5B40B

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITCPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40B00
3AN2A 5GSUA 2NZDA 4R8PA 3MVDA 3MGSD 3W96A 3W97C 3W99D 3NQUB 4J8XC 3AZND 1HQ3B 5AV6A 3O62B 1P34D 3LJAD 3WKJB 3KXBC 1P3KD 3KWQD 3MGRC 3TU4A 3WA9B 4KHAA 5CPJD 3REHC 5B40C 3B0CT 1KX4D 2F8NK 4KUDA 3AZHC 4CAYA 4G92C 2HIOD 5AV5C 4ZUXA 3A6NC 3UTBA 1S32B 3MVDC 5B0YC 4G91B 1P3OD 1TAFB 1JFIA 2F8NG 3AZFD 4JJND 3MGQB 3X1VC 4Z66B 5GT3D 1WWIA 3AYWC 3LELD 5DNMD 4YS3D 3B6GD 3X1TD 1BH9A 1P3GB 4J8UD 5B24D 3C1CA 4YM6D 3C1BC 1P3FD 1KX3B 5AV8A 4Z5TB 2PYOC 5AV9C 5B2ID 1P3PB 4E45A 1EQZA 5B1LD 3AZMA 1ZLAA 5JA4A 3NQJB 5G49A 5B32A 5CP6A 3AZEB 4J8VB 4WU9A 4XZQD 3VH6A 3AZJD 1P3IC 1P3LC 5B1MA 2NQBC 1F66D 5B33A 1P3AD 1ID3D 1M19D 5B31B 4J8XB 3VH5A 3RELC 3KXBB 4WU8D 3WAAD 3WTPD 4XUJC 2CWEA 4NE6A 3REHB 3AZKC 3AV1C 5CPKA 1U35D 5CP6C 1P3BB 3MGPA 4G92B 1P3KA 5B1MC 2AROA 1H3OB 3AZGC 1P3MD 5B33C 5B0YB 2F8NA 3AN2D 5GSUD 1KX4A 4R8PD 2YFWB 3W96D 5E5AD 5B0ZC 1M1AA 3R45B 3X1VB 4J8WA 2FJ7A 3AYWB 5GXQA 5AV6D 2RVQD 3MGSC 5BT1D 5FUGB 3AZFA 3TU4D 3W99C 3AZNC 5GT3A 3C1BB 3LJAC 3UTAD 1P34C 5B31G 4KUDD 3NQUA 2PYOB 5AV9B 4Z2MG 3KWQC 3AV2B 1P3KC 3X1UB 5CPJC 3UTBD 4ZUXD 1KX4C 3KUYA 5B24A 4YM6A 3AZLB 4KGCA 1P3IB 5AY8A 1P3LB 2HIOC 2NQBB 1P3OC 5B1LA 5DNND 4AWLC 4JJNC 3RELB 5GT3C 5B2JD 4H9QB 2YFVA 1B6WA 3LELC 1ULYA 5AV8D 5DNMC 1F1EA 4XUJB 4YS3C 1ID3A 3B6GC 5F99A 3X1TC 3B0DC 5AVBA 5AVCD 3AV1B 4J8UC 5B24C 1EQZD 1P3FC 1ZLAD 3WAAA 5B32D 4H9NB 5B2IC 3AZGB 4DRAA 4WU9D 2CV5A 1P3MA 3LZ1A 3AFAC 5B1LC 3REKA 1U35A 5B0ZB 1AOID 4XZQC 5KDMA 3AZJC 5BNVA 3MGSB 1F66C 1P3AC 1TZYD 4HGAC 1M19C 5E5AA 3W99B 3AZNB 2BYKB 1P34B 3LJAB 4WU8C 5CPKD 3WAAC 3UT9A 4H9OA 3KWQB 3WTPE 3WTPC 3MGPD 3X1SD 2AROD 1M18A 4QLCB 2F8ND 3UTAA 1M1AD 4J8WD 2FJ7D 4LD9D 5JRGA 5BS7C 1P3MC 5GXQD 4X23C 3AN2C 1P3OB 5GSUC 2NZDC 4AWLB 4R8PC 2IO5C 3W96C 4H9PB 4JJNB 1KX5B 4H9RB 5AV6C 5CPIB 2RVQC 5BT1C 5DNMB 4YS3B 3B6GB 5DNNA 3TU4C 3X1TB 3B0DB 4J8UB 3B0BA 5B2JA 1P3FB 4UUZB 3UTAC 3WA9D 3KUYD 4KUDC 5GT0A 5B2IB 4KGCD 5BO0B 5AY8D 3UTBC 4ZUXC 3AFAB 5AVCA 1BH8A 3REJA 3W98A 3VH6T 4XZQB 2LY8A 3V9RA 3AZJB 3LZ0A 3B6FA 1F66B 1P3AB 4HGAB 1M19B 1AOIA 3VH5T 3MNNA 3W97B 1N1JA 5F99D 5AVBD 4WU8B 3C1CC 5AV8C 3WTPB 1TZYA 3MGRB 1KX3D 4Z5TD 2CV5D 5B40B 3LZ1D 1EQZC 3REKD 3AZMC 1ZLAC 5B32C 3AZHB 1P3MB 4WU9C 5AV5B 4X23B 3A6NB 3AZIA 3X1SA 5GSUB 3REIA 3AN2B 3AZED 4R8PB 3MVDB 2IO5B 3W96B 2NZDB 5BNXA 1AOIC 4M6BA 1HTAA 4CSRA 5AV6B 4LD9A 4NE5A 5B31D 3UT9D 4KHAB 2BYMA 2L5AA 1B67A 1M18D 5CPKC 3REHD 4CAYB 3MGPC 1HQ3A 3O62A 4ZUXB 3UTBB 3WKJA 2AROC 5JRGD 1P3BD 1JFIB 3WA9A 1M1AC 4J8WC 2FJ7C 5GXQC 3AYWD 3AZFC 1S32A 1BH9B 1TAFA 3C1CB 5AV8B 4ZBJC 5GT0D 3MGQA 4Z66A 3AZKB 3AV2D 3REJD 1EQZB 3AZMB 1ZLAB 5JA4B 5G49B 3KUYC 3W98D 3X1UD 4YM6C 5CP6B 1P3GA 4WU9B 4KGCC 3B6FD 5AY8C 2JSSA 3LZ0D 5B1MB 3AZLD 1KX3A 4Z5TA 5B33B 4NE3A 2F8NH 1P3PA 3MNND 3NQJA 3AZEA 4J8VA 1ID3C 5F99C 5AVBC 5CPKB 4XUJD 1WWSA 5B31A 3MGPB 3AV1D 4J8XA 1P3KB 1Q9CA 2AROB 2HUEC 3KXBA 1KX3C 5CPJB 2CV5C 3AZID 2F8NB 3REID 3LZ1C 3MGRA 1KX4B 3REKC 1U35C 3REHA 1M1AB 4J8WB 2FJ7B 2HIOB 5GXQB 1P3BA 3AZEC 1KU5A 3A6NA 3AZFB 1H3OA 5E5AC 5B0YA 5GT3B 2YFWA 5B31C 4ZBJB 3LELB 3UT9C 3R45A 3X1VA 4WNNB 3AYWA 1HQ3D 3O62D 3WKJD 1M18C 5CHLB 3KUYB 4WV4B 5FUGA 5B24B 4YM6B 4KGCB 4QLCD 5AY8B 3C1BA 5JRGC 1P3BC 2PYOA 5AV9A 3AV2A 5B1LB 3X1UA 1S32D 2YFVB 3AZLA 1KX5D 1P3IA 1P3LA 3MGQD 1ID3B 5DNNC 5F99B 4Z66D 5CPID 5AVBB 2NQBA 5B2JC 3WAAB 4Z2MH 5GT0C 3RELA 2HUEB 1P3GD 4H9QA 5C3IC 2CV5B 3LZ1B 3AV2C 5AVCC 3B0CW 3REJC 3REKB 1R4VA 4XUJA 3X1UC 1U35B 3W98C 1P3PD 3AFAD 3AZKA 3AV1A 3B6FC 5KDMB 3LZ0C 5BNVB 3AZLC 4NFTA 4H9NA 4J8VD 3AZGA 5E5AB 3MNNC 4EO5C 5B0ZA 4H9OB 3UT9B 3W97D 4J8XD 1TZYC 3TU4B 3MGSA 3KXBD 1M18B 3MGRD 3UTAB 3W99A 4KUDB 5B40D 3AZNA 2BYKA 1P34A 3LJAA 5JRGB 3AZIC 3AZHD 3KWQA 3X1SC 3REIC 5CPJA 5AV5D 3VH6W 4X23D 3A6ND 4DRBA 2NZDD 3MVDD 4QLCA 5B0YD 4H9SA 4LD9C 2HIOA 5DNNB 3X1VD 3VH5W 1P3OA 3KSYA 5B2JB 4H9PA 4JJNA 5GT0B 1KX5A 4H9RA 5C3IB 1HQ3C 3O62C 3LELA 3C1BD 5CPIA 5AVCB 1BH8B 3REJB 3WKJC 5DNMA 2PYOD 4WNNA 5AV9D 4YS3A 3B6GA 3W98B 3X1TA 3WA9C 5B32B 4J8UA 3V9RB 4QLCC 3B6FB 3LZ0B 4H9SC 1P3FA 4UUZA 5B2IA 4E44A 5BO0A 1P3ID 1P3LD 3MNNB 1AOIB 1N1JB 1S32C 3AFAA 2NQBD 4EO5B 4G91C 1BFMA 1KX5C 4XZQA 3AZJA 3MGQC 1TZYB 3C1CD 4Z66C 3RELD 5CPIC 1F66A 1P3AA 1M19A 3W97A 3AZKD 3AZMD 4WU8A 1P3GC 3AZIB 3X1SB 5CP6D 3REIB 4Z5TC 3WTPA 5BNXB 5B1MD 1A7WA 3AZGD 1P3PC 5B33D 5B40A 4CSRB 4LD9B 5B0ZD 3AZHA 5B32G 4WZSB 4J8VC 5BS7A 2BYMB 5AV5A 4X23A
