5B4WA

Crystal structure of plexin inhibitor complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
456
structure length
434
Chain Sequence
TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-B1
publication title Allosteric Inhibition of a Semaphorin 4D Receptor Plexin B1 by a High-Affinity Macrocyclic Peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 101
structure length 434
sequence length 456
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5b4wA00
5TEFA 5EMKB 4PSXB 3PXWD 2OVQB 3OKYA 4GQ2P 2MTAH 2HJBA 3A0FA 2CO0A 3OTTA 3C9CA 3MKSB 5GXIA 2H9NA 5A2Qg 2H6NA 5JWZA 5H14A 3MKQA 4YVDA 2H13A 5IT9g 3AFCA 1SHYB 1JMZB 4GMBA 3DXKC 4I79A 2AGZA 4GGCA 3JROA 1YFQA 2HXCA 4JSNC 4GQ1A 1ERJA 5CXCB 3EWEA 5EAMA 4J81A 2P9LC 2CN3A 1GP2B 5AJAA 4A0BA 5CXCA 2IWFA 4GQBB 5FXYA 2B5LA 2HYEA 2GC7A 4JT5C 2PM6B 3RLMD 4FA5D 4ES0A 5EM2A 3HFQA 2Q7QA 3MXXA 4J0XA 5EALA 5GMKn 3GFCA 5K1CC 3J80g 4ERQA 4A08B 3OKTA 2J56H 2CN2A 5IGOA 4J78A 3DXMC 3IJCA 2I0RA 3NVXA 5K19A 4A08A 5SXMA 3KRXB 3RN1D 2IAAA 1GXRA 2YBAA 3BG1A 2XYIA 3UVLA 3SWSD 4MK0B 3RN0D 5THAA 4X63B 2IWKA 4U7AA 2I3SA 3KRWB 4TZ4A 3SBRA 3SCYA 3EI1B 2CE8A 3I7HA 4FA1D 3UVMA 3I7LA 3SN6B 2P9UC 4OWRA 4CI1A 1RI6A 3EI1A 4O1QD 4EWRA 2AGLA 4GZ8A 3VA6A 2HKMA 3IIYA 3I7OA 4CC9A 4CZYA 4K3ID 2G9AA 4FHLA 4GGDA 4XYIA 2IUVA 3ULEC 2YNNA 4FA4D 4QRJA 4CY3A 3UVKA 1U4CA 5EMMB 1U2VC 3I8CA 3EI2B 3PE7A 2HJ4A 3JAMg 3C99A 3MZKA 3EG6A 4FAND 1Q47A 3EI2A 1FWXA 4CZXA 5CYKB 2B5MA 5I5IA 4GM9A 3J81g 2H9PA 3EU7A 4ZOXA 5TF2A 5I5JA 3VH0A 3UVOA 2P9KC 5CYKA 4CI8A 2B5NA 1A0RB 5FKRA 3FRXA 5IC7A 3JZNA 2PM7B 4J86A 3UVNA 2PM9B 3EMHA 2G99A 3JB9L 3IKOA 4JSVC 3RFGA 3SFZA 2AH1A 2PM9A 3V9FA 2P9PC 3OKWA 2H68A 5EMJB 4O45A 2YB8B 5HYNB 3F3GA 3JRPA 2P9IC 4ERYA 2HKRA 2QXVA 2OIZA 4X61B 1S4UX 1TYQC 2IUQA 1K8KC 3NVNA 1GOTB 1B9YA 1PI6A 4JD2C 4IA9A 3C75H 5C2WB 2H6QA 5C9ZB 4L3HD 4BL0A 5IGQA 3F3PA 4J0WA 2CNXA 3AL8B 5HE3B 4JSXC 5TEEA 2Z2NA 4J87A 1PEVA 3CFSB 3L4OD 4K3JB 2OK6A 2B4EA 1SQJA 4PXWA 4O3TB 2AQ5A 4L1QD 4N14A 2H3XA 4OZUA 1L0QA 4UI9R 5FLXg 3ODTA 4J79A 3I2NA 2GC4A 5FA5B 3I89A 2I0TA 4A2MA 4PBYA 3JZHA 4XYHA 2OJYA 4IMMA 3IJ0A 3CFVA 3MMYA 4ESGA 1NR0A 3B7FA 2AH0A 2H9MA 4ZOVA 4AEZA 4BUJC 3C5MA 4O3UB 5EARA 3AH8B 4JSPC 2AGXA 2I0SA 3BWSA 4Z8LA 4CZVA 5FKTA 2O9KA 3ZWLB 2OVPB 4CY1A 2W18A 2XU7A 3SJLD 4E5ZB 3U4YA 3FM0A 3OW8A 3JZGA 5IJ8E 1OLZA 1MG3A 3RMZD 2OK4A 3SVWD 3VGZA 4R7AB 4E5ZA 1XKSA 4FA9D 4A2LA 4ZN4A 2AGYA 5CXBB 3GREA 3UKUC 4E54B 2H14A 3I8EA 3MZLA 4Y5RD 3E0CA 3ORVD 4J84A 5CXBA 3SMRA 4JXMA 3PXSD 4FWWA 4PNKB 4PSWB 3SXTD 4A7JA 4GM3A 4E54A 3PSCB 4ZOYA 4J73A 4J8GA 3SLED 3PVWB 3UR4A 2IUPA 3PSLA 4LG8A 5EMLB 4A09B 2BCJB 3P4FA 3F3FA 2IURA 5FKQA 3I7NA 4PC0A 1B9XA 4A09A 5C2VB 4HDJA 1N6FA 3L4MD 4O9DA 2YNOA 3DWLC 2PBIB 1PBYB 1SQ9A 5AMSA 5EAPA 3CIKB 3PXTD 4H5JA 5FKSA 4CI3A 5TDHB 2CO0C 4J77A 3IJ1A 3V7DB 3NVQA 5B4WA 4PBZA 3K26A 4A0BB 4NSXA 3RSEC 1VYHC 2CE9A 1TBGA 4XEIC 4BH6A 3RFHA 3AL8A 5EM2B 4JT6C 5H1MA 5H17A 3SBPA 1K32A 2J57G 2UZXB 4A11B 1NEXB 1GG2B 1XIPA 5HQGA 5GXHA 3W15A 4J8BA 1PGUA 4A11A 1JMXB 5KDOB 2HESX 4LG9A 3UKRC 2XL3A 3N0DA 2P9NC 2TRCB 1XHMA 1N6DA 3RRMC 2XL2A 2OVRB 4Y7RA 5HE1B 4FAVD 2EBSA 2H6KA 5GSAA 4D6VA 3I7PA 4G56B 4ZOZA 1P22A 5HE0B 5HE2B 3AL9A 3PVUB 4FB1D 4QL1A 3IIWA 4X60B 2UZYB 3SHFA 3SBQA 1MDAH 3OL2B 4A0AB 4QT8A 4J82A 2BBKH 4X3EA 5AFU3 4KFMB 4QQEA 3OL2A 3FGBA 4A0AA 1JOFA 3JPXA 2Z2OA 4GGAA 4H5IA 2AGWA 4L9OA 1JJUB 4ERZA 4U1EI 2GNQA 3EI4B 1R5MA 4CY5A 1QNIA 1N6EA 4CI2A 3I7KA 2Z2PA 4AOWA 2YNPA 2H47A 3EI4A 3N0EA 1MG2A 5FQDA 4GM8A 3DSMA 5I5MA 5IJ7E 2I3TA 3BG0A 3EI3B 1OMWB 4D0KA 2H9LA 2YMUA 3V5WB 2P9SC 3K27A 4L3GD 4CY2A 4LGNA 3DM0A 3EI3A 3OKYB 2QC5A 2J55H
