5B4WA

Crystal structure of plexin inhibitor complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
456
structure length
434
Chain Sequence
b'TAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-B1
publication title Allosteric Inhibition of a Semaphorin 4D Receptor Plexin B1 by a High-Affinity Macrocyclic Peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 101
structure length 434
sequence length 456
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5b4wA00
5C2VB 4J79A 3EI1B 2Q7QA 4PBZA 4CY2A 4GM3A 4R7AB 3FRXA 3IJCA 2P9IC 4LGNA 3U4YA 3SBRA 4XYHA 3I7NA 4IA9A 4ERQA 4ERZA 3PXWD 1B9YA 4E54A 2OK6A 4XEIC 2CE8A 5EM2B 3FGBA 2H14A 1Q47A 3V9FA 4D6VA 4L3HD 1MG2A 1L0QA 5FXYA 3UVOA 5HE2B 3CFVA 4GMBA 3UVKA 5THAA 1PEVA 3RRMC 4O9DA 2O9KA 3I7LA 3RSEC 1XKSA 3UR4A 2H6QA 4ES0A 4X60B 3SHFA 2EBSA 3ULEC 3UKUC 5HYNB 3MMYA 3EI3A 4J0WA 3KRWB 3VH0A 3L4MD 1JMZB 1GOTB 2AQ5A 2B5NA 5K19A 2HKRA 4J86A 5FKTA 4A0BB 3EI1A 4J84A 3W15A 2HJBA 4ERYA 2OVRB 2IUQA 3OTTA 4J78A 4QL1A 2HYEA 5C9ZB 1MDAH 5EAMA 3IKOA 2HJ4A 3P4FA 5EM2A 1P22A 1NR0A 3N0EA 1JOFA 3UKRC 2CN2A 3NVNA 5IGOA 2J55H 4J73A 5FA5B 2PM7B 3IIWA 3OKYB 4A09A 1OLZA 4NSXA 3KRXB 4JSPC 2GC7A 5JWZA 5AMSA 1GP2B 4A0AB 2YBAA 3SBQA 1R5MA 4L9OA 2P9PC 3EI4A 3CIKB 1N6DA 3I8CA 4GZ8A 4A0BA 4CY1A 3JRPA 5EMKB 2OIZA 3F3FA 5GSAA 1JMXB 5FQDA 3AL9A 3EG6A 3EI2B 3I89A 5EMJB 2BBKH 4JSVC 4KFMB 5EAPA 3RN1D 4O45A 2UZXB 1XIPA 5K1CC 2CN3A 4PSWB 2I3SA 2H3XA 3RFGA 1K32A 3HFQA 3JZNA 3RMZD 2H6KA 4TZ4A 5AFU3 4PNKB 2H47A 2QC5A 3A0FA 2AGLA 2B4EA 2Z2OA 1A0RB 1PBYB 4CY5A 4AEZA 3NVQA 2HXCA 3OKYA 4U7AA 4K3ID 4ZOXA 3MXXA 4JT5C 3L4OD 4PBYA 4PXWA 2YNOA 5EMMB 2IUVA 2H9NA 4A0AA 3PSCB 3DXMC 3SXTD 4J0XA 1GG2B 3IJ1A 3IJ0A 2P9LC 4FA4D 4X63B 5IJ7E 2IWKA 2AGXA 3JZHA 3EI2A 3DSMA 5IC7A 4A08A 3SFZA 1N6FA 2IURA 4J77A 2J56H 2OJYA 2HKMA 3DXKC 2B5LA 3RFHA 5I5JA 1SHYB 3I8EA 4J81A 3I2NA 3K26A 5EARA 2J57G 5TF2A 3FM0A 5AJAA 2AGYA 4CZYA 4FA1D 4CI1A 1SQ9A 3RN0D 5CXCB 4U1EI 5HE3B 3PVUB 4QRJA 5B4WA 4N14A 3PXSD 1FWXA 4EWRA 3V5WB 4H5IA 5HE0B 5A2Qg 1B9XA 4ZOZA 5IGQA 2G9AA 2P9KC 5IT9g 3BWSA 4E5ZB 3ODTA 1PGUA 2GNQA 4O3UB 2PM9B 3MZKA 2H9MA 