chains in the Genus database with same CATH superfamily
3AN2A 5GSUA 2NZDA 4R8PA 3MVDA 3MGSD 3W96A 3W97C 3W99D 3NQUB 4J8XC 3AZND 1HQ3B 5AV6A 2Y2KA 3O62B 3LJAD 1W2EA 1P34D 3KXBC 3WKJB 1P3KD 3KWQD 3MGRC 3TU4A 3WA9B 3EG5B 4KHAA 5CPJD 3REHC 5B40C 3B0CT 1KX4D 2F8NK 4KUDA 3AZHC 2XD1A 4CAYA 4G92C 2HIOD 5AV5C 4ZUXA 3A6NC 3UTBA 1S32B 3MVDC 5B0YC 4G91B 1P3OD 1TAFB 1JFIA 2F8NG 3AZFD 4JJND 3MGQB 3X1VC 4Z66B 5GT3D 1WWIA 3AYWC 3LELD 5DNMD 4YS3D 3B6GD 3X1TD 1BH9A 1P3GB 4J8UD 5B24D 3C1CA 4YM6D 3C1BC 1P3FD 1KX3B 5AV8A 4Z5TB 2PYOC 5AV9C 5B2ID 1P3PB 4E45A 1EQZA 5B1LD 3AZMA 1ZLAA 5JA4A 3NQJB 5G49A 5B32A 5CP6A 3AZEB 4J8VB 4WU9A 4XZQD 3VH6A 3AZJD 1P3IC 2Y2MA 5B1MA 1P3LC 2NQBC 1F66D 5B33A 1P3AD 1ID3D 1M19D 2Y2JA 5B31B 4WJ3C 4J8XB 3VH5A 3RELC 2Y2OA 3KXBB 4WU8D 3WAAD 1T3UA 3WTPD 4XUJC 2CWEA 4NE6A 3REHB 3AZKC 3AV1C 5CPKA 1U35D 5CP6C 1P3BB 3MGPA 4G92B 1P3KA 2JCHA 5B1MC 2AROA 1H3OB 3H0LC 3AZGC 1P3MD 5B33C 5B0YB 2F8NA 3AN2D 5GSUD 1KX4A 4R8PD 2YFWB 3W96D 5E5AD 5B0ZC 1M1AA 3R45B 3X1VB 4J8WA 2FJ7A 3AYWB 5GXQA 5AV6D 2RVQD 3MGSC 5BT1D 5FUGB 3AZFA 3TU4D 3W99C 3AZNC 1PZRA 5GT3A 3LJAC 3C1BB 3UTAD 1P34C 5B31G 4KUDD 3NQUA 2PYOB 5AV9B 4Z2MG 3KWQC 3AV2B 1P3KC 3X1UB 5CPJC 3UTBD 4ZUXD 2W8SA 3EPJA 1KX4C 2ZM5A 3KUYA 5B24A 4YM6A 3AZLB 2Y2HA 4KGCA 1P3IB 5AY8A 1P3LB 2HIOC 2NQBB 1P3OC 5B1LA 5DNND 4AWLC 4JJNC 3RELB 5GT3C 5B2JD 4H9QB 2YFVA 1B6WA 3LELC 1ULYA 5AV8D 5DNMC 1F1EA 4XUJB 4YS3C 1ID3A 3B6GC 5F99A 3X1TC 2ZY3A 3B0DC 3H0RC 5AVBA 5AVCD 4J8UC 3AV1B 5B24C 1EQZD 1P3FC 1ZLAD 3WAAA 5B32D 4H9NB 5B2IC 3AZGB 4DRAA 4WU9D 2CV5A 2Y2IA 1P3MA 3LZ1A 3AFAC 5B1LC 3REKA 1U35A 5B0ZB 1AOID 4XZQC 5KDMA 3AZJC 2ZY5A 5BNVA 3MGSB 4DQYB 1F66C 1P3AC 1TZYD 4HGAC 1M19C 5E5AA 3W99B 3AZNB 2BYKB 1P34B 3LJAB 4WU8C 5CPKD 3WAAC 3UT9A 4H9OA 3KWQB 3WTPE 2RIQA 3WTPC 3MGPD 3X1SD 2AROD 1M18A 4QLCB 2F8ND 3UTAA 2XD5A 1M1AD 4J8WD 2FJ7D 4LD9D 5JRGA 5BS7C 1P3MC 5GXQD 4X23C 3F6TA 3AN2C 5GSUC 1P3OB 2NZDC 4AWLB 4R8PC 2IO5C 3W96C 3AL0C 4H9PB 4JJNB 1KX5B 4H9RB 2Y2GA 5AV6C 5CPIB 2RVQC 5BT1C 5DNMB 4YS3B 3B6GB 5DNNA 3TU4C 3X1TB 3B0DB 4J8UB 3B0BA 5B2JA 1P3FB 4UUZB 3UTAC 3WA9D 3KUYD 4KUDC 5GT0A 5B2IB 4KGCD 3P5JB 5BO0B 5AY8D 3UTBC 4ZUXC 3AFAB 5AVCA 1BH8A 2Y2LA 3REJA 1Z2CB 3W98A 3VH6T 4XZQB 2LY8A 3V9RA 3AZJB 3LZ0A 3B6FA 1F66B 1P3AB 4HGAB 1M19B 1AOIA 3VH5T 3MNNA 3W97B 1N1JA 5F99D 5AVBD 4WU8B 3C1CC 5AV8C 3WTPB 1TZYA 3MGRB 1KX3D 4Z5TD 2CV5D 5B40B 3LZ1D 1EQZC 3REKD 3AZMC 1ZLAC 5B32C 3AZHB 1P3MB 4WU9C 5AV5B 4X23B 3A6NB 3AZIA 3X1SA 5GSUB 3REIA 3AN2B 3AZED 4R8PB 3MVDB 2IO5B 3W96B 2NZDB 5BNXA 1AOIC 4M6BA 1HTAA 4CSRA 5AV6B 4LD9A 4NE5A 5B31D 3UT9D 4KHAB 2BYMA 3H0MC 2L5AA 1B67A 2F2AC 1M18D 5CPKC 3REHD 4CAYB 3MGPC 1HQ3A 3O62A 4ZUXB 3IP4C 4UPKA 2AROC 5JRGD 3UTBB 1P3BD 3WKJA 2DF4C 1JFIB 3WA9A 1M1AC 4J8WC 2FJ7C 5GXQC 3AYWD 3AZFC 1S32A 1BH9B 1TAFA 3C1CB 2JE5A 3EPLA 5AV8B 4ZBJC 2ZY4A 5GT0D 2UWXA 3MGQA 3A1KA 4Z66A 3AZKB 3AV2D 3REJD 1EQZB 3AZMB 1ZLAB 5JA4B 5G49B 3KUYC 3W98D 3X1UD 4YM6C 5CP6B 1P3GA 4WU9B 4KGCC 3B6FD 5AY8C 2JSSA 3LZ0D 5B1MB 2Y2NA 3AZLD 1KX3A 4Z5TA 5B33B 4NE3A 2F8NH 1P3PA 2VQRA 3MNND 3NQJA 3AZEA 4J8VA 1ID3C 5F99C 5AVBC 5CPKB 4XUJD 1WWSA 5B31A 3MGPB 3AV1D 4J8XA 1P3KB 1Q9CA 2AROB 2HUEC 3KXBA 1KX3C 5CPJB 2CV5C 3AZID 2F8NB 3REID 3LZ1C 3MGRA 1KX4B 3REKC 1U35C 3REHA 1M1AB 4J8WB 2FJ7B 2FFFB 2HIOB 5GXQB 1P3BA 3AZEC 1KU5A 3A6NA 3AZFB 1H3OA 5E5AC 5B0YA 5GT3B 2YFWA 5B31C 2BG1A 4ZBJB 3LELB 3UT9C 3R45A 3X1VA 3FDDA 4WNNB 3AYWA 1HQ3D 3O62D 3WKJD 1M18C 5CHLB 3KUYB 4WV4B 5FUGA 5B24B 4YM6B 4KGCB 4QLCD 5AY8B 3C1BA 5JRGC 1P3BC 2PYOA 5AV9A 3AV2A 5B1LB 3X1UA 1S32D 2YFVB 3AZLA 1KX5D 1P3IA 1P3LA 3MGQD 1ID3B 5DNNC 5F99B 4Z66D 5CPID 5AVBB 2NQBA 5B2JC 3WAAB 4Z2MH 5GT0C 3RELA 2HUEB 1P3GD 4H9QA 5C3IC 2CV5B 3LZ1B 3AV2C 5AVCC 3B0CW 3REJC 3REKB 1R4VA 4XUJA 3X1UC 1U35B 3W98C 1P3PD 2Y2PA 3AFAD 3EPKA 3AZKA 3AV1A 3B6FC 5KDMB 3LZ0C 3EPHA 5BNVB 3AZLC 4NFTA 4H9NA 4J8VD 3AZGA 5E5AB 3MNNC 4EO5C 3KFUG 5B0ZA 4H9OB 3UT9B 3W97D 4J8XD 1TZYC 3TU4B 3MGSA 3KXBD 1M18B 3MGRD 3UTAB 3W99A 4KUDB 5B40D 3AZNA 2BYKA 1P34A 3LJAA 5JRGB 3AZIC 3AZHD 3KWQA 3X1SC 3REIC 5CPJA 5AV5D 3VH6W 4X23D 3A6ND 4DRBA 2NZDD 2ZY2A 4QLCA 3MVDD 5B0YD 4H9SA 4LD9C 2HIOA 5DNNB 3X1VD 3VH5W 2G5IC 1P3OA 3KSYA 5B2JB 2DQNC 4H9PA 4JJNA 5GT0B 1KX5A 4H9RA 5C3IB 1HQ3C 3O62C 3LELA 3C1BD 5CPIA 5AVCB 1BH8B 3REJB 3WKJC 5DNMA 2PYOD 4WNNA 5AV9D 4YS3A 3B6GA 3W98B 3X1TA 3WA9C 5B32B 4J8UA 3V9RB 4QLCC 3B6FB 3LZ0B 4H9SC 1P3FA 3A1IA 4UUZA 2J8PA 5B2IA 4E44A 5BO0A 1P3ID 1P3LD 3MNNB 1AOIB 1N1JB 1S32C 3AFAA 2NQBD 4EO5B 4G91C 1BFMA 1KX5C 4XZQA 3AZJA 3MGQC 1TZYB 3C1CD 4Z66C 3RELD 5CPIC 1F66A 1P3AA 1M19A 2G5HC 3W97A 3AZKD 3AZMD 4WU8A 1P3GC 3AZIB 3X1SB 5CP6D 3REIB 4Z5TC 3WTPA 5BNXB 5B1MD 1A7WA 3AZGD 1P3PC 5B33D 5B40A 4CSRB 4LD9B 2Y2QA 5B0ZD 3AZHA 5B32G 4WZSB 4J8VC 5BS7A 2BYMB 5AV5A 4X23A