chains in the Genus database with same CATH superfamily
5TEFA 5EMKB 4PSXB 2VC2A 2BKLA 3PXWD 2OVQB 3OKYA 4GQ2P 2MTAH 2HJBA 3IUQA 3A0FA 2CO0A 3OTTA 3C9CA 3MKSB 5GXIA 2H9NA 5A2Qg 2H6NA 5JWZA 5H14A 3MKQA 4YVDA 2H13A 5IT9g 3AFCA 1SHYB 1JMZB 4GMBA 3DXKC 4I79A 2AGZA 4GGCA 3JROA 1YFQA 2HXCA 4JSNC 4DNUA 4GQ1A 1ERJA 5CXCB 4BCDA 3EWEA 5EAMA 4AN0A 4J81A 2P9LC 2VDPA 2CN3A 1GP2B 5AJAA 4A0BA 5CXCA 2IWFA 2HU8A 4GQBB 5FXYA 2B5LA 4AMZA 2HYEA 4RE5A 2GC7A 4JT5C 2PM6B 3RLMD 4FA5D 4ES0A 5EM2A 3HFQA 5M61A 3MUNA 2Q7QA 3MXXA 4J0XA 5EALA 5GMKn 3GFCA 5K1CC 2VZ3A 3J80g 4ERQA 4A08B 3OKTA 2J56H 3K71A 2CN2A 5IGOA 4J78A 3DXMC 3IJCA 2I0RA 3NVXA 5K19A 4A08A 5SXMA 3KRXB 3RN1D 2IAAA 1GXRA 2YBAA 2VDLA 3BG1A 2XYIA 3UVLA 3SWSD 5M5TA 4MK0B 3RN0D 1GOFA 2WQ8A 5THAA 4X63B 4NBMA 2IWKA 4U7AA 2I3SA 3KRWB 2VDRA 2QR5A 4TZ4A 3SBRA 3SCYA 3EI1B 4MMYA 2CE8A 3I7HA 4FA1D 3UVMA 5M5UA 3I7LA 3SN6B 5FFGA 2P9UC 3DDUA 3ZDYA 4OWRA 4CI1A 4DNVA 1RI6A 3EI1A 1VZ3A 3NIGA 4O1QD 4EWRA 1A12A 1UTCA 2AGLA 4GZ8A 5E6UA 3VA6A 2HKMA 3IIYA 1BPOA 3I7OA 4CC9A 4CZYA 4K3ID 2G9AA 4FHLA 3IULA 4GGDA 3IUMA 2VDKA 2EIEA 4XYIA 3O4HA 2IUVA 3ULEC 2YNNA 4FA4D 4QRJA 4CY3A 2VDMA 3UVKA 1U4CA 5EMMB 1U2VC 3I8CA 2HU7A 3EI2B 3PE7A 2HJ4A 3JAMg 3C99A 3NIDA 3KCIA 3MZKA 3EG6A 4FAND 1Q47A 3ZDXA 3EI2A 1FWXA 4CZXA 5CYKB 2B5MA 5I5IA 4GM9A 3J81g 2H9PA 3EU7A 3MUOA 4ZOXA 5TF2A 5I5JA 3VH0A 3UVOA 2P9KC 3O4IA 5CYKA 4CI8A 2B5NA 1A0RB 4BP9A 4WJKA 5FKRA 3FRXA 3GD1I 5IC7A 3JZNA 2PM7B 4J86A 3UVNA 2PM9B 1E5TA 3EMHA 4MMZA 2G99A 3JB9L 3IKOA 4JSVC 3RFGA 1M1XA 3SFZA 2AH1A 2PM9A 3V9FA 2P9PC 3OKWA 2H68A 5EMJB 4O45A 4AN1A 2YB8B 4IRZA 1UOOA 3IJEA 5HYNB 3F3GA 3JRPA 2P9IC 1C9IA 4ERYA 2HKRA 3GC3B 2QXVA 3K6SA 2OIZA 1E8NA 1S4UX 1TYQC 2IUQA 4X61B 1C9LA 1K8KC 3NVNA 5M5SA 1GOTB 1O6FA 1B9YA 1PI6A 4JD2C 1K3IA 3C75H 4IA9A 5C2WB 2H6QA 5C9ZB 4L3HD 4BL0A 5IGQA 3F3PA 4J0WA 2CNXA 3AL8B 5HE3B 1UOPA 4JSXC 5FFOA 5TEEA 2Z2NA 4J87A 1PEVA 3CFSB 3L4OD 4AX4A 4K3JB 2OK6A 2VDQA 2B4EA 1SQJA 3MVDK 4PXWA 4O3TB 2AQ5A 4L1QD 4N14A 2H3XA 4OZUA 1L0QA 4UI9R 5FLXg 3ODTA 4J79A 3I2NA 2GC4A 4WK2A 5FA5B 3I89A 2I0TA 4A2MA 4PBYA 3JZHA 4XYHA 4BCCA 2OJYA 1JTDB 4IMMA 4UM8A 3IJ0A 2EIDA 3CFVA 3MMYA 1QFMA 4ESGA 4Z7OA 1NR0A 3B7FA 1QFSA 3EQ9A 2AH0A 2H9MA 4ZOVA 4AEZA 1E8MA 4BUJC 3C5MA 4O3UB 5C92A 5EARA 3AH8B 4JSPC 2AGXA 2I0SA 5M5RA 3BWSA 4Z8LA 4L1MA 4CZVA 3V4PA 3QI0A 5FKTA 2O9KA 3ZWLB 3ZE2A 2OVPB 4G55A 5M5VA 4Z7QA 4CY1A 2W18A 2XU7A 3SJLD 3EQ7A 4E5ZB 2VDOA 3U4YA 3FM0A 5E6SA 3OW8A 4MMXA 2XZGA 3JZGA 5IJ8E 1OLZA 1MG3A 3RMZD 2OK4A 3SVWD 3T3PA 3VGZA 4R7AB 4E5ZA 2HU5A 1XKSA 1GOGA 4FA9D 4A2LA 4ZN4A 2AGYA 5CXBB 3GREA 3FCUA 3UKUC 4E54B 2H14A 3I8EA 3MZLA 4Y5RD 3E0CA 3ORVD 4J84A 5CXBA 3SMRA 3IUJA 4JXMA 3PXSD 4FWWA 4PNKB 4PSWB 3SXTD 4A7JA 4GM3A 4E54A 3QHYB 3PSCB 4ZOYA 4J73A 4J8GA 3SLED 4QAMA 3PVWB 4NC4A 2QZPA 3UR4A 2IUPA 4NENA 3PSLA 4LG8A 5EMLB 4A09B 2BCJB 3P4FA 2VDNA 3F3FA 2IURA 4NAAA 5FKQA 2XDWA 3I7NA 4PC0A 3T3MA 3VI3A 1B9XA 4JHPC 4A09A 5C2VB 5C86A 4HDJA 1N6FA 3L4MD 4O9DA 3O4GA 2YNOA 3DWLC 1YR2A 4Z7NA 2PBIB 1PBYB 1SQ9A 5AMSA 5EAPA 3CIKB 3ZDZA 4BP8A 3PXTD 4JHNA 4H5JA 5FKSA 5HDBA 4CI3A 5TDHB 2CO0C 