV2 A;  3TU4 C;  1P3L A;  3VH6 W;  4ZUX D;  3AZK B;  3NQJ A;  3W97 C;  1KX4 C;  3WTP B;  3UT9 D;  1T3U A;  1M18 B;  5AVB A;  4H9N B;  5CP6 B;  1ZLA D;  5AV6 C;  1AOI B;  4YM6 B;  4XUJ D;  5GXQ C;  1P3P D;  4WNN B;  1M19 B;  1WWI A;  5BNX A;  3MGP C;  3B6G B;  3X1V C;  1KX3 D;  5AV5 C;  3LEL D;  3C1C D;  5JRG A;  4YS3 A;  4J8X A;  2VQR A;  4ZBJ C;  3TU4 A;  1BH8 B;  4DRA A;  2XD1 A;  5DNN A;  1HQ3 C;  4WU9 C;  3O62 A;  1P3I B;  1KX4 A;  3W96 D;  2L5A A;  5GSU B;  3AZH C;  2FFF B;  3AZN D;  5B1L C;  3REI D;  1F66 C;  3MGR B;  5AV6 A;  3FDD A;  3H0R C;  5AV9 C;  5B24 A;  5C3I C;  5DNM C;  3REK B;  2HIO C;  2RIQ A;  3EPL A;  1P34 B;  1JFI A;  2F8N A;  3MGP A;  3X1V A;  1TZY D;  5B33 D;  5AV5 A;  3C1B D;  3REJ C;  2G5I C;  1W2E A;  4Z2M G;  1P3K D;  1HQ3 A;  4WU9 A;  1P3G D;  5KDM A;  4H9O A;  3WA9 B;  4XZQ C;  3VH6 T;  3LZ0 C;  1N1J A;  3AN2 C;  1F66 A;  3REL B;  4DQY B;  3NQU B;  1PZR A;  3X1T B;  2CV5 A;  4KGC B;  5GT3 D;  2IO5 C;  3AZI B;  4G91 B;  3MVD B;  1M1A D;  4H9P A;  2NZD B;  3AZM B;  3AZL D;  5F99 B;  3UTB D;  4R8P B;  1P3B D;  3W98 D;  3AZK A;  3LZ1 B;  5B2I C; 
#chains in the Genus database with same CATH homology
 3X1S D;  5BO0 B;  3WKJ C;  4NE3 A;  3WTP A;  4XZQ A;  3AN2 A;  4ZUX C;  3KWQ B;  4H9N A;  5CP6 A;  4CAY B;  2HUE C;  1AOI A;  5B2J D;  4YM6 A;  3UT9 C;  3AZJ B;  5B0Z C;  3AL0 C;  4Z66 D;  2FJ7 B;  4WNN A;  2NQB D;  3A1K A;  1M19 A;  3AV2 B;  2F8N H;  1ZLA C;  5E5A B;  2Y2N A;  5B1M D;  5GT0 B;  3NQJ B;  3MNN B;  1P3P C;  3MGQ D;  2J8P A;  1KX3 C;  3WKJ A;  3A6N D;  3LEL C;  4J8V B;  2G5H C;  3MGS B;  5AY8 D;  1P3A D;  3VH6 A;  1Q9C A;  3MGR A;  1P3O D;  3W96 C;  4QLC D;  5B0Z A;  3REK A;  3X1U D;  2ARO B;  2Y2I A;  1P34 A;  1ZLA A;  3TU4 B;  3W97 B;  1KX4 B;  2ZY4 A;  1P3M D;  3C1B C;  5B33 C;  1EQZ D;  1B67 A;  3B6F D;  3W99 D;  5AV6 B;  1P3K C;  5CPI C;  5CPK D;  3AYW D;  3KXB D;  4WU8 D;  5GXQ B;  3W96 A;  3X1T A;  2F8N B;  1JFI B;  3MGP B;  3X1V B;  4KGC A;  5AV5 B;  3AZI A;  4ZBJ B;  2NZD A;  5B32 C;  1HQ3 B;  4WU9 B;  1KX5 