chains in the Genus database with same CATH topology
3AN2A 5GSUA 2NZDA 4R8PA 3MVDA 3MGSD 3W96A 3W97C 3W99D 3NQUB 4J8XC 3AZND 1HQ3B 5AV6A 2Y2KA 3O62B 3LJAD 1W2EA 1P34D 3KXBC 3WKJB 1P3KD 3KWQD 3MGRC 3TU4A 3WA9B 3EG5B 4KHAA 5CPJD 3REHC 5B40C 3B0CT 1KX4D 2F8NK 4KUDA 3AZHC 2XD1A 4CAYA 4G92C 2HIOD 5AV5C 4ZUXA 3A6NC 3UTBA 1S32B 3MVDC 5B0YC 4G91B 1P3OD 1TAFB 1JFIA 2F8NG 3AZFD 4JJND 3MGQB 3X1VC 4Z66B 5GT3D 1WWIA 3AYWC 3LELD 5DNMD 4YS3D 3B6GD 3X1TD 1BH9A 1P3GB 4J8UD 5B24D 3C1CA 4YM6D 3C1BC 1P3FD 1KX3B 5AV8A 4Z5TB 2PYOC 5AV9C 5B2ID 1P3PB 4E45A 1EQZA 5B1LD 3AZMA 1ZLAA 5JA4A 3NQJB 5G49A 5B32A 5CP6A 3AZEB 4J8VB 4WU9A 4XZQD 3VH6A 3AZJD 1P3IC 2Y2MA 5B1MA 1P3LC 2NQBC 1F66D 5B33A 1P3AD 1ID3D 1M19D 2Y2JA 5B31B 4WJ3C 4J8XB 3VH5A 3RELC 2Y2OA 3KXBB 4WU8D 3WAAD 1T3UA 3WTPD 4XUJC 2CWEA 4NE6A 3REHB 3AZKC 3AV1C 5CPKA 1U35D 5CP6C 1P3BB 3MGPA 4G92B 1P3KA 2JCHA 5B1MC 2AROA 1H3OB 3H0LC 3AZGC 1P3MD 5B33C 5B0YB 2F8NA 3AN2D 5GSUD 1KX4A 4R8PD 2YFWB 3W96D 5E5AD 5B0ZC 1M1AA 3R45B 3X1VB 4J8WA 2FJ7A 3AYWB 5GXQA 5AV6D 2RVQD 3MGSC 5BT1D 5FUGB 3AZFA 3TU4D 3W99C 3AZNC 1PZRA 5GT3A 3LJAC 3C1BB 3UTAD 1P34C 5B31G 4KUDD 3NQUA 2PYOB 5AV9B 4Z2MG 3KWQC 3AV2B 1P3KC 3X1UB 5CPJC 3UTBD 4ZUXD 2W8SA 3EPJA 1KX4C 2ZM5A 3KUYA 5B24A 4YM6A 3AZLB 2Y2HA 4KGCA 1P3IB 5AY8A 1P3LB 2HIOC 2NQBB 1P3OC 5B1LA 5DNND 4AWLC 4JJNC 3RELB 5GT3C 5B2JD 4H9QB 2YFVA 1B6WA 3LELC 1ULYA 5AV8D 5DNMC 1F1EA 4XUJB 4YS3C 1ID3A 3B6GC 5F99A 3X1TC 2ZY3A 3B0DC 3H0RC 5AVBA 5AVCD 4J8UC 3AV1B 5B24C 1EQZD 1P3FC 1ZLAD 3WAAA 5B32D 4H9NB 5B2IC 3AZGB 4DRAA 4WU9D 2CV5A 2Y2IA 1P3MA 3LZ1A 3AFAC 5B1LC 3REKA 1U35A 5B0ZB 1AOID 4XZQC 5KDMA 3AZJC 2ZY5A 5BNVA 3MGSB 4DQYB 1F66C 1P3AC 1TZYD 4HGAC 1M19C 5E5AA 3W99B 3AZNB 2BYKB 1P34B 3LJAB 4WU8C 5CPKD 3WAAC 3UT9A 4H9OA 3KWQB 3WTPE 2RIQA 3WTPC 3MGPD 3X1SD 2AROD 1M18A 4QLCB 2F8ND 3UTAA 2XD5A 1M1AD 4J8WD 2FJ7D 4LD9D 5JRGA 5BS7C 1P3MC 5GXQD 4X23C 3F6TA 3AN2C 5GSUC 1P3OB 2NZDC 4AWLB 4R8PC 2IO5C 3W96C 3AL0C 4H9PB 4JJNB 1KX5B 4H9RB 2Y2GA 5AV6C 5CPIB 2RVQC 5BT1C 5DNMB 4YS3B 3B6GB 5DNNA 3TU4C 3X1TB 3B0DB 4J8UB 3B0BA 5B2JA 1P3FB 4UUZB 3UTAC 3WA9D 3KUYD 4KUDC 5GT0A 5B2IB 4KGCD 3P5JB 5BO0B 5AY8D 3UTBC 4ZUXC 3AFAB 5AVCA 1BH8A 2Y2LA 3REJA 1Z2CB 3W98A 3VH6T 4XZQB 2LY8A 3V9RA 3AZJB 3LZ0A 3B6FA 1F66B 1P3AB 4HGAB 1M19B 1AOIA 3VH5T 3MNNA 3W97B 1N1JA 5F99D 5AVBD 4WU8B 3C1CC 5AV8C 3WTPB 1TZYA 3MGRB 1KX3D 4Z5TD 2CV5D 5B40B 3LZ1D 1EQZC 3REKD 3AZMC 1ZLAC 5B32C 3AZHB 1P3MB 4WU9C 5AV5B 4X23B 3A6NB 3AZIA 3X1SA 5GSUB 3REIA 3AN2B 3AZED 4R8PB 3MVDB 2IO5B 3W96B 2NZDB 5BNXA 1AOIC 4M6BA 1HTAA 4CSRA 5AV6B 4LD9A 4NE5A 5B31D 3UT9D 4KHAB 2BYMA 3H0MC 2L5AA 1B67A 2F2AC 1M18D 5CPKC 3REHD 4CAYB 3MGPC 1HQ3A 3O62A 4ZUXB 3IP4C 4UPKA 2AROC 5JRGD 3UTBB 1P3BD 3WKJA 2DF4C 1JFIB 3WA9A 1M1AC 4J8WC 2FJ7C 5GXQC 3AYWD 3AZFC 1S32A 1BH9B 1TAFA 3C1CB 2JE5A 3EPLA 5AV8B 4ZBJC 2ZY4A 5GT0D 2UWXA 3MGQA 3A1KA 4Z66A 3AZKB 3AV2D 3REJD 1EQZB 3AZMB 1ZLAB 5JA4B 5G49B 3KUYC 3W98D 3X1UD 4YM6C 5CP6B 1P3GA 4WU9B 4KGCC 3B6FD 5AY8C 2JSSA 3LZ0D 5B1MB 2Y2NA 3AZLD 1KX3A 4Z5TA 5B33B 4NE3A 2F8NH 1P3PA 2VQRA 3MNND 3NQJA 3AZEA 4J8VA 1ID3C 5F99C 5AVBC 5CPKB 4XUJD 1WWSA 5B31A 3MGPB 3AV1D 4J8XA 1P3KB 1Q9CA 2AROB 2HUEC 3KXBA 1KX3C 5CPJB 2CV5C 3AZID 2F8NB 3REID 3LZ1C 3MGRA 1KX4B 3REKC 1U35C 3REHA 1M1AB 4J8WB 2FJ7B 2FFFB 2HIOB 5GXQB 1P3BA 3AZEC 1KU5A 3A6NA 3AZFB 1H3OA 5E5AC 5B0YA 5GT3B 2YFWA 5B31C 2BG1A 4ZBJB 3LELB 3UT9C 3R45A 3X1VA 3FDDA 4WNNB 3AYWA 1HQ3D 3O62D 3WKJD 1M18C 5CHLB 3KUYB 4WV4B 5FUGA 5B24B 4YM6B 4KGCB 4QLCD 5AY8B 3C1BA 5JRGC 1P3BC 2PYOA 5AV9A 3AV2A 5B1LB 3X1UA 1S32D 2YFVB 3AZLA 1KX5D 1P3IA 1P3LA 3MGQD 1ID3B 5DNNC 5F99B 4Z66D 5CPID 5AVBB 2NQBA 5B2JC 3WAAB 4Z2MH 5GT0C 3RELA 2HUEB 1P3GD 4H9QA 5C3IC 2CV5B 3LZ1B 3AV2C 5AVCC 3B0CW 3REJC 3REKB 1R4VA 4XUJA 3X1UC 1U35B 3W98C 1P3PD 2Y2PA 3AFAD 3EPKA 3AZKA 3AV1A 3B6FC 5KDMB 3LZ0C 3EPHA 