4J77A 2VZ1A 3IJ1A 3V7DB 3EQ8A 3NVQA 1L5GA 3V4VA 5B4WA 4PBZA 3K26A 4A0BB 4NSXA 4WK0A 3RSEC 4UM9A 1VYHC 2CE9A 1TBGA 4XEIC 4BH6A 3RFHA 1VZ2A 3AL8A 5EM2B 4JT6C 5H1MA 5H17A 3SBPA 1K32A 4D9SA 1U8CA 2J57G 1TYEA 2UZXB 4A11B 1NEXB 1GG2B 1XIPA 4RE6A 5HQGA 5GXHA 3W15A 1JV2A 4J8BA 4BCBA 1H2ZA 3IUNA 1PGUA 4A11A 1JMXB 5KDOB 4O2WA 2HESX 4LG9A 3UKRC 2XL3A 3N0DA 4AMYA 2JKXA 2P9NC 2TRCB 1XHMA 1N6DA 3RRMC 1VE7A 2EIBA 2XL2A 2OVRB 4Y7RA 5HE1B 3OF7A 4FAVD 2EBSA 2H6KA 5GSAA 4D6VA 3VI4A 3I7PA 4DNWA 4G56B 1VE6A 4ZOZA 1H2WA 1P22A 5HE0B 3K72A 5HE2B 3AL9A 3PVUB 4FB1D 4QL1A 3IIWA 4X60B 2UZYB 3SHFA 3SBQA 1MDAH 3OL2B 4A0AB 3FCSA 4QT8A 3O4JA 3IURA 4J82A 2BBKH 4X3EA 4WK4A 5AFU3 4KFMB 4QQEA 1H2YA 3OL2A 3FGBA 4A0AA 3ZE1A 1JOFA 4G1EA 1T2XA 3JPXA 2Z2OA 4GGAA 4H5IA 2AGWA 4L9OA 1H2XA 1JJUB 4ERZA 4U1EI 2GNQA 3EI4B 3IVMA 1R5MA 4CY5A 2XE4A 1QNIA 1N6EA 2EICA 1UOQA 4CI2A 1I2MB 3I7KA 2Z2PA 4AOWA 2YNPA 2H47A 3EI4A 3N0EA 3ZE0A 1MG2A 1O6GA 5FQDA 4GM8A 3DSMA 4G1MA 5I5MA 5IJ7E 2I3TA 3BG0A 3EI3B 1OMWB 4D0KA 2H9LA 2YMUA 3V5WB 2P9SC 3K27A 4L3GD 5E6RA 4O02A 3NIFA 4LGNA 1GOHA 3DM0A 4CY2A 3EI3A 3OKYB 2QC5A 2J55H
chains in the Genus database with same CATH topology
5TEFA 5EMKB 4PSXB 3PXWD 2OVQB 3OKYA 4GQ2P 2MTAH 2HJBA 3A0FA 2CO0A 3OTTA 3C9CA 3MKSB 5GXIA 2H9NA 5A2Qg 2H6NA 5JWZA 5H14A 3MKQA 4YVDA 2H13A 5IT9g 3AFCA 1SHYB 1JMZB 4GMBA 3DXKC 4I79A 2AGZA 4GGCA 3JROA 1YFQA 2HXCA 4JSNC 4GQ1A 1ERJA 5CXCB 3EWEA 5EAMA 4J81A 2P9LC 2CN3A 1GP2B 5AJAA 4A0BA 5CXCA 2IWFA 4GQBB 5FXYA 2B5LA 2HYEA 2GC7A 4JT5C 2PM6B 3RLMD 4FA5D 4ES0A 5EM2A 3HFQA 2Q7QA 3MXXA 4J0XA 5EALA 5GMKn 3GFCA 5K1CC 3J80g 4ERQA 4A08B 3OKTA 2J56H 2CN2A 5IGOA 4J78A 3DXMC 3IJCA 2I0RA 3NVXA 5K19A 4A08A 5SXMA 3KRXB 3RN1D 2IAAA 1GXRA 2YBAA 3BG1A 2XYIA 3UVLA 3SWSD 4MK0B 3RN0D 5THAA 4X63B 2IWKA 4U7AA 2I3SA 3KRWB 4TZ4A 3SBRA 3SCYA 3EI1B 2CE8A 3I7HA 4FA1D 3UVMA 3I7LA 3SN6B 2P9UC 4OWRA 4CI1A 1RI6A 3EI1A 4O1QD 4EWRA 2AGLA 4GZ8A 3VA6A 2HKMA 3IIYA 3I7OA 4CC9A 4CZYA 4K3ID 2G9AA 4FHLA 4GGDA 4XYIA 2IUVA 3ULEC 2YNNA 4FA4D 4QRJA 4CY3A 3UVKA 1U4CA 5EMMB 1U2VC 3I8CA 3EI2B 3PE7A 2HJ4A 3JAMg 3C99A 3MZKA 3EG6A 4FAND 1Q47A 3EI2A 1FWXA 4CZXA 5CYKB 2B5MA 5I5IA 4GM9A 3J81g 2H9PA 3EU7A 4ZOXA 5TF2A 5I5JA 3VH0A 3UVOA 2P9KC 5CYKA 4CI8A 2B5NA 1A0RB 5FKRA 3FRXA 5IC7A 3JZNA 2PM7B 4J86A 3UVNA 2PM9B 3EMHA 2G99A 3JB9L 3IKOA 4JSVC 3RFGA 3SFZA 2AH1A 2PM9A 3V9FA 2P9PC 3OKWA 2H68A 5EMJB 4O45A 2YB8B 5HYNB 3F3GA 3JRPA 2P9IC 4ERYA 2HKRA 2QXVA 2OIZA 4X61B 1S4UX 1TYQC 2IUQA 1K8KC 3NVNA 1GOTB 1B9YA 1PI6A 4JD2C 4IA9A 3C75H 5C2WB 2H6QA 5C9ZB 4L3HD 4BL0A 5IGQA 3F3PA 4J0WA 2CNXA 3AL8B 5HE3B 4JSXC 5TEEA 2Z2NA 4J87A 1PEVA 3CFSB 3L4OD 4K3JB 2OK6A 2B4EA 1SQJA 4PXWA 4O3TB 2AQ5A 4L1QD 4N14A 2H3XA 4OZUA 1L0QA 4UI9R 5FLXg 3ODTA 4J79A 3I2NA 2GC4A 5FA5B 3I89A 2I0TA 4A2MA 4PBYA 3JZHA 4XYHA 2OJYA 4IMMA 3IJ0A 3CFVA 3MMYA 4ESGA 1NR0A 3B7FA 2AH0A 2H9MA 4ZOVA 4AEZA 4BUJC 3C5MA 4O3UB 5EARA 3AH8B 4JSPC 2AGXA 2I0SA 3BWSA 4Z8LA 4CZVA 5FKTA 2O9KA 3ZWLB 2OVPB 4CY1A 2W18A 2XU7A 3SJLD 4E5ZB 3U4YA 3FM0A 3OW8A 3JZGA 5IJ8E 1OLZA 1MG3A 3RMZD 2OK4A 3SVWD 3VGZA 4R7AB 4E5ZA 1XKSA 4FA9D 4A2LA 4ZN4A 2AGYA 5CXBB 3GREA 3UKUC 4E54B 2H14A 3I8EA 3MZLA 4Y5RD 3E0CA 3ORVD 4J84A 5CXBA 3SMRA 4JXMA 3PXSD 4FWWA 4PNKB 4PSWB 3SXTD 4A7JA 4GM3A 4E54A 3PSCB 4ZOYA 4J73A 4J8GA 3SLED 3PVWB 3UR4A 2IUPA 3PSLA 4LG8A 5EMLB 4A09B 2BCJB 3P4FA 3F3FA 2IURA 5FKQA 3I7NA 4PC0A 1B9XA 4A09A 