4O3TB 4BUJC 4GGDA 3SCYA 4LG8A 2AH1A 4O1QD 1RI6A 5KDOB 3V7DB 4A2LA 5C2WB 4J8BA 3AFCA 4CC9A 3JPXA 4OZUA 5IJ8E 3SBPA 3SLED 2Z2NA 3B7FA 2I3TA 4MK0B 5H17A 3UVLA 3OKWA 3VGZA 4FHLA 3I7OA 4JD2C 5H14A 2AGWA 1YFQA 5SXMA 4CI2A 5CXCA 1TBGA 4ESGA 2H9PA 3MKQA 2YNPA 2XL3A 4BH6A 3SJLD 4L3GD 3F3PA 3SWSD 4GQ1A 4HDJA 5GMKn 4E5ZA 4A2MA 2CE9A 2IAAA 1GXRA 2PM9A 3PXTD 2IUPA 4A7JA 2GC4A 3K27A 3JZGA 4D0KA 3UVMA 4GGAA 4IMMA 4CI8A 3F3GA 5TDHB 2YMUA 2XYIA 2HESX 3C5MA 4ZOYA 4Y7RA 5FKRA 3JB9L 1K8KC 5HE1B 2AH0A 3EU7A 2OVPB 4G56B 1N6EA 3DWLC 3ORVD 3BG1A 3UVNA 1VYHC 2P9SC 2W18A 1OMWB 4XYIA 3AH8B 2MTAH 4ZOVA 3SVWD 5I5MA 1SQJA 4GQ2P 3J80g 4JSNC 4PC0A 2YNNA 5HQGA 1NEXB 3BG0A 5TEEA 3C9CA 2CO0C 2H68A 1PI6A 3OL2B 2OK4A 5H1MA 3PSLA 4LG9A 5CXBB 5FKSA 4A11B 3I7KA 2XU7A 2Z2PA 4FA9D 1U4CA 2G99A 4FWWA 2P9UC 1JJUB 4CI3A 5FLXg 4Y5RD 4A09B 3N0DA 4JSXC 2I0TA 2P9NC 3SMRA 2H9LA 2CO0A 4K3JB 4CZVA 4FA5D 3PVWB 3E0CA 2B5MA 3SN6B 4JXMA 3JROA 5CYKB 4GQBB 4QT8A 2I0SA 4ZN4A 4FAND 4GM8A 3EI4B 2UZYB 3J81g 3GFCA 3C99A 4J87A 4AOWA 4GGCA 4GM9A 2H6NA 4UI9R 3DM0A 3OL2A 3RLMD 2OVQB 1QNIA 3C75H 5CXBA 5EALA 4J8GA 4FAVD 5GXIA 4A11A 3OW8A 3AL8B 1TYQC 4X61B 4BL0A 3OKTA 4YVDA 1MG3A 3EMHA 2IWFA 2H13A 3IIYA 3EWEA 2YB8B 3I7PA 5CYKA 2BCJB 4H5JA 3MZLA 4OWRA 2PBIB 3GREA 2I0RA 5FKQA 4E54B 3MKSB 4I79A 2XL2A 1U2VC 4J82A 3VA6A 4Z8LA 2PM6B 2TRCB 5TEFA 4A08B 4L1QD 4FB1D 4X3EA 1XHMA 2CNXA 3PE7A 4CZXA 4PSXB 4QQEA 3ZWLB 3CFSB 3AL8A 4CY3A 5EMLB 3EI3B 1ERJA 4JT6C 3NVXA 2AGZA 5GXHA 3JAMg 1S4UX 5I5IA 3I7HA 2QXVA
chains in the Genus database with same CATH superfamily
4G55A 1M1XA 5C2VB 4J79A 3EI1B 2Q7QA 4UM8A 4PBZA 4CY2A 4GM3A 4R7AB 3FRXA 3IJCA 2P9IC 1O6GA 4LGNA 3U4YA 3SBRA 4XYHA 3I7NA 4IA9A 4ERQA 4ERZA 3PXWD 1B9YA 4E54A 2OK6A 4XEIC 1UOOA 2CE8A 2VDNA 5EM2B 4AX4A 3FGBA 2H14A 4L1MA 1Q47A 3V9FA 4D6VA 1UOPA 4L3HD 1MG2A 1L0QA 3IUJA 5FXYA 3UVOA 5HE2B 3ZE2A 3CFVA 4GMBA 3UVKA 5THAA 1PEVA 3RRMC 2EIDA 2VZ1A 2EIBA 4O9DA 2O9KA 3I7LA 3RSEC 1XKSA 3UR4A 5FFOA 2H6QA 4QAMA 4ES0A 4X60B 3SHFA 3QI0A 2EBSA 3ULEC 3UKUC 5HYNB 3MMYA 3EI3A 4J0WA 3KRWB 3VH0A 3L4MD 1JTDB 1JMZB 1GOTB 4WJKA 4AMYA 2AQ5A 2B5NA 5K19A 