5BNVB 3AZLC 4NFTA 4H9NA 4J8VD 3AZGA 5E5AB 3MNNC 4EO5C 3KFUG 5B0ZA 4H9OB 3UT9B 3W97D 4J8XD 1TZYC 3TU4B 3MGSA 3KXBD 1M18B 3MGRD 3UTAB 3W99A 4KUDB 5B40D 3AZNA 2BYKA 1P34A 3LJAA 5JRGB 3AZIC 3AZHD 3KWQA 3X1SC 3REIC 5CPJA 5AV5D 3VH6W 4X23D 3A6ND 4DRBA 2NZDD 2ZY2A 4QLCA 3MVDD 5B0YD 4H9SA 4LD9C 2HIOA 5DNNB 3X1VD 3VH5W 2G5IC 1P3OA 3KSYA 5B2JB 2DQNC 4H9PA 4JJNA 5GT0B 1KX5A 4H9RA 5C3IB 1HQ3C 3O62C 3LELA 3C1BD 5CPIA 5AVCB 1BH8B 3REJB 3WKJC 5DNMA 2PYOD 4WNNA 5AV9D 4YS3A 3B6GA 3W98B 3X1TA 3WA9C 5B32B 4J8UA 3V9RB 4QLCC 3B6FB 3LZ0B 4H9SC 1P3FA 3A1IA 4UUZA 2J8PA 5B2IA 4E44A 5BO0A 1P3ID 1P3LD 3MNNB 1AOIB 1N1JB 1S32C 3AFAA 2NQBD 4EO5B 4G91C 1BFMA 1KX5C 4XZQA 3AZJA 3MGQC 1TZYB 3C1CD 4Z66C 3RELD 5CPIC 1F66A 1P3AA 1M19A 2G5HC 3W97A 3AZKD 3AZMD 4WU8A 1P3GC 3AZIB 3X1SB 5CP6D 3REIB 4Z5TC 3WTPA 5BNXB 5B1MD 1A7WA 3AZGD 1P3PC 5B33D 5B40A 4CSRB 4LD9B 2Y2QA 5B0ZD 3AZHA 5B32G 4WZSB 4J8VC 5BS7A 2BYMB 5AV5A 4X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 A;  5GSU A;  2NZD A;  4R8P A;  3MVD A;  3MGS D;  3W96 A;  3W97 C;  3W99 D;  3NQU B;  4J8X C;  3AZN D;  1HQ3 B;  5AV6 A;  3O62 B;  1P34 D;  3LJA D;  3WKJ B;  3KXB C;  1P3K D;  3KWQ D;  3MGR C;  3TU4 A;  3WA9 B;  4KHA A;  5CPJ D;  3REH C;  5B40 C;  3B0C T;  1KX4 D;  2F8N K;  4KUD A;  3AZH C;  4CAY A;  4G92 C;  2HIO D;  5AV5 C;  4ZUX A;  3A6N C;  3UTB A;  1S32 B;  3MVD C;  5B0Y C;  4G91 B;  1P3O D;  1TAF B;  1JFI A;  2F8N G;  3AZF D;  4JJN D;  3MGQ B;  3X1V C;  4Z66 B;  5GT3 D;  1WWI A;  3AYW C;  3LEL D;  5DNM D;  4YS3 D;  3B6G D;  3X1T D;  1BH9 A;  1P3G B;  4J8U D;  5B24 D;  3C1C A;  4YM6 D;  3C1B C;  1P3F D;  1KX3 B;  5AV8 A;  4Z5T B;  2PYO C;  5AV9 C;  5B2I D;  1P3P B;  4E45 A;  1EQZ A;  5B1L D;  3AZM A;  1ZLA A;  5JA4 A;  3NQJ B;  5G49 A;  5B32 A;  5CP6 A;  3AZE B;  4J8V B;  4WU9 A;  4XZQ D;  3VH6 A;  3AZJ D;  1P3I C;  1P3L C;  5B1M A;  2NQB C;  1F66 D;  5B33 A;  1P3A D;  1ID3 D;  1M19 D;  5B31 B;  4J8X B;  3VH5 A;  3REL C;  3KXB B;  4WU8 D;  3WAA D;  3WTP D;  4XUJ C;  2CWE A;  4NE6 A;  3REH B;  3AZK C;  3AV1 C;  5CPK A;  1U35 D;  5CP6 C;  1P3B B;  3MGP A;  4G92 B;  1P3K A;  5B1M C;  2ARO A;  1H3O B;  3AZG C;  1P3M D;  5B33 C;  5B0Y B;  2F8N A;  3AN2 D;  5GSU D;  1KX4 A;  4R8P D;  2YFW B;  3W96 D;  5E5A D;  5B0Z C;  1M1A A;  3R45 B;  3X1V B;  4J8W A;  2FJ7 A;  3AYW B;  5GXQ A;  5AV6 D;  2RVQ D;  3MGS C;  5BT1 D;  5FUG B;  3AZF A;  3TU4 D;  3W99 C;  3AZN C;  5GT3 A;  3C1B B;  3LJA C;  3UTA D;  1P34 C;  5B31 G;  4KUD D;  3NQU A;  2PYO B;  5AV9 B;  4Z2M G;  3KWQ C;  3AV2 B;  1P3K C;  3X1U B;  5CPJ C;  3UTB D;  4ZUX D;  1KX4 C;  3KUY A;  5B24 A;  4YM6 A;  3AZL B;  4KGC A;  1P3I B;  5AY8 A;  1P3L B;  2HIO C;  2NQB B;  1P3O C;  5B1L A;  5DNN D;  4AWL C;  4JJN C;  3REL B;  5GT3 C;  5B2J D;  4H9Q B;  2YFV A;  1B6W A;  3LEL C;  1ULY A;  5AV8 D;  5DNM C;  1F1E A;  4XUJ B;  4YS3 C;  1ID3 A;  3B6G C;  5F99 A;  3X1T C;  3B0D C;  5AVB A;  5AVC D;  3AV1 B;  4J8U C;  5B24 C;  1EQZ D;  1P3F C;  1ZLA D;  3WAA A;  5B32 D;  4H9N B;  5B2I C;  3AZG B;  4DRA A;  4WU9 D;  2CV5 A;  1P3M A;  3LZ1 A;  3AFA C;  5B1L C;  3REK A;  1U35 A;  5B0Z B;  1AOI D;  4XZQ C;  5KDM A;  3AZJ C;  5BNV A;  3MGS B;  1F66 C;  1P3A C;  1TZY D;  4HGA C;  1M19 C;  5E5A A;  3W99 B;  3AZN B;  2BYK B;  1P34 B;  3LJA B;  4WU8 C;  5CPK D;  3WAA C;  3UT9 A;  4H9O A;  3KWQ B;  3WTP E;  3WTP C;  3MGP D;  3X1S D;  2ARO D;  1M18 A;  4QLC B;  2F8N D;  3UTA A;  1M1A D;  4J8W D;  2FJ7 D;  4LD9 D;  5JRG A;  5BS7 C;  1P3M C;  5GXQ D;  4X23 C;  3AN2 C;  1P3O B;  5GSU C;  2NZD C;  4AWL B;  4R8P C;  2IO5 C;  3W96 C;  4H9P B;  4JJN B;  1KX5 B;  4H9R B;  5AV6 C;  5CPI B;  2RVQ C;  5BT1 C;  5DNM B;  4YS3 B;  3B6G B;  5DNN A;  3TU4 C;  3X1T B;  3B0D B;  4J8U B;  3B0B A;  5B2J A;  1P3F B;  4UUZ B;  3UTA C;  3WA9 D;  3KUY D;  4KUD C;  5GT0 A;  5B2I B;  4KGC D;  5BO0 B;  5AY8 D;  3UTB C;  4ZUX C;  3AFA B;  5AVC A;  1BH8 A;  3REJ A;  3W98 A;  3VH6 T;  4XZQ B;  2LY8 A;  3V9R A;  3AZJ B;  3LZ0 A;  3B6F A;  1F66 B;  1P3A B;  4HGA B;  1M19 B;  1AOI A;  3VH5 T;  3MNN A;  3W97 B;  1N1J A;  5F99 D;  5AVB D;  4WU8 B;  3C1C C;  5AV8 C;  3WTP B;  1TZY A;  3MGR B;  1KX3 D;  4Z5T D;  2CV5 D;  5B40 B;  3LZ1 D;  1EQZ C;  3REK D;  3AZM C;  1ZLA C;  5B32 C;  3AZH B;  1P3M B;  4WU9 C;  5AV5 B;  4X23 B;  3A6N B;  3AZI A;  3X1S A;  5GSU B;  3REI A;  3AN2 B;  