5C2VB 4HDJA 1N6FA 3L4MD 4O9DA 2YNOA 3DWLC 2PBIB 1PBYB 1SQ9A 5AMSA 5EAPA 3CIKB 3PXTD 4H5JA 5FKSA 4CI3A 5TDHB 2CO0C 4J77A 3IJ1A 3V7DB 3NVQA 5B4WA 4PBZA 3K26A 4A0BB 4NSXA 3RSEC 1VYHC 2CE9A 1TBGA 4XEIC 4BH6A 3RFHA 3AL8A 5EM2B 4JT6C 5H1MA 5H17A 3SBPA 1K32A 2J57G 2UZXB 4A11B 1NEXB 1GG2B 1XIPA 5HQGA 5GXHA 3W15A 4J8BA 1PGUA 4A11A 1JMXB 5KDOB 2HESX 4LG9A 3UKRC 2XL3A 3N0DA 2P9NC 2TRCB 1XHMA 1N6DA 3RRMC 2XL2A 2OVRB 4Y7RA 5HE1B 4FAVD 2EBSA 2H6KA 5GSAA 4D6VA 3I7PA 4G56B 4ZOZA 1P22A 5HE0B 5HE2B 3AL9A 3PVUB 4FB1D 4QL1A 3IIWA 4X60B 2UZYB 3SHFA 3SBQA 1MDAH 3OL2B 4A0AB 4QT8A 4J82A 2BBKH 4X3EA 5AFU3 4KFMB 4QQEA 3OL2A 3FGBA 4A0AA 1JOFA 3JPXA 2Z2OA 4GGAA 4H5IA 2AGWA 4L9OA 1JJUB 4ERZA 4U1EI 2GNQA 3EI4B 1R5MA 4CY5A 1QNIA 1N6EA 4CI2A 3I7KA 2Z2PA 4AOWA 2YNPA 2H47A 3EI4A 3N0EA 1MG2A 5FQDA 4GM8A 3DSMA 5I5MA 5IJ7E 2I3TA 3BG0A 3EI3B 1OMWB 4D0KA 2H9LA 2YMUA 3V5WB 2P9SC 3K27A 4L3GD 4CY2A 4LGNA 3DM0A 3EI3A 3OKYB 2QC5A 2J55H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TEF A;  5EMK B;  4PSX B;  3PXW D;  2OVQ B;  3OKY A;  4GQ2 P;  2MTA H;  2HJB A;  3A0F A;  2CO0 A;  3OTT A;  3C9C A;  3MKS B;  5GXI A;  2H9N A;  5A2Q g;  2H6N A;  5JWZ A;  5H14 A;  3MKQ A;  4YVD A;  2H13 A;  5IT9 g;  3AFC A;  1SHY B;  1JMZ B;  4GMB A;  3DXK C;  4I79 A;  2AGZ A;  4GGC A;  3JRO A;  1YFQ A;  2HXC A;  4JSN C;  4GQ1 A;  1ERJ A;  5CXC B;  3EWE A;  5EAM A;  4J81 A;  2P9L C;  2CN3 A;  1GP2 B;  5AJA A;  4A0B A;  5CXC A;  2IWF A;  4GQB B;  5FXY A;  2B5L A;  2HYE A;  2GC7 A;  4JT5 C;  2PM6 B;  3RLM D;  4FA5 D;  4ES0 A;  5EM2 A;  3HFQ A;  2Q7Q A;  3MXX A;  4J0X A;  5EAL A;  5GMK n;  3GFC A;  5K1C C;  3J80 g;  4ERQ A;  4A08 B;  3OKT A;  2J56 H;  2CN2 A;  5IGO A;  4J78 A;  3DXM C;  3IJC A;  2I0R A;  3NVX A;  5K19 A;  4A08 A;  5SXM A;  3KRX B;  3RN1 D;  2IAA A;  1GXR A;  2YBA A;  3BG1 A;  2XYI A;  3UVL A;  3SWS D;  4MK0 B;  3RN0 D;  5THA A;  4X63 B;  2IWK A;  4U7A A;  2I3S A;  3KRW B;  4TZ4 A;  3SBR A;  3SCY A;  3EI1 B;  2CE8 A;  3I7H A;  4FA1 D;  3UVM A;  3I7L A;  3SN6 B;  2P9U C;  4OWR A;  4CI1 A;  1RI6 A;  3EI1 A;  4O1Q D;  4EWR A;  2AGL A;  4GZ8 A;  3VA6 A;  2HKM A;  3IIY A;  3I7O A;  4CC9 A;  4CZY A;  4K3I D;  2G9A A;  4FHL A;  4GGD A;  4XYI A;  2IUV A;  3ULE C;  2YNN A;  4FA4 D;  4QRJ A;  4CY3 A;  3UVK A;  1U4C A;  5EMM B;  1U2V C;  3I8C A;  3EI2 B;  3PE7 A;  2HJ4 A;  3JAM g;  3C99 A;  3MZK A;  3EG6 A;  4FAN D;  1Q47 A;  3EI2 A;  1FWX A;  4CZX A;  5CYK B;  2B5M A;  5I5I A;  4GM9 A;  3J81 g;  2H9P A;  3EU7 A;  4ZOX A;  5TF2 A;  5I5J A;  3VH0 A;  3UVO A;  2P9K C;  5CYK A;  4CI8 A;  2B5N A;  1A0R B;  5FKR A;  3FRX A;  5IC7 A;  3JZN A;  2PM7 B;  4J86 A;  3UVN A;  2PM9 B;  3EMH A;  2G99 A;  3JB9 L;  3IKO A;  4JSV C;  3RFG A;  3SFZ A;  2AH1 A;  2PM9 A;  3V9F A;  2P9P C;  3OKW A;  2H68 A;  5EMJ B;  4O45 A;  2YB8 B;  5HYN B;  3F3G A;  3JRP A;  2P9I C;  4ERY A;  2HKR A;  2QXV A;  2OIZ A;  4X61 B;  1S4U X;  1TYQ C;  2IUQ A;  1K8K C;  3NVN A;  1GOT B;  1B9Y A;  1PI6 A;  4JD2 C;  4IA9 A;  3C75 H;  5C2W B;  2H6Q A;  5C9Z B;  4L3H D;  4BL0 A;  5IGQ A;  3F3P A;  4J0W A;  2CNX A;  3AL8 B;  5HE3 B;  4JSX C;  5TEE A;  2Z2N A;  4J87 A;  1PEV A;  3CFS B;  3L4O D;  4K3J B;  2OK6 A;  2B4E A;  1SQJ A;  4PXW A;  4O3T B;  2AQ5 A;  4L1Q D;  4N14 A;  2H3X A;  4OZU A;  1L0Q A;  4UI9 R;  5FLX g;  3ODT A;  4J79 A;  3I2N A;  2GC4 A;  5FA5 B;  3I89 