2HKRA 4J86A 5FKTA 4A0BB 2VDQA 3EI1A 4J84A 1YR2A 3W15A 2HJBA 4ERYA 3O4JA 2OVRB 2HU5A 2IUQA 3OTTA 4J78A 3OF7A 4AN1A 4QL1A 2HYEA 1JV2A 3O4IA 5C9ZB 1MDAH 5EAMA 3IKOA 1TYEA 2HJ4A 3P4FA 5EM2A 2QZPA 1P22A 1NR0A 1H2YA 2VZ3A 3N0EA 1JOFA 3NIDA 3UKRC 2CN2A 3NVNA 4MMYA 5IGOA 4MMZA 2J55H 4J73A 5HDBA 5FA5B 2PM7B 3IIWA 3OKYB 3FCSA 4A09A 2WQ8A 1OLZA 4NSXA 3KRXB 4JSPC 1E8NA 2GC7A 5JWZA 5AMSA 1GP2B 4A0AB 2YBAA 3SBQA 1R5MA 3DDUA 4L9OA 1H2ZA 2P9PC 3EI4A 3CIKB 1N6DA 3I8CA 4GZ8A 4A0BA 3ZE0A 4CY1A 3JRPA 5EMKB 2OIZA 3F3FA 5GSAA 1JMXB 5FQDA 3AL9A 3EG6A 3EI2B 3I89A 5EMJB 2BBKH 4JSVC 4KFMB 5EAPA 3RN1D 4O45A 2UZXB 1XIPA 5K1CC 2CN3A 4PSWB 2I3SA 2H3XA 3RFGA 1K32A 3HFQA 3JZNA 3RMZD 2H6KA 4TZ4A 5AFU3 1C9IA 4PNKB 2H47A 4JHNA 2QC5A 3A0FA 2AGLA 2B4EA 2Z2OA 1A0RB 1PBYB 1UTCA 4CY5A 3IUQA 4AEZA 3NVQA 2HXCA 3OKYA 4U7AA 3GD1I 4K3ID 3NIFA 4ZOXA 3MXXA 1GOFA 3L4OD 4JT5C 4PBYA 4PXWA 4DNVA 2YNOA 5EMMB 4WK2A 2IUVA 2H9NA 4A0AA 3PSCB 3DXMC 3SXTD 4J0XA 1GG2B 3FCUA 3IJ1A 4Z7NA 3IJ0A 2P9LC 4FA4D 4X63B 5IJ7E 2QR5A 2IWKA 2AGXA 3IUMA 3JZHA 3EI2A 3DSMA 3IJEA 5IC7A 4A08A 3SFZA 1N6FA 2IURA 4J77A 1H2WA 2J56H 2OJYA 2HKMA 3DXKC 2B5LA 3RFHA 1VE7A 5I5JA 3O4GA 1SHYB 3I8EA 4J81A 3I2NA 3IVMA 3K26A 5EARA 2J57G 5TF2A 3K72A 3FM0A 5M5RA 5AJAA 2AGYA 4CZYA 4FA1D 2VC2A 4CI1A 1SQ9A 3RN0D 5M5UA 5CXCB 4U1EI 5HE3B 3PVUB 4QRJA 5B4WA 4N14A 3PXSD 1FWXA 4EWRA 3QHYB 3V5WB 4H5IA 5HE0B 5A2Qg 1H2XA 1B9XA 4ZOZA 5IGQA 2G9AA 1K3IA 2P9KC 5IT9g 3BWSA 4E5ZB 3ODTA 1PGUA 4UM9A 2GNQA 4O3UB 2PM9B 3MZKA 2H9MA 4O3TB 4BUJC 2EICA 4GGDA 3SCYA 1UOQA 4LG8A 2AH1A 2VDOA 1RI6A 2VDKA 4O1QD 5KDOB 3V7DB 3ZDXA 3MUOA 1VE6A 4A2LA 5C2WB 4J8BA 3AFCA 4CC9A 3JPXA 4OZUA 5IJ8E 3SBPA 3SLED 2Z2NA 4JHPC 3B7FA 2I3TA 4MK0B 5H17A 3UVLA 3OKWA 3VGZA 3T3MA 2XDWA 2XE4A 3I7OA 4FHLA 4JD2C 4NENA 4AMZA 5H14A 3VI3A 4AN0A 2AGWA 1YFQA 5SXMA 4CI2A 5CXCA 1TBGA 3MUNA 4ESGA 4DNUA 2H9PA 3IUNA 3MKQA 4BP8A 2YNPA 2XL3A 4BH6A 1QFMA 3SJLD 4L3GD 3F3PA 2JKXA 4G1MA 3SWSD 4GQ1A 4HDJA 5GMKn 4E5ZA 4A2MA 2CE9A 2IAAA 1GXRA 2PM9A 3PXTD 2IUPA 5C92A 4A7JA 2GC4A 3K27A 3JZGA 4D0KA 1E5TA 4GGAA 5FFGA 4IMMA 3UVMA 1U8CA 4CI8A 3F3GA 3GC3B 5TDHB 2YMUA 2XYIA 