3AZE D;  4R8P B;  3MVD B;  2IO5 B;  3W96 B;  2NZD B;  5BNX A;  1AOI C;  4M6B A;  1HTA A;  4CSR A;  5AV6 B;  4LD9 A;  4NE5 A;  5B31 D;  3UT9 D;  4KHA B;  2BYM A;  2L5A A;  1B67 A;  1M18 D;  5CPK C;  3REH D;  4CAY B;  3MGP C;  1HQ3 A;  3O62 A;  4ZUX B;  3UTB B;  3WKJ A;  2ARO C;  5JRG D;  1P3B D;  1JFI B;  3WA9 A;  1M1A C;  4J8W C;  2FJ7 C;  5GXQ C;  3AYW D;  3AZF C;  1S32 A;  1BH9 B;  1TAF A;  3C1C B;  5AV8 B;  4ZBJ C;  5GT0 D;  3MGQ A;  4Z66 A;  3AZK B;  3AV2 D;  3REJ D;  1EQZ B;  3AZM B;  1ZLA B;  5JA4 B;  5G49 B;  3KUY C;  3W98 D;  3X1U D;  4YM6 C;  5CP6 B;  1P3G A;  4WU9 B;  4KGC C;  3B6F D;  5AY8 C;  2JSS A;  3LZ0 D;  5B1M B;  3AZL D;  1KX3 A;  4Z5T A;  5B33 B;  4NE3 A;  2F8N H;  1P3P A;  3MNN D;  3NQJ A;  3AZE A;  4J8V A;  1ID3 C;  5F99 C;  5AVB C;  5CPK B;  4XUJ D;  1WWS A;  5B31 A;  3MGP B;  3AV1 D;  4J8X A;  1P3K B;  1Q9C A;  2ARO B;  2HUE C;  3KXB A;  1KX3 C;  5CPJ B;  2CV5 C;  3AZI D;  2F8N B;  3REI D;  3LZ1 C;  3MGR A;  1KX4 B;  3REK C;  1U35 C;  3REH A;  1M1A B;  4J8W B;  2FJ7 B;  2HIO B;  5GXQ B;  1P3B A;  3AZE C;  1KU5 A;  3A6N A;  3AZF B;  1H3O A;  5E5A C;  5B0Y A;  5GT3 B;  2YFW A;  5B31 C;  4ZBJ B;  3LEL B;  3UT9 C;  3R45 A;  3X1V A;  4WNN B;  3AYW A;  1HQ3 D;  3O62 D;  3WKJ D;  1M18 C;  5CHL B;  3KUY B;  4WV4 B;  5FUG A;  5B24 B;  4YM6 B;  4KGC B;  4QLC D;  5AY8 B;  3C1B A;  5JRG C;  1P3B C;  2PYO A;  5AV9 A;  3AV2 A;  5B1L B;  3X1U A;  1S32 D;  2YFV B;  3AZL A;  1KX5 D;  1P3I A;  1P3L A;  3MGQ D;  1ID3 B;  5DNN C;  5F99 B;  4Z66 D;  5CPI D;  5AVB B;  2NQB A;  5B2J C;  3WAA B;  4Z2M H;  5GT0 C;  3REL A;  2HUE B;  1P3G D;  4H9Q A;  5C3I C;  2CV5 B;  3LZ1 B;  3AV2 C;  5AVC C;  3B0C W;  3REJ C;  3REK B;  1R4V A;  4XUJ A;  3X1U C;  1U35 B;  3W98 C;  1P3P D;  3AFA D;  3AZK A;  3AV1 A;  3B6F C;  5KDM B;  3LZ0 C;  5BNV B;  3AZL C;  4NFT A;  4H9N A;  4J8V D;  3AZG A;  5E5A B;  3MNN C;  4EO5 C;  5B0Z A;  4H9O B;  3UT9 B;  3W97 D;  4J8X D;  1TZY C;  3TU4 B;  3MGS A;  3KXB D;  1M18 B;  3MGR D;  3UTA B;  3W99 A;  4KUD B;  5B40 D;  3AZN A;  2BYK A;  1P34 A;  3LJA A;  5JRG B;  3AZI C;  3AZH D;  3KWQ A;  3X1S C;  3REI C;  5CPJ A;  5AV5 D;  3VH6 W;  4X23 D;  3A6N D;  4DRB A;  2NZD D;  3MVD D;  4QLC A;  5B0Y D;  4H9S A;  4LD9 C;  2HIO A;  5DNN B;  3X1V D;  3VH5 W;  1P3O A;  3KSY A;  5B2J B;  4H9P A;  4JJN A;  5GT0 B;  1KX5 A;  4H9R A;  5C3I B;  1HQ3 C;  3O62 C;  3LEL A;  3C1B D;  5CPI A;  5AVC B;  1BH8 B;  3REJ B;  3WKJ C;  5DNM A;  2PYO D;  4WNN A;  5AV9 D;  4YS3 A;  3B6G A;  3W98 B;  3X1T A;  3WA9 C;  5B32 B;  4J8U A;  3V9R B;  4QLC C;  3B6F B;  3LZ0 B;  4H9S C;  1P3F A;  4UUZ A;  5B2I A;  4E44 A;  5BO0 A;  1P3I D;  1P3L D;  3MNN B;  1AOI B;  1N1J B;  1S32 C;  3AFA A;  2NQB D;  4EO5 B;  4G91 C;  1BFM A;  1KX5 C;  4XZQ A;  3AZJ A;  3MGQ C;  1TZY B;  3C1C D;  4Z66 C;  3REL D;  5CPI C;  1F66 A;  1P3A A;  1M19 A;  3W97 A;  3AZK D;  3AZM D;  4WU8 A;  1P3G C;  3AZI B;  3X1S B;  5CP6 D;  3REI B;  4Z5T C;  3WTP A;  5BNX B;  5B1M D;  1A7W A;  3AZG D;  1P3P C;  5B33 D;  5B40 A;  4CSR B;  4LD9 B;  5B0Z D;  3AZH A;  5B32 G;  4WZS B;  4J8V C;  5BS7 A;  2BYM B;  5AV5 A;  4X23 A; 
#chains in the Genus database with same CATH topology
 3AN2 A;  5GSU A;  2NZD A;  4R8P A;  3MVD A;  3MGS D;  3W96 A;  3W97 C;  3W99 D;  3NQU B;  4J8X C;  3AZN D;  1HQ3 B;  5AV6 A;  2Y2K A;  3O62 B;  3LJA D;  1W2E A;  1P34 D;  3KXB C;  3WKJ B;  1P3K D;  3KWQ D;  3MGR C;  3TU4 A;  3WA9 B;  3EG5 B;  4KHA A;  5CPJ D;  3REH C;  5B40 C;  3B0C T;  1KX4 D;  2F8N K;  4KUD A;  3AZH C;  2XD1 A;  4CAY A;  4G92 C;  2HIO D;  5AV5 C;  4ZUX A;  3A6N C;  3UTB A;  1S32 B;  3MVD C;  5B0Y C;  4G91 B;  1P3O D;  1TAF B;  1JFI A;  2F8N G;  3AZF D;  4JJN D;  3MGQ B;  3X1V C;  4Z66 B;  5GT3 D;  1WWI A;  3AYW C;  3LEL D;  5DNM D;  4YS3 D;  3B6G D;  3X1T D;  1BH9 A;  1P3G B;  4J8U D;  5B24 D;  3C1C A;  4YM6 D;  3C1B C;  1P3F D;  1KX3 B;  5AV8 A;  4Z5T B;  2PYO C;  5AV9 C;  5B2I D;  1P3P B;  4E45 A;  1EQZ A;  5B1L D;  3AZM A;  1ZLA A;  5JA4 A;  3NQJ B;  5G49 A;  5B32 A;  5CP6 A;  3AZE B;  4J8V B;  4WU9 A;  4XZQ D;  3VH6 A;  3AZJ D;  1P3I C;  2Y2M A;  5B1M A;  1P3L C;  2NQB C;  1F66 D;  5B33 A;  1P3A D;  1ID3 D;  1M19 D;  2Y2J A;  5B31 B;  4WJ3 C;  4J8X B;  3VH5 A;  3REL C;  2Y2O A;  3KXB B;  4WU8 D;  3WAA D;  1T3U A;  3WTP D;  4XUJ C;  2CWE A;  4NE6 A;  3REH