A;  2I0T A;  4A2M A;  4PBY A;  3JZH A;  4XYH A;  2OJY A;  4IMM A;  3IJ0 A;  3CFV A;  3MMY A;  4ESG A;  1NR0 A;  3B7F A;  2AH0 A;  2H9M A;  4ZOV A;  4AEZ A;  4BUJ C;  3C5M A;  4O3U B;  5EAR A;  3AH8 B;  4JSP C;  2AGX A;  2I0S A;  3BWS A;  4Z8L A;  4CZV A;  5FKT A;  2O9K A;  3ZWL B;  2OVP B;  4CY1 A;  2W18 A;  2XU7 A;  3SJL D;  4E5Z B;  3U4Y A;  3FM0 A;  3OW8 A;  3JZG A;  5IJ8 E;  1OLZ A;  1MG3 A;  3RMZ D;  2OK4 A;  3SVW D;  3VGZ A;  4R7A B;  4E5Z A;  1XKS A;  4FA9 D;  4A2L A;  4ZN4 A;  2AGY A;  5CXB B;  3GRE A;  3UKU C;  4E54 B;  2H14 A;  3I8E A;  3MZL A;  4Y5R D;  3E0C A;  3ORV D;  4J84 A;  5CXB A;  3SMR A;  4JXM A;  3PXS D;  4FWW A;  4PNK B;  4PSW B;  3SXT D;  4A7J A;  4GM3 A;  4E54 A;  3PSC B;  4ZOY A;  4J73 A;  4J8G A;  3SLE D;  3PVW B;  3UR4 A;  2IUP A;  3PSL A;  4LG8 A;  5EML B;  4A09 B;  2BCJ B;  3P4F A;  3F3F A;  2IUR A;  5FKQ A;  3I7N A;  4PC0 A;  1B9X A;  4A09 A;  5C2V B;  4HDJ A;  1N6F A;  3L4M D;  4O9D A;  2YNO A;  3DWL C;  2PBI B;  1PBY B;  1SQ9 A;  5AMS A;  5EAP A;  3CIK B;  3PXT D;  4H5J A;  5FKS A;  4CI3 A;  5TDH B;  2CO0 C;  4J77 A;  3IJ1 A;  3V7D B;  3NVQ A;  5B4W A;  4PBZ A;  3K26 A;  4A0B B;  4NSX A;  3RSE C;  1VYH C;  2CE9 A;  1TBG A;  4XEI C;  4BH6 A;  3RFH A;  3AL8 A;  5EM2 B;  4JT6 C;  5H1M A;  5H17 A;  3SBP A;  1K32 A;  2J57 G;  2UZX B;  4A11 B;  1NEX B;  1GG2 B;  1XIP A;  5HQG A;  5GXH A;  3W15 A;  4J8B A;  1PGU A;  4A11 A;  1JMX B;  5KDO B;  2HES X;  4LG9 A;  3UKR C;  2XL3 A;  3N0D A;  2P9N C;  2TRC B;  1XHM A;  1N6D A;  3RRM C;  2XL2 A;  2OVR B;  4Y7R A;  5HE1 B;  4FAV D;  2EBS A;  2H6K A;  5GSA A;  4D6V A;  3I7P A;  4G56 B;  4ZOZ A;  1P22 A;  5HE0 B;  5HE2 B;  3AL9 A;  3PVU B;  4FB1 D;  4QL1 A;  3IIW A;  4X60 B;  2UZY B;  3SHF A;  3SBQ A;  1MDA H;  3OL2 B;  4A0A B;  4QT8 A;  4J82 A;  2BBK H;  4X3E A;  5AFU 3;  4KFM B;  4QQE A;  3OL2 A;  3FGB A;  4A0A A;  1JOF A;  3JPX A;  2Z2O A;  4GGA A;  4H5I A;  2AGW A;  4L9O A;  1JJU B;  4ERZ A;  4U1E I;  2GNQ A;  3EI4 B;  1R5M A;  4CY5 A;  1QNI A;  1N6E A;  4CI2 A;  3I7K A;  2Z2P A;  4AOW A;  2YNP A;  2H47 A;  3EI4 A;  3N0E A;  1MG2 A;  5FQD A;  4GM8 A;  3DSM A;  5I5M A;  5IJ7 E;  2I3T A;  3BG0 A;  3EI3 B;  1OMW B;  4D0K A;  2H9L A;  2YMU A;  3V5W B;  2P9S C;  3K27 A;  4L3G D;  4CY2 A;  4LGN A;  3DM0 A;  3EI3 A;  3OKY B;  2QC5 A;  2J55 H; 
#chains in the Genus database with same CATH topology
 5TEF A;  5EMK B;  4PSX B;  2VC2 A;  2BKL A;  3PXW D;  2OVQ B;  3OKY A;  4GQ2 P;  2MTA H;  2HJB A;  3IUQ A;  3A0F A;  2CO0 A;  3OTT A;  3C9C A;  3MKS B;  5GXI A;  2H9N A;  5A2Q g;  2H6N A;  5JWZ A;  5H14 A;  3MKQ A;  4YVD A;  2H13 A;  5IT9 g;  3AFC A;  1SHY B;  1JMZ B;  4GMB A;  3DXK C;  4I79 A;  2AGZ A;  4GGC A;  3JRO A;  1YFQ A;  2HXC A;  4JSN C;  4DNU A;  4GQ1 A;  1ERJ A;  5CXC B;  4BCD A;  3EWE A;  5EAM A;  4AN0 A;  4J81 A;  2P9L C;  2VDP A;  2CN3 A;  1GP2 B;  5AJA A;  4A0B A;  5CXC A;  2IWF A;  2HU8 A;  4GQB B;  5FXY A;  2B5L A;  4AMZ A;  2HYE A;  4RE5 A;  2GC7 A;  4JT5 C;  2PM6 B;  3RLM D;  4FA5 D;  4ES0 A;  5EM2 A;  3HFQ A;  5M61 A;  3MUN A;  2Q7Q A;  3MXX A;  4J0X A;  5EAL A;  5GMK n;  3GFC A;  5K1C C;  2VZ3 A;  3J80 g;  4ERQ A;  4A08 B;  3OKT A;  2J56 H;  3K71 A;  2CN2 A;  5IGO A;  4J78 A;  3DXM C;  3IJC A;  2I0R A;  3NVX A;  5K19 A;  4A08 A;  5SXM A;  3KRX B;  3RN1 D;  2IAA A;  1GXR A;  2YBA A;  2VDL