D;  1ID3 D;  2Y2L A;  1B6W A;  5GT3 C;  3KUY D;  3AZH B;  1M1A C;  3LZ1 A;  4H9S A;  2PYO D;  3AZL C;  3UTB C;  1N1J B;  5B1L B;  2Y2M A;  1F66 B;  1P3B C;  3P5J B;  5AV9 B;  4J8V C;  5CPI A;  4X23 D;  5C3I B;  5DNM B;  2HIO B;  3W98 C;  1U35 D;  3AZJ A;  4H9P B;  3REJ B;  5B32 A;  5E5A A;  3R45 B;  5GT0 A;  5B2J C;  4J8U D;  1M18 D;  3MNN A;  2ZY2 A;  2NQB C;  4XZQ B;  3LZ0 B;  3AZL A;  3AN2 B;  5B1M C;  2DF4 C;  3KSY A;  4KHA A;  3MGS A;  4J8V A;  4JJN B;  1P3F D;  3WAA D;  2DQN C;  3MGQ C;  3B6G D;  2IO5 B;  3EPJ A;  2Y2K A;  2ARO A;  5AY8 C;  1P3A C;  1P3O C;  1BH9 A;  1P3I D;  3W97 A;  5GSU D;  4QLC C;  5B2I B;  3WKJ B;  3REH D;  3AZF C;  4H9R A;  4UPK A;  4ZUX B;  2ZM5 A;  4LD9 D;  3AV1 D;  4J8W C;  2HUE B;  3UT9 B;  4CSR A;  5CPJ C;  5B0Z B;  5GXQ A;  2ZY3 A;  1ZLA B;  3B6F C;  3W99 C;  3AYW C;  1P3A A;  4WU8 C;  1P3O A;  1P3P B;  4WZS B;  4HGA C;  5BNV A;  4E44 A;  5AVC D;  3WA9 D;  1KX3 B;  3LEL B;  3AZF A;  1F1E A;  3AZH A;  2JCH A;  3IP4 C;  1KX5 C;  5B1L A;  1ID3 C;  4J8W A;  1R4V A;  2LY8 A;  3W96 B;  5AV9 A;  4JJN C;  5CPJ A;  5DNM A;  2HIO A;  1HTA A;  5B40 D;  5BS7 C;  3AZM D;  1WWS A;  3B6F A;  3W99 A;  3AZE D;  4KUD D;  3AFA C;  3REJ A;  4X23 C;  5B31 C;  4Z5T C;  3R45 A;  3H0L C;  3LJA D;  5B33 B;  3B0D C;  3C1B B;  1S32 C;  3KWQ D;  3UTA D;  3LZ0 A;  3AZG D;  2Y2H A;  5CPI B;  1P3K B;  1KX5 A;  4G92 C;  4J8U C;  2F8N K;  4JJN A;  2FJ7 D;  3AV2 D;  1P3L D;  3AFA A;  5B32 B;  4X23 A;  3VH5 W;  1P3F C;  5B31 A;  4Z5T A;  4H9Q A;  5GT3 B;  4XUJ C;  5AVB D;  5G49 B;  1M1A B;  4NFT A;  5B2I A;  1S32 A;  3AZL B;  3UTB B;  3C1C C;  1P3B B;  4KHA B;  4ZUX A;  4J8U A;  3W98 B;  3X1S B;  3REH C;  5JRG D;  4YS3 D;  4J8X D;  3UT9 A;  3AZN C;  2JSS A;  5DNN D;  5B32 G;  3AV1 C;  3O62 D;  3REI C;  4LD9 C;  1BH9 B;  1P3F A;  5AV8 D;  5B2J B;  4XUJ A;  1P3P A;  2NQB B;  1Z2C B;  2BYK A;  1TZY C;  4H9R B;  1KX3 A;  5B1M B;  3LEL A;  2ZY5 A;  5B24 D;  3C1C A;  4WJ3 C;  2F8N D;  4CSR B;  3MGQ B;  4NE5 A;  3MGP D;  1P3G C;  5AV5 D;  3AZN A;  5AY8 B;  1P3A B;  1HQ3 D;  2Y2P A;  3REI A;  1P3O B;  2F2A C;  5B0Y D;  5BNV B;  4QLC B;  3X1U B;  5B40 C;  3AZF B;  4AWL C;  1F66 D;  3KFU G;  1H3O B;  3AZE C;  1TZY A;  4KUD C;  5B33 A;  3VH5 T;  3C1B A;  2CV5 D;  4J8W B;  1P3K A;  5CPJ B;  2W8S A;  3LJA C;  4WV4 B;  3X1S C;  1P3G A;  2F8N G;  3B6F B;  3W99 B;  3UTA C;  3AZG C;  5CPK B;  3AYW B;  4WU8 B;  3AZK D;  2BG1 A;  5BT1 D;  4HGA B;  3WTP D;  1TAF B;  5GT3 A;  1P3L C;  4Z66 C;  3AN2 D;  5G49 A;  1M1A A;  5CP6 D;  4KUD A;  3F6T A;  3H0M C;  3UTB A;  1KX5 B;  1ID3 B;  1AOI D;  3EPH A;  4YM6 D;  4Z2M H;  1P3B A;  5AVB C;  2UWX A;  1M19 D;  3W98 A;  3X1S A;  3A6N C;  3AFA B;  4X23 B;  5B31 B;  4Z5T B;  4H9Q B;  1U35 B;  3WKJ D;  5B2J A;  5JRG C;  4YS3 C;  4J8X C;  1S32 B;  3B0D B;  3X1U C;  4Z66 A;  2NQB A;  5DNN C;  3O62 C;  3MGR D;  5B1M A;  5AV8 C;  4J8U B;  4G92 B;  5B0Z D;  2BYM A;  3VH5 A;  3REK D;  4NE6 A;  1P34 D;  3MGQ A;  1P3M C;  3A6N A;  1EQZ C;  5B24 C;  5B31 G;  4EO5 C;  5AY8 A;  5CPK C;  1P3F B;  3WAA B;  3KXB C;  4XUJ B;  5FUG B;  4QLC A;  2BYK B;  3B0B A;  3X1U A;  3C1C B;  2Y2Q A;  1H3O A;  3REL D;  5AV8 A;  3X1T D;  5B0Y C;  4KGC D;  3KUY C;  3REH B;  3AZI D;  4UUZ A;  3WTP E;  3MVD D;  1P3M A;  3AZN B;  2NZD D;  1EQZ A;  2PYO C;  5F99 D;  5JA4 A;  3AV1 B;  2CV5 C;  3REI B;  4R8P D;  4LD9 B;  4E45 A;  5CPK A;  3AYW A;  3KXB A;  4WU8 A;  3LZ1 D;  1U35 C;  1TAF A;  1TZY B;  5CPI D;  3B0C W;  3AZK C;  2Y2J A;  5BT1 C;  5B0Y A;  1ID3 A;  3WTP C;  5AVC B;  3AZJ D;  1P3G B;  1M18 C;  3KUY A;  3V9R B;  5CP6 C;  5BS7 A;  5B32 D;  2PYO A;  5E5A D;  3EG5 B;  2YFV B;  1AOI C;  5GT0 D;  4YM6 C;  2CWE A;  3MNN D;  1M19 C;  3WAA C;  5B40 B;  3B6G C;  1U35 A;  4AWL B;  3EPK A;  3AZE B;  4KUD B;  4J8V D;  3MGS D;  2RVQ D;  2YFW B;  1P3I C;  1BFM A;  5GSU C;  3LJA B;  1M18 A;  2ARO D;  3UTA B;  3MGR C;  3TU4 D;  3AZG B;  4M6B A;  3W97 D;  3REK C;  1KX4 D;  1P34 C;  3WAA A;  3B6G A;  1P3L B;  2XD5 A;  4Z66 B;  5FUG A;  1BH8 A;  5AV6 D;  2BYM B;  5GXQ D;  5AVB B;  1P3I A;  3A1I A;  5GSU A;  5AVC C;  3WA9 C;  