B;  3AZK C;  3AV1 C;  5CPK A;  1U35 D;  5CP6 C;  1P3B B;  3MGP A;  4G92 B;  1P3K A;  2JCH A;  5B1M C;  2ARO A;  1H3O B;  3H0L C;  3AZG C;  1P3M D;  5B33 C;  5B0Y B;  2F8N A;  3AN2 D;  5GSU D;  1KX4 A;  4R8P D;  2YFW B;  3W96 D;  5E5A D;  5B0Z C;  1M1A A;  3R45 B;  3X1V B;  4J8W A;  2FJ7 A;  3AYW B;  5GXQ A;  5AV6 D;  2RVQ D;  3MGS C;  5BT1 D;  5FUG B;  3AZF A;  3TU4 D;  3W99 C;  3AZN C;  1PZR A;  5GT3 A;  3LJA C;  3C1B B;  3UTA D;  1P34 C;  5B31 G;  4KUD D;  3NQU A;  2PYO B;  5AV9 B;  4Z2M G;  3KWQ C;  3AV2 B;  1P3K C;  3X1U B;  5CPJ C;  3UTB D;  4ZUX D;  2W8S A;  3EPJ A;  1KX4 C;  2ZM5 A;  3KUY A;  5B24 A;  4YM6 A;  3AZL B;  2Y2H A;  4KGC A;  1P3I B;  5AY8 A;  1P3L B;  2HIO C;  2NQB B;  1P3O C;  5B1L A;  5DNN D;  4AWL C;  4JJN C;  3REL B;  5GT3 C;  5B2J D;  4H9Q B;  2YFV A;  1B6W A;  3LEL C;  1ULY A;  5AV8 D;  5DNM C;  1F1E A;  4XUJ B;  4YS3 C;  1ID3 A;  3B6G C;  5F99 A;  3X1T C;  2ZY3 A;  3B0D C;  3H0R C;  5AVB A;  5AVC D;  4J8U C;  3AV1 B;  5B24 C;  1EQZ D;  1P3F C;  1ZLA D;  3WAA A;  5B32 D;  4H9N B;  5B2I C;  3AZG B;  4DRA A;  4WU9 D;  2CV5 A;  2Y2I A;  1P3M A;  3LZ1 A;  3AFA C;  5B1L C;  3REK A;  1U35 A;  5B0Z B;  1AOI D;  4XZQ C;  5KDM A;  3AZJ C;  2ZY5 A;  5BNV A;  3MGS B;  4DQY B;  1F66 C;  1P3A C;  1TZY D;  4HGA C;  1M19 C;  5E5A A;  3W99 B;  3AZN B;  2BYK B;  1P34 B;  3LJA B;  4WU8 C;  5CPK D;  3WAA C;  3UT9 A;  4H9O A;  3KWQ B;  3WTP E;  2RIQ A;  3WTP C;  3MGP D;  3X1S D;  2ARO D;  1M18 A;  4QLC B;  2F8N D;  3UTA A;  2XD5 A;  1M1A D;  4J8W D;  2FJ7 D;  4LD9 D;  5JRG A;  5BS7 C;  1P3M C;  5GXQ D;  4X23 C;  3F6T A;  3AN2 C;  5GSU C;  1P3O B;  2NZD C;  4AWL B;  4R8P C;  2IO5 C;  3W96 C;  3AL0 C;  4H9P B;  4JJN B;  1KX5 B;  4H9R B;  2Y2G A;  5AV6 C;  5CPI B;  2RVQ C;  5BT1 C;  5DNM B;  4YS3 B;  3B6G B;  5DNN A;  3TU4 C;  3X1T B;  3B0D B;  4J8U B;  3B0B A;  5B2J A;  1P3F B;  4UUZ B;  3UTA C;  3WA9 D;  3KUY D;  4KUD C;  5GT0 A;  5B2I B;  4KGC D;  3P5J B;  5BO0 B;  5AY8 D;  3UTB C;  4ZUX C;  3AFA B;  5AVC A;  1BH8 A;  2Y2L A;  3REJ A;  1Z2C B;  3W98 A;  3VH6 T;  4XZQ B;  2LY8 A;  3V9R A;  3AZJ B;  3LZ0 A;  3B6F A;  1F66 B;  1P3A B;  4HGA B;  1M19 B;  1AOI A;  3VH5 T;  3MNN A;  3W97 B;  1N1J A;  5F99 D;  5AVB D;  4WU8 B;  3C1C C;  5AV8 C;  3WTP B;  1TZY A;  3MGR B;  1KX3 D;  4Z5T D;  2CV5 D;  5B40 B;  3LZ1 D;  1EQZ C;  3REK D;  3AZM C;  1ZLA C;  5B32 C;  3AZH B;  1P3M B;  4WU9 C;  5AV5 B;  4X23 B;  3A6N B;  3AZI A;  3X1S A;  5GSU B;  3REI A;  3AN2 B;  3AZE D;  4R8P B;  3MVD B;  2IO5 B;  3W96 B;  2NZD B;  5BNX A;  1AOI C;  4M6B A;  1HTA A;  4CSR A;  5AV6 B;  4LD9 A;  4NE5 A;  5B31 D;  3UT9 D;  4KHA B;  2BYM A;  3H0M C;  2L5A A;  1B67 A;  2F2A C;  1M18 D;  5CPK C;  3REH D;  4CAY B;  3MGP C;  1HQ3 A;  3O62 A;  4ZUX B;  3IP4 C;  4UPK A;  2ARO C;  5JRG D;  3UTB B;  1P3B D;  3WKJ A;  2DF4 C;  1JFI B;  3WA9 A;  1M1A C;  4J8W C;  2FJ7 C;  5GXQ C;  3AYW D;  3AZF C;  1S32 A;  1BH9 B;  1TAF A;  3C1C B;  2JE5 A;  3EPL A;  5AV8 B;  4ZBJ C;  2ZY4 A;  5GT0 D;  2UWX A;  3MGQ A;  3A1K A;  4Z66 A;  3AZK B;  3AV2 D;  3REJ D;  1EQZ B;  3AZM B;  1ZLA B;  5JA4 B;  5G49 B;  3KUY C;  3W98 D;  3X1U D;  4YM6 C;  5CP6 B;  1P3G A;  4WU9 B;  4KGC C;  3B6F D;  5AY8 C;  2JSS A;  3LZ0 D;  5B1M B;  2Y2N A;  3AZL D;  1KX3 A;  4Z5T A;  5B33 B;  4NE3 A;  2F8N H;  1P3P A;  2VQR A;  3MNN D;  3NQJ A;  3AZE A;  4J8V A;  1ID3 C;  5F99 C;  5AVB C;  5CPK B;  4XUJ D;  1WWS A;  5B31 A;  3MGP B;  3AV1 D;  4J8X A;  1P3K B;  1Q9C A;  2ARO B;  2HUE C;  3KXB A;  1KX3 C;  5CPJ B;  2CV5 C;  3AZI D;  2F8N B;  3REI D;  3LZ1 C;  3MGR A;  1KX4 B;  3REK C;  1U35 C;  3REH A;  1M1A B;  4J8W B;  2FJ7 B;  2FFF B;  2HIO B;  5GXQ B;  1P3B A;  3AZE C;  1KU5 A;  3A6N A;  3AZF B;  1H3O A;  5E5A C;  5B0Y A;  5GT3 B;  2YFW A;  5B31 C;  2BG1 A;  4ZBJ B;  3LEL B;  3UT9 C;  3R45 A;  3X1V A;  3FDD A;  4WNN B;  3AYW A;  1HQ3 D;  3O62 D;  3WKJ D;  1M18 C;  5CHL B;  3KUY B;  4WV4 B;  5FUG A;  5B24 B;  4YM6 B;  4KGC B;  4QLC D;  5AY8 B;  3C1B A;  5JRG C;  1P3B C;  2PYO A;  5AV9 A;  3AV2 A;  5B1L B;  3X1U A;  1S32 D;  2YFV B;  3AZL A;  1KX5 D;  1P3I A;  1P3L A;  3MGQ D;  1ID3 B;  5DNN C;  5F99 B;  4Z66 D;  5CPI D;  5AVB B;  2NQB A;  5B2J C;  3WAA B;  4Z2M H;  5GT0 C;  3REL A;  2HUE B;  1P3G D;  4H9Q A;  5C3I C;  2CV5 B;  3LZ1 B;  3AV2 C;  5AVC C;  3B0C W;  3REJ C;  