A;  3BG1 A;  2XYI A;  3UVL A;  3SWS D;  5M5T A;  4MK0 B;  3RN0 D;  1GOF A;  2WQ8 A;  5THA A;  4X63 B;  4NBM A;  2IWK A;  4U7A A;  2I3S A;  3KRW B;  2VDR A;  2QR5 A;  4TZ4 A;  3SBR A;  3SCY A;  3EI1 B;  4MMY A;  2CE8 A;  3I7H A;  4FA1 D;  3UVM A;  5M5U A;  3I7L A;  3SN6 B;  5FFG A;  2P9U C;  3DDU A;  3ZDY A;  4OWR A;  4CI1 A;  4DNV A;  1RI6 A;  3EI1 A;  1VZ3 A;  3NIG A;  4O1Q D;  4EWR A;  1A12 A;  1UTC A;  2AGL A;  4GZ8 A;  5E6U A;  3VA6 A;  2HKM A;  3IIY A;  1BPO A;  3I7O A;  4CC9 A;  4CZY A;  4K3I D;  2G9A A;  4FHL A;  3IUL A;  4GGD A;  3IUM A;  2VDK A;  2EIE A;  4XYI A;  3O4H A;  2IUV A;  3ULE C;  2YNN A;  4FA4 D;  4QRJ A;  4CY3 A;  2VDM A;  3UVK A;  1U4C A;  5EMM B;  1U2V C;  3I8C A;  2HU7 A;  3EI2 B;  3PE7 A;  2HJ4 A;  3JAM g;  3C99 A;  3NID A;  3KCI A;  3MZK A;  3EG6 A;  4FAN D;  1Q47 A;  3ZDX A;  3EI2 A;  1FWX A;  4CZX A;  5CYK B;  2B5M A;  5I5I A;  4GM9 A;  3J81 g;  2H9P A;  3EU7 A;  3MUO A;  4ZOX A;  5TF2 A;  5I5J A;  3VH0 A;  3UVO A;  2P9K C;  3O4I A;  5CYK A;  4CI8 A;  2B5N A;  1A0R B;  4BP9 A;  4WJK A;  5FKR A;  3FRX A;  3GD1 I;  5IC7 A;  3JZN A;  2PM7 B;  4J86 A;  3UVN A;  2PM9 B;  1E5T A;  3EMH A;  4MMZ A;  2G99 A;  3JB9 L;  3IKO A;  4JSV C;  3RFG A;  1M1X A;  3SFZ A;  2AH1 A;  2PM9 A;  3V9F A;  2P9P C;  3OKW A;  2H68 A;  5EMJ B;  4O45 A;  4AN1 A;  2YB8 B;  4IRZ A;  1UOO A;  3IJE A;  5HYN B;  3F3G A;  3JRP A;  2P9I C;  1C9I A;  4ERY A;  2HKR A;  3GC3 B;  2QXV A;  3K6S A;  2OIZ A;  1E8N A;  1S4U X;  1TYQ C;  2IUQ A;  4X61 B;  1C9L A;  1K8K C;  3NVN A;  5M5S A;  1GOT B;  1O6F A;  1B9Y A;  1PI6 A;  4JD2 C;  1K3I A;  3C75 H;  4IA9 A;  5C2W B;  2H6Q A;  5C9Z B;  4L3H D;  4BL0 A;  5IGQ A;  3F3P A;  4J0W A;  2CNX A;  3AL8 B;  5HE3 B;  1UOP A;  4JSX C;  5FFO A;  5TEE A;  2Z2N A;  4J87 A;  1PEV A;  3CFS B;  3L4O D;  4AX4 A;  4K3J B;  2OK6 A;  2VDQ A;  2B4E A;  1SQJ A;  3MVD K;  4PXW A;  4O3T B;  2AQ5 A;  4L1Q D;  4N14 A;  2H3X A;  4OZU A;  1L0Q A;  4UI9 R;  5FLX g;  3ODT A;  4J79 A;  3I2N A;  2GC4 A;  4WK2 A;  5FA5 B;  3I89 A;  2I0T A;  4A2M A;  4PBY A;  3JZH A;  4XYH A;  4BCC A;  2OJY A;  1JTD B;  4IMM A;  4UM8 A;  3IJ0 A;  2EID A;  3CFV A;  3MMY A;  1QFM A;  4ESG A;  4Z7O A;  1NR0 A;  3B7F A;  1QFS A;  3EQ9 A;  2AH0 A;  2H9M A;  4ZOV A;  4AEZ A;  1E8M A;  4BUJ C;  3C5M A;  4O3U B;  5C92 A;  5EAR A;  3AH8 B;  4JSP C;  2AGX A;  2I0S A;  5M5R A;  3BWS A;  4Z8L A;  4L1M A;  4CZV A;  3V4P A;  3QI0 A;  5FKT A;  2O9K A;  3ZWL B;  3ZE2 A;  2OVP B;  4G55 A;  5M5V A;  4Z7Q A;  4CY1 A;  2W18 A;  2XU7 A;  3SJL D;  3EQ7 A;  4E5Z B;  2VDO A;  3U4Y A;  3FM0 A;  5E6S A;  3OW8 A;  4MMX A;  2XZG A;  3JZG A;  5IJ8 E;  1OLZ A;  1MG3 A;  3RMZ D;  2OK4 A;  3SVW D;  3T3P A;  3VGZ A;  4R7A B;  4E5Z A;  2HU5 A;  1XKS A;  1GOG A;  4FA9 D;  4A2L A;  4ZN4 A;  2AGY A;  5CXB B;  3GRE A;  3FCU A;  3UKU C;  4E54 B;  2H14 A;  3I8E A;  3MZL A;  4Y5R D;  3E0C A;  3ORV D;  4J84 A;  5CXB A;  3SMR A;  3IUJ A;  4JXM A;  3PXS D;  4FWW A;  4PNK B;  4PSW B;  3SXT D;  4A7J A;  4GM3 A;  4E54 A;  3QHY B;  3PSC B;  4ZOY A;  4J73 A;  4J8G A;  3SLE D;  4QAM A;  3PVW B;  4NC4 A;  2QZP A;  3UR4 A;  2IUP A;  4NEN A;  3PSL A;  4LG8 A;  5EML B;  4A09 B;  2BCJ B;  3P4F A;  2VDN A;  3F3F A;  2IUR A;  4NAA A;  5FKQ A;  2XDW A;  3I7N A;  4PC0 A;  3T3M A;  3VI3 A;  1B9X A;  4JHP C;  4A09 A;  5C2V B;  5C86 A;  4HDJ A;  1N6F A;  3L4M D;  4O9D A;  3O4G A;  2YNO A;  3DWL C;  1YR2 A;  4Z7N A;  2PBI B;  1PBY B;  1SQ9 A;  5AMS A;  5EAP A;  3CIK B;  3ZDZ A;  4BP8 A;  3PXT D;  4JHN A;  4H5J A;  5FKS A;  5HDB A;  4CI3 A;  5TDH B;  2CO0 C;  4J77 A;  2VZ1 A;  3IJ1 A;  3V7D B;  3EQ8 A;  3NVQ A;  1L5G A;  3V4V A;  5B4W A;  4PBZ A;  3K26 A;  4A0B B;  4NSX A;  4WK0 A;  3RSE C;  4UM9 A;  1VYH C;  2CE9 A;  1TBG A;  4XEI C;  4BH6 A;  3RFH A;  1VZ2 A;  3AL8 A;  5EM2 B;  4JT6 C;  5H1M A;  5H17 A;  3SBP A;  1K32 A;  4D9S A;  1U8C A;  2J57 G;  1TYE A;  2UZX B;  4A11 B;  1NEX B;  1GG2 B;  1XIP A;  4RE6 A;  5HQG A;  5GXH A;  3W15 A;  1JV2 A;  4J8B A;  4BCB A;  1H2Z A;  3IUN A;  1PGU A;  4A11 A;  1JMX B;  5KDO B;  4O2W A;  2HES X;  4LG9 A;  3UKR C;  2XL3 A;  3N0D A;  4AMY A;  2JKX A;  2P9N C;  2TRC B;  1XHM A;  1N6D A;  3RRM C;  1VE7 A;  2EIB A;  2XL2 A;  2OVR B;  4Y7R A;  5HE1 B;  3OF7 A;  4FAV D;  2EBS A;  2H6K A;  5GSA A;  4D6V A;  3VI4 A;  3I7P A;  4DNW A;  4G56 B;  1VE6 A;  4ZOZ A;  1H2W A;  1P22 A;  5HE0 B;  3K72 A;  5HE2 B;  3AL9 A;  3PVU B;  4FB1 D;  4QL1 A;  3IIW A;  4X60 B;  2UZY B;  3SHF A;  3SBQ A;  1MDA H;  3OL2 B;  4A0A B;  3FCS A;  4QT8 A;  3O4J A;  3IUR A;  4J82 A;  2BBK H;  4X3E A;  4WK4 A;  5AFU 3;  4KFM B;  4QQE A;  1H2Y A;  3OL2 A;  3FGB A;  4A0A A;  3ZE1 A;  1JOF A;  4G1E A;  1T2X A;  3JPX A;  2Z2O A;  4GGA A;  4H5I A;  2AGW A;  4L9O A;  1H2X A;  1JJU B;  4ERZ A;  4U1E I;  2GNQ A;  3EI4 B;  3IVM A;  1R5M A;  4CY5 A;  2XE4 A;  1QNI A;  1N6E A;  2EIC A;  1UOQ A;  4CI2 A;  1I2M B;  3I7K A;  2Z2P A;  4AOW A;  2YNP A;  2H47 A;  3EI4 A;  3N0E A;  3ZE0 A;  1MG2 A;  1O6G A;  5FQD A;  4GM8 A;  3DSM A;  4G1M A;  5I5M A;  5IJ7 E;  2I3T A;  3BG0 A;  3EI3 B;  1OMW B;  4D0K A;  2H9L A;  2YMU A;  3V5W B;  2P9S C;  3K27 A;  4L3G D;  5E6R A;  4O02 A;  3NIF A;  4LGN A;  1GOH A;  3DM0 A;  4CY2 A;  3EI3 A;  3OKY B;  2QC5 A;  2J55 H; 
#chains in the Genus database with same CATH homology
 5TEF A;  5EMK B;  4PSX B;  3PXW D;  2OVQ B;  3OKY A;  4GQ2 P;  2MTA H;  2HJB A;  3A0F A;  2CO0 A;  3OTT A;  3C9C A;  3MKS B;  5GXI A;  2H9N A;  5A2Q g;  2H6N A;  5JWZ A;  5H14 A;  3MKQ A;  4YVD A;  2H13 A;  5IT9 g;  3AFC A;  1SHY B;  1JMZ B;  4GMB A;  3DXK C;  4I79 A;  2AGZ A;  4GGC A;  3JRO A;  1YFQ A;  2HXC A;  4JSN C;  4GQ1 A;  1ERJ A;  5CXC B;  3EWE A;  5EAM A;  4J81 A;  2P9L C;  2CN3 A;  1GP2 B;  5AJA A;  4A0B A;  5CXC A;  2IWF A;  4GQB B;  5FXY A;  2B5L A;  2HYE A;  2GC7 A;  4JT5 C;  2PM6 B;  3RLM D;  4FA5 D;  4ES0 A;  5EM2 A;  3HFQ A;  2Q7Q A;  3MXX A;  4J0X A;  5EAL A;  5GMK n;  3GFC A;  5K1C C;  3J80 g;  4ERQ A;  4A08 B;  3OKT A;  2J56 H;  2CN2 A;  5IGO A;  4J78 A;  3DXM C;  3IJC A;  2I0R A;  3NVX A;  5K19 A;  4A08 A;  5SXM A;  3KRX B;  3RN1 D;  2IAA A;  1GXR A;  2YBA A;  3BG1 A;  2XYI A;  3UVL A;  3SWS D;  4MK0 B;  3RN0 D;  5THA A;  4X63 B;  2IWK A;  4U7A A;  2I3S A;  3KRW B;  4TZ4 A;  3SBR A;  3SCY A;  3EI1 B;  2CE8 A;  3I7H A;  4FA1 D;  3UVM A;  3I7L A;  3SN6 B;  2P9U C;  4OWR A;  4CI1 A;  1RI6 A;  3EI1 A;  4O1Q D;  4EWR A;  2AGL A;  4GZ8 A;  3VA6 A;  2HKM A;  3IIY A;  3I7O A;  4CC9 A;  4CZY A;  4K3I D;  2G9A A;  4FHL A;  4GGD A;  4XYI A;  2IUV A;  3ULE C;  2YNN A;  4FA4 D;  4QRJ A;  4CY3 A;  3UVK A;  1U4C A;  5EMM B;  1U2V C;  3I8C A;  3EI2 B;  3PE7 A;  2HJ4 A;  3JAM g;  3C99 A;  3MZK A;  3EG6 A;  4FAN