3X1V D;  3A6N B;  3B0C T;  3REH A;  3REL C;  1KU5 A;  3X1T C;  4LD9 A;  5BNX B;  4WU9 D;  3AV1 A;  4KGC C;  3AZI C;  3AZF D;  5JRG B;  4YS3 B;  4G91 C;  3MVD C;  4J8X B;  3AZH D;  2NZD C;  3AZM C;  5DNN B;  5F99 C;  5B1L D;  3O62 B;  4J8W D;  4R8P C;  5AV9 D;  2JE5 A;  1A7W A;  5AV8 B;  5CPJ D;  5DNM D;  3LZ1 C;  2HIO D;  4H9S C;  4UUZ B;  5AVC A;  1P3M B;  3WA9 A;  3REJ D;  1EQZ B;  5B24 B;  5JA4 B;  3KWQ C;  3REL A;  4EO5 B;  3NQU A;  2YFV A;  3KXB B;  3AZJ C;  2FJ7 C;  3MVD A;  3AV2 C;  5B40 A;  4XZQ D;  2Y2O A;  3LZ0 D;  3AZM A;  5E5A C;  5F99 A;  5GT0 C;  4R8P A;  3AZE A;  5KDM B;  3MNN C;  4JJN D;  5B0Y B;  4H9O B;  3V9R A;  2YFW A;  5BO0 A;  3KUY B;  3LJA A;  3MGS C;  3AFA D;  2PYO B;  2CV5 B;  2RVQ C;  4DRB A;  4Z5T D;  5B31 D;  3KWQ A;  1ULY A;  2Y2G A;  3UTA A;  4CAY A;  3AZG A;  5B2I D;  1S32 D;  5CHL B;  2ARO C;  2FJ7 A;  3AV2 A;  3TU4 C;  1P3L A;  3VH6 W;  4ZUX D;  3AZK B;  3NQJ A;  3W97 C;  1KX4 C;  3WTP B;  3UT9 D;  1T3U A;  1M18 B;  5AVB A;  4H9N B;  5CP6 B;  1ZLA D;  5AV6 C;  1AOI B;  4YM6 B;  4XUJ D;  5GXQ C;  1P3P D;  4WNN B;  1M19 B;  1WWI A;  5BNX A;  3MGP C;  3B6G B;  3X1V C;  1KX3 D;  5AV5 C;  3LEL D;  3C1C D;  5JRG A;  4YS3 A;  4J8X A;  2VQR A;  4ZBJ C;  3TU4 A;  1BH8 B;  4DRA A;  2XD1 A;  5DNN A;  1HQ3 C;  4WU9 C;  3O62 A;  1P3I B;  1KX4 A;  3W96 D;  2L5A A;  5GSU B;  3AZH C;  2FFF B;  3AZN D;  5B1L C;  3REI D;  1F66 C;  3MGR B;  5AV6 A;  3FDD A;  3H0R C;  5AV9 C;  5B24 A;  5C3I C;  5DNM C;  3REK B;  2HIO C;  2RIQ A;  3EPL A;  1P34 B;  1JFI A;  2F8N A;  3MGP A;  3X1V A;  1TZY D;  5B33 D;  5AV5 A;  3C1B D;  3REJ C;  2G5I C;  1W2E A;  4Z2M G;  1P3K D;  1HQ3 A;  4WU9 A;  1P3G D;  5KDM A;  4H9O A;  3WA9 B;  4XZQ C;  3VH6 T;  3LZ0 C;  1N1J A;  3AN2 C;  1F66 A;  3REL B;  4DQY B;  3NQU B;  1PZR A;  3X1T B;  2CV5 A;  4KGC B;  5GT3 D;  2IO5 C;  3AZI B;  4G91 B;  3MVD B;  1M1A D;  4H9P A;  2NZD B;  3AZM B;  3AZL D;  5F99 B;  3UTB D;  4R8P B;  1P3B D;  3W98 D;  3AZK A;  3LZ1 B;  5B2I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...