3REK B;  1R4V A;  4XUJ A;  3X1U C;  1U35 B;  3W98 C;  1P3P D;  2Y2P A;  3AFA D;  3EPK A;  3AZK A;  3AV1 A;  3B6F C;  5KDM B;  3LZ0 C;  3EPH A;  5BNV B;  3AZL C;  4NFT A;  4H9N A;  4J8V D;  3AZG A;  5E5A B;  3MNN C;  4EO5 C;  3KFU G;  5B0Z A;  4H9O B;  3UT9 B;  3W97 D;  4J8X D;  1TZY C;  3TU4 B;  3MGS A;  3KXB D;  1M18 B;  3MGR D;  3UTA B;  3W99 A;  4KUD B;  5B40 D;  3AZN A;  2BYK A;  1P34 A;  3LJA A;  5JRG B;  3AZI C;  3AZH D;  3KWQ A;  3X1S C;  3REI C;  5CPJ A;  5AV5 D;  3VH6 W;  4X23 D;  3A6N D;  4DRB A;  2NZD D;  2ZY2 A;  4QLC A;  3MVD D;  5B0Y D;  4H9S A;  4LD9 C;  2HIO A;  5DNN B;  3X1V D;  3VH5 W;  2G5I C;  1P3O A;  3KSY A;  5B2J B;  2DQN C;  4H9P A;  4JJN A;  5GT0 B;  1KX5 A;  4H9R A;  5C3I B;  1HQ3 C;  3O62 C;  3LEL A;  3C1B D;  5CPI A;  5AVC B;  1BH8 B;  3REJ B;  3WKJ C;  5DNM A;  2PYO D;  4WNN A;  5AV9 D;  4YS3 A;  3B6G A;  3W98 B;  3X1T A;  3WA9 C;  5B32 B;  4J8U A;  3V9R B;  4QLC C;  3B6F B;  3LZ0 B;  4H9S C;  1P3F A;  3A1I A;  4UUZ A;  2J8P A;  5B2I A;  4E44 A;  5BO0 A;  1P3I D;  1P3L D;  3MNN B;  1AOI B;  1N1J B;  1S32 C;  3AFA A;  2NQB D;  4EO5 B;  4G91 C;  1BFM A;  1KX5 C;  4XZQ A;  3AZJ A;  3MGQ C;  1TZY B;  3C1C D;  4Z66 C;  3REL D;  5CPI C;  1F66 A;  1P3A A;  1M19 A;  2G5H C;  3W97 A;  3AZK D;  3AZM D;  4WU8 A;  1P3G C;  3AZI B;  3X1S B;  5CP6 D;  3REI B;  4Z5T C;  3WTP A;  5BNX B;  5B1M D;  1A7W A;  3AZG D;  1P3P C;  5B33 D;  5B40 A;  4CSR B;  4LD9 B;  2Y2Q A;  5B0Z D;  3AZH A;  5B32 G;  4WZS B;  4J8V C;  5BS7 A;  2BYM B;  5AV5 A;  4X23 A; 
#chains in the Genus database with same CATH homology
 3AN2 A;  5GSU A;  2NZD A;  4R8P A;  3MVD A;  3MGS D;  3W96 A;  3W97 C;  3W99 D;  3NQU B;  4J8X C;  3AZN D;  1HQ3 B;  5AV6 A;  2Y2K A;  3O62 B;  3LJA D;  1W2E A;  1P34 D;  3KXB C;  3WKJ B;  1P3K D;  3KWQ D;  3MGR C;  3TU4 A;  3WA9 B;  3EG5 B;  4KHA A;  5CPJ D;  3REH C;  5B40 C;  3B0C T;  1KX4 D;  2F8N K;  4KUD A;  3AZH C;  2XD1 A;  4CAY A;  4G92 C;  2HIO D;  5AV5 C;  4ZUX A;  3A6N C;  3UTB A;  1S32 B;  3MVD C;  5B0Y C;  4G91 B;  1P3O D;  1TAF B;  1JFI A;  2F8N G;  3AZF D;  4JJN D;  3MGQ B;  3X1V C;  4Z66 B;  5GT3 D;  1WWI A;  3AYW C;  3LEL D;  5DNM D;  4YS3 D;  3B6G D;  3X1T D;  1BH9 A;  1P3G B;  4J8U D;  5B24 D;  3C1C A;  4YM6 D;  3C1B C;  1P3F D;  1KX3 B;  5AV8 A;  4Z5T B;  2PYO C;  5AV9 C;  5B2I D;  1P3P B;  4E45 A;  1EQZ A;  5B1L D;  3AZM A;  1ZLA A;  5JA4 A;  3NQJ B;  5G49 A;  5B32 A;  5CP6 A;  3AZE B;  4J8V B;  4WU9 A;  4XZQ D;  3VH6 A;  3AZJ D;  1P3I C;  2Y2M A;  5B1M A;  1P3L C;  2NQB C;  1F66 D;  5B33 A;  1P3A D;  1ID3 D;  1M19 D;  2Y2J A;  5B31 B;  4WJ3 C;  4J8X B;  3VH5 A;  3REL C;  2Y2O A;  3KXB B;  4WU8 D;  3WAA D;  1T3U A;  3WTP D;  4XUJ C;  2CWE A;  4NE6 A;  3REH B;  3AZK C;  3AV1 C;  5CPK A;  1U35 D;  5CP6 C;  1P3B B;  3MGP A;  4G92 B;  1P3K A;  2JCH A;  5B1M C;  2ARO A;  1H3O B;  3H0L C;  3AZG C;  1P3M D;  5B33 C;  5B0Y B;  2F8N A;  3AN2 D;  5GSU D;  1KX4 A;  4R8P D;  2YFW B;  3W96 D;  5E5A D;  5B0Z C;  1M1A A;  3R45 B;  3X1V B;  4J8W A;  2FJ7 A;  3AYW B;  5GXQ A;  5AV6 D;  2RVQ D;  3MGS C;  5BT1 D;  5FUG B;  3AZF A;  3TU4 D;  3W99 C;  3AZN C;  1PZR A;  5GT3 A;  3LJA C;  3C1B B;  3UTA D;  1P34 C;  5B31 G;  4KUD D;  3NQU A;  2PYO B;  5AV9 B;  4Z2M G;  3KWQ C;  3AV2 B;  1P3K C;  3X1U B;  5CPJ C;  3UTB D;  4ZUX D;  2W8S A;  3EPJ A;  1KX4 C;  2ZM5 A;  3KUY A;  5B24 A;  4YM6 A;  3AZL B;  2Y2H A;  4KGC A;  1P3I B;  5AY8 A;  1P3L B;  2HIO C;  2NQB B;  1P3O C;  5B1L A;  5DNN D;  4AWL C;  4JJN C;  3REL B;  5GT3 C;  5B2J D;  4H9Q B;  2YFV A;  1B6W A;  3LEL C;  1ULY A;  5AV8 D;  5DNM C;  1F1E A;  4XUJ B;  4YS3 C;  1ID3 A;  3B6G C;  5F99 A;  3X1T C;  2ZY3 A;  3B0D C;  3H0R C;  5AVB A;  5AVC D;  4J8U C;  3AV1 B;  5B24 C;  1EQZ D;  1P3F C;  1ZLA D;  3WAA A;  5B32 D;  4H9N B;  5B2I C;  3AZG B;  4DRA A;  4WU9 D;  2CV5 A;  2Y2I A;  1P3M A;  3LZ1 A;  3AFA C;  5B1L C;  3REK A;  1U35 A;  5B0Z B;  1AOI D;  4XZQ C;  5KDM A;  3AZJ C;  2ZY5 A;  5BNV A;  3MGS B;  4DQY B;  1F66 C;  1P3A C;  1TZY D;  4HGA C;  1M19 C;  5E5A A;  3W99 B;  3AZN B;  2BYK B;  1P34 B;  3LJA B;  4WU8 C;  5CPK D;  3WAA C;  3UT9 A;  4H9O A;  3KWQ B;  3WTP E;  2RIQ A;  3WTP C;  3MGP D;  3X1S D;  2ARO D;  1M18 A;  4QLC B;  2F8N D;  3UTA A;  2XD5 A;  1M1A D;  4J8W D;  2FJ7 D;  4LD9 D;  5JRG A;  5BS7 C;  1P3M C;  5GXQ D;  