D;  1Q47 A;  3EI2 A;  1FWX A;  4CZX A;  5CYK B;  2B5M A;  5I5I A;  4GM9 A;  3J81 g;  2H9P A;  3EU7 A;  4ZOX A;  5TF2 A;  5I5J A;  3VH0 A;  3UVO A;  2P9K C;  5CYK A;  4CI8 A;  2B5N A;  1A0R B;  5FKR A;  3FRX A;  5IC7 A;  3JZN A;  2PM7 B;  4J86 A;  3UVN A;  2PM9 B;  3EMH A;  2G99 A;  3JB9 L;  3IKO A;  4JSV C;  3RFG A;  3SFZ A;  2AH1 A;  2PM9 A;  3V9F A;  2P9P C;  3OKW A;  2H68 A;  5EMJ B;  4O45 A;  2YB8 B;  5HYN B;  3F3G A;  3JRP A;  2P9I C;  4ERY A;  2HKR A;  2QXV A;  2OIZ A;  4X61 B;  1S4U X;  1TYQ C;  2IUQ A;  1K8K C;  3NVN A;  1GOT B;  1B9Y A;  1PI6 A;  4JD2 C;  4IA9 A;  3C75 H;  5C2W B;  2H6Q A;  5C9Z B;  4L3H D;  4BL0 A;  5IGQ A;  3F3P A;  4J0W A;  2CNX A;  3AL8 B;  5HE3 B;  4JSX C;  5TEE A;  2Z2N A;  4J87 A;  1PEV A;  3CFS B;  3L4O D;  4K3J B;  2OK6 A;  2B4E A;  1SQJ A;  4PXW A;  4O3T B;  2AQ5 A;  4L1Q D;  4N14 A;  2H3X A;  4OZU A;  1L0Q A;  4UI9 R;  5FLX g;  3ODT A;  4J79 A;  3I2N A;  2GC4 A;  5FA5 B;  3I89 A;  2I0T A;  4A2M A;  4PBY A;  3JZH A;  4XYH A;  2OJY A;  4IMM A;  3IJ0 A;  3CFV A;  3MMY A;  4ESG A;  1NR0 A;  3B7F A;  2AH0 A;  2H9M A;  4ZOV A;  4AEZ A;  4BUJ C;  3C5M A;  4O3U B;  5EAR A;  3AH8 B;  4JSP C;  2AGX A;  2I0S A;  3BWS A;  4Z8L A;  4CZV A;  5FKT A;  2O9K A;  3ZWL B;  2OVP B;  4CY1 A;  2W18 A;  2XU7 A;  3SJL D;  4E5Z B;  3U4Y A;  3FM0 A;  3OW8 A;  3JZG A;  5IJ8 E;  1OLZ A;  1MG3 A;  3RMZ D;  2OK4 A;  3SVW D;  3VGZ A;  4R7A B;  4E5Z A;  1XKS A;  4FA9 D;  4A2L A;  4ZN4 A;  2AGY A;  5CXB B;  3GRE A;  3UKU C;  4E54 B;  2H14 A;  3I8E A;  3MZL A;  4Y5R D;  3E0C A;  3ORV D;  4J84 A;  5CXB A;  3SMR A;  4JXM A;  3PXS D;  4FWW A;  4PNK B;  4PSW B;  3SXT D;  4A7J A;  4GM3 A;  4E54 A;  3PSC B;  4ZOY A;  4J73 A;  4J8G A;  3SLE D;  3PVW B;  3UR4 A;  2IUP A;  3PSL A;  4LG8 A;  5EML B;  4A09 B;  2BCJ B;  3P4F A;  3F3F A;  2IUR A;  5FKQ A;  3I7N A;  4PC0 A;  1B9X A;  4A09 A;  5C2V B;  4HDJ A;  1N6F A;  3L4M D;  4O9D A;  2YNO A;  3DWL C;  2PBI B;  1PBY B;  1SQ9 A;  5AMS A;  5EAP A;  3CIK B;  3PXT D;  4H5J A;  5FKS A;  4CI3 A;  5TDH B;  2CO0 C;  4J77 A;  3IJ1 A;  3V7D B;  3NVQ A;  5B4W A;  4PBZ A;  3K26 A;  4A0B B;  4NSX A;  3RSE C;  1VYH C;  2CE9 A;  1TBG A;  4XEI C;  4BH6 A;  3RFH A;  3AL8 A;  5EM2 B;  4JT6 C;  5H1M A;  5H17 A;  3SBP A;  1K32 A;  2J57 G;  2UZX B;  4A11 B;  1NEX B;  1GG2 B;  1XIP A;  5HQG A;  5GXH A;  3W15 A;  4J8B A;  1PGU A;  4A11 A;  1JMX B;  5KDO B;  2HES X;  4LG9 A;  3UKR C;  2XL3 A;  3N0D A;  2P9N C;  2TRC B;  1XHM A;  1N6D A;  3RRM C;  2XL2 A;  2OVR B;  4Y7R A;  5HE1 B;  4FAV D;  2EBS A;  2H6K A;  5GSA A;  4D6V A;  3I7P A;  4G56 B;  4ZOZ A;  1P22 A;  5HE0 B;  5HE2 B;  3AL9 A;  3PVU B;  4FB1 D;  4QL1 A;  3IIW A;  4X60 B;  2UZY B;  3SHF A;  3SBQ A;  1MDA H;  3OL2 B;  4A0A B;  4QT8 A;  4J82 A;  2BBK H;  4X3E A;  5AFU 3;  4KFM B;  4QQE A;  3OL2 A;  3FGB A;  4A0A A;  1JOF A;  3JPX A;  2Z2O A;  4GGA A;  4H5I A;  2AGW A;  4L9O A;  1JJU B;  4ERZ A;  4U1E I;  2GNQ A;  3EI4 B;  1R5M A;  4CY5 A;  1QNI A;  1N6E A;  4CI2 A;  3I7K A;  2Z2P A;  4AOW A;  2YNP A;  2H47 A;  3EI4 A;  3N0E A;  1MG2 A;  5FQD A;  4GM8 A;  3DSM A;  5I5M A;  5IJ7 E;  2I3T A;  3BG0 A;  3EI3 B;  1OMW B;  4D0K A;  2H9L A;  2YMU A;  3V5W B;  2P9S C;  3K27 A;  4L3G D;  4CY2 A;  4LGN A;  3DM0 A;  3EI3 A;  3OKY B;  2QC5 A;  2J55 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...