4X23 C;  3F6T A;  3AN2 C;  5GSU C;  1P3O B;  2NZD C;  4AWL B;  4R8P C;  2IO5 C;  3W96 C;  3AL0 C;  4H9P B;  4JJN B;  1KX5 B;  4H9R B;  2Y2G A;  5AV6 C;  5CPI B;  2RVQ C;  5BT1 C;  5DNM B;  4YS3 B;  3B6G B;  5DNN A;  3TU4 C;  3X1T B;  3B0D B;  4J8U B;  3B0B A;  5B2J A;  1P3F B;  4UUZ B;  3UTA C;  3WA9 D;  3KUY D;  4KUD C;  5GT0 A;  5B2I B;  4KGC D;  3P5J B;  5BO0 B;  5AY8 D;  3UTB C;  4ZUX C;  3AFA B;  5AVC A;  1BH8 A;  2Y2L A;  3REJ A;  1Z2C B;  3W98 A;  3VH6 T;  4XZQ B;  2LY8 A;  3V9R A;  3AZJ B;  3LZ0 A;  3B6F A;  1F66 B;  1P3A B;  4HGA B;  1M19 B;  1AOI A;  3VH5 T;  3MNN A;  3W97 B;  1N1J A;  5F99 D;  5AVB D;  4WU8 B;  3C1C C;  5AV8 C;  3WTP B;  1TZY A;  3MGR B;  1KX3 D;  4Z5T D;  2CV5 D;  5B40 B;  3LZ1 D;  1EQZ C;  3REK D;  3AZM C;  1ZLA C;  5B32 C;  3AZH B;  1P3M B;  4WU9 C;  5AV5 B;  4X23 B;  3A6N B;  3AZI A;  3X1S A;  5GSU B;  3REI A;  3AN2 B;  3AZE D;  4R8P B;  3MVD B;  2IO5 B;  3W96 B;  2NZD B;  5BNX A;  1AOI C;  4M6B A;  1HTA A;  4CSR A;  5AV6 B;  4LD9 A;  4NE5 A;  5B31 D;  3UT9 D;  4KHA B;  2BYM A;  3H0M C;  2L5A A;  1B67 A;  2F2A C;  1M18 D;  5CPK C;  3REH D;  4CAY B;  3MGP C;  1HQ3 A;  3O62 A;  4ZUX B;  3IP4 C;  4UPK A;  2ARO C;  5JRG D;  3UTB B;  1P3B D;  3WKJ A;  2DF4 C;  1JFI B;  3WA9 A;  1M1A C;  4J8W C;  2FJ7 C;  5GXQ C;  3AYW D;  3AZF C;  1S32 A;  1BH9 B;  1TAF A;  3C1C B;  2JE5 A;  3EPL A;  5AV8 B;  4ZBJ C;  2ZY4 A;  5GT0 D;  2UWX A;  3MGQ A;  3A1K A;  4Z66 A;  3AZK B;  3AV2 D;  3REJ D;  1EQZ B;  3AZM B;  1ZLA B;  5JA4 B;  5G49 B;  3KUY C;  3W98 D;  3X1U D;  4YM6 C;  5CP6 B;  1P3G A;  4WU9 B;  4KGC C;  3B6F D;  5AY8 C;  2JSS A;  3LZ0 D;  5B1M B;  2Y2N A;  3AZL D;  1KX3 A;  4Z5T A;  5B33 B;  4NE3 A;  2F8N H;  1P3P A;  2VQR A;  3MNN D;  3NQJ A;  3AZE A;  4J8V A;  1ID3 C;  5F99 C;  5AVB C;  5CPK B;  4XUJ D;  1WWS A;  5B31 A;  3MGP B;  3AV1 D;  4J8X A;  1P3K B;  1Q9C A;  2ARO B;  2HUE C;  3KXB A;  1KX3 C;  5CPJ B;  2CV5 C;  3AZI D;  2F8N B;  3REI D;  3LZ1 C;  3MGR A;  1KX4 B;  3REK C;  1U35 C;  3REH A;  1M1A B;  4J8W B;  2FJ7 B;  2FFF B;  2HIO B;  5GXQ B;  1P3B A;  3AZE C;  1KU5 A;  3A6N A;  3AZF B;  1H3O A;  5E5A C;  5B0Y A;  5GT3 B;  2YFW A;  5B31 C;  2BG1 A;  4ZBJ B;  3LEL B;  3UT9 C;  3R45 A;  3X1V A;  3FDD A;  4WNN B;  3AYW A;  1HQ3 D;  3O62 D;  3WKJ D;  1M18 C;  5CHL B;  3KUY B;  4WV4 B;  5FUG A;  5B24 B;  4YM6 B;  4KGC B;  4QLC D;  5AY8 B;  3C1B A;  5JRG C;  1P3B C;  2PYO A;  5AV9 A;  3AV2 A;  5B1L B;  3X1U A;  1S32 D;  2YFV B;  3AZL A;  1KX5 D;  1P3I A;  1P3L A;  3MGQ D;  1ID3 B;  5DNN C;  5F99 B;  4Z66 D;  5CPI D;  5AVB B;  2NQB A;  5B2J C;  3WAA B;  4Z2M H;  5GT0 C;  3REL A;  2HUE B;  1P3G D;  4H9Q A;  5C3I C;  2CV5 B;  3LZ1 B;  3AV2 C;  5AVC C;  3B0C W;  3REJ C;  3REK B;  1R4V A;  4XUJ A;  3X1U C;  1U35 B;  3W98 C;  1P3P D;  2Y2P A;  3AFA D;  3EPK A;  3AZK A;  3AV1 A;  3B6F C;  5KDM B;  3LZ0 C;  3EPH A;  5BNV B;  3AZL C;  4NFT A;  4H9N A;  4J8V D;  3AZG A;  5E5A B;  3MNN C;  4EO5 C;  3KFU G;  5B0Z A;  4H9O B;  3UT9 B;  3W97 D;  4J8X D;  1TZY C;  3TU4 B;  3MGS A;  3KXB D;  1M18 B;  3MGR D;  3UTA B;  3W99 A;  4KUD B;  5B40 D;  3AZN A;  2BYK A;  1P34 A;  3LJA A;  5JRG B;  3AZI C;  3AZH D;  3KWQ A;  3X1S C;  3REI C;  5CPJ A;  5AV5 D;  3VH6 W;  4X23 D;  3A6N D;  4DRB A;  2NZD D;  2ZY2 A;  4QLC A;  3MVD D;  5B0Y D;  4H9S A;  4LD9 C;  2HIO A;  5DNN B;  3X1V D;  3VH5 W;  2G5I C;  1P3O A;  3KSY A;  5B2J B;  2DQN C;  4H9P A;  4JJN A;  5GT0 B;  1KX5 A;  4H9R A;  5C3I B;  1HQ3 C;  3O62 C;  3LEL A;  3C1B D;  5CPI A;  5AVC B;  1BH8 B;  3REJ B;  3WKJ C;  5DNM A;  2PYO D;  4WNN A;  5AV9 D;  4YS3 A;  3B6G A;  3W98 B;  3X1T A;  3WA9 C;  5B32 B;  4J8U A;  3V9R B;  4QLC C;  3B6F B;  3LZ0 B;  4H9S C;  1P3F A;  3A1I A;  4UUZ A;  2J8P A;  5B2I A;  4E44 A;  5BO0 A;  1P3I D;  1P3L D;  3MNN B;  1AOI B;  1N1J B;  1S32 C;  3AFA A;  2NQB D;  4EO5 B;  4G91 C;  1BFM A;  1KX5 C;  4XZQ A;  3AZJ A;  3MGQ C;  1TZY B;  3C1C D;  4Z66 C;  3REL D;  5CPI C;  1F66 A;  1P3A A;  1M19 A;  2G5H C;  3W97 A;  3AZK D;  3AZM D;  4WU8 A;  1P3G C;  3AZI B;  3X1S B;  5CP6 D;  3REI B;  4Z5T C;  3WTP A;  5BNX B;  5B1M D;  1A7W A;  3AZG D;  1P3P C;  5B33 D;  5B40 A;  4CSR B;  4LD9 B;  2Y2Q A;  5B0Z D;  3AZH A;  5B32 G;  4WZS B;  4J8V C;  5BS7 A;  2BYM B;  5AV5 A;  4X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...