2HESX 3C5MA 4ZOYA 4Y7RA 4O2WA 5FKRA 1E8MA 3JB9L 1K8KC 5HE1B 2HU7A 3EU7A 2AH0A 2OVPB 4G56B 1N6EA 3DWLC 3ORVD 3BG1A 3UVNA 1VYHC 2P9SC 1GOHA 3K6SA 1BPOA 3KCIA 2W18A 1OMWB 4O02A 3AH8B 4XYIA 2MTAH 2BKLA 4ZOVA 3NIGA 3SVWD 5I5MA 1SQJA 4GQ2P 3J80g 4JSNC 4PC0A 2YNNA 5HQGA 1NEXB 3BG0A 5TEEA 3C9CA 2CO0C 2H68A 1PI6A 3OL2B 2OK4A 5H1MA 3PSLA 1A12A 4LG9A 3T3PA 4BCCA 5CXBB 5FKSA 4NAAA 3ZE1A 4A11B 3I7KA 2XU7A 2Z2PA 4FA9D 5M5VA 1U4CA 2G99A 4FWWA 2P9UC 1JJUB 4CI3A 5FLXg 2VDRA 4Y5RD 4A09B 3N0DA 4JSXC 1VZ3A 2I0TA 2P9NC 3SMRA 3O4HA 3ZDZA 2H9LA 2CO0A 4K3JB 4CZVA 1C9LA 4FA5D 3PVWB 3E0CA 1T2XA 2B5MA 3SN6B 4JXMA 3V4PA 3JROA 5CYKB 4NC4A 4GQBB 4QT8A 2I0SA 4ZN4A 4G1EA 4BCBA 4FAND 3V4VA 4GM8A 3EQ9A 3EI4B 2UZYB 3J81g 3GFCA 3C99A 4J87A 4AOWA 4RE5A 4GGCA 2VDLA 4GM9A 2H6NA 4UI9R 4Z7OA 3DM0A 1QFSA 3OL2A 3RLMD 2OVQB 5M5TA 1I2MB 4IRZA 1L5GA 1QNIA 3C75H 5CXBA 5EALA 4J8GA 4FAVD 5GXIA 4A11A 1O6FA 3OW8A 3AL8B 2VDMA 1TYQC 4X61B 4BL0A 3OKTA 4YVDA 4Z7QA 1MG3A 3EMHA 1GOGA 2IWFA 2H13A 1VZ2A 3IIYA 3EWEA 2YB8B 3I7PA 5CYKA 4WK0A 2BCJB 5M5SA 4MMXA 4H5JA 4RE6A 3MZLA 4OWRA 5E6SA 2PBIB 3GREA 2I0RA 5FKQA 3IULA 4E54B 3MKSB 4I79A 2VDPA 4DNWA 2XL2A 1U2VC 4J82A 4BCDA 4BP9A 5C86A 2EIEA 3K71A 3ZDYA 4NBMA 3IURA 3VA6A 4Z8LA 5M61A 5E6UA 2XZGA 3EQ8A 2PM6B 2TRCB 5TEFA 4A08B 4L1QD 3VI4A 4FB1D 4D9SA 4X3EA 3MVDK 1XHMA 2CNXA 3PE7A 2HU8A 4CZXA 4PSXB 4QQEA 3ZWLB 3CFSB 3AL8A 4CY3A 5EMLB 3EI3B 1ERJA 4JT6C 3NVXA 4WK4A 2AGZA 5E6RA 3EQ7A 5GXHA 3JAMg 1S4UX 5I5IA 3I7HA 2QXVA
chains in the Genus database with same CATH topology
5C2VB 4J79A 3EI1B 2Q7QA 4PBZA 4CY2A 4GM3A 4R7AB 3FRXA 3IJCA 2P9IC 4LGNA 3U4YA 3SBRA 4XYHA 3I7NA 4IA9A 4ERQA 4ERZA 3PXWD 1B9YA 4E54A 2OK6A 4XEIC 2CE8A 5EM2B 3FGBA 2H14A 1Q47A 3V9FA 4D6VA 4L3HD 1MG2A 1L0QA 5FXYA 3UVOA 5HE2B 3CFVA 4GMBA 3UVKA 5THAA 1PEVA 3RRMC 4O9DA 2O9KA 3I7LA 3RSEC 1XKSA 3UR4A 2H6QA 4ES0A 4X60B 3SHFA 2EBSA 3ULEC 3UKUC 5HYNB 3MMYA 3EI3A 4J0WA 3KRWB 3VH0A 3L4MD 1JMZB 1GOTB 2AQ5A 2B5NA 5K19A 2HKRA 4J86A 5FKTA 4A0BB 3EI1A 4J84A 3W15A 2HJBA 4ERYA 2OVRB 2IUQA 3OTTA 4J78A 4QL1A 2HYEA 5C9ZB 1MDAH 5EAMA 3IKOA 2HJ4A 3P4FA 5EM2A 1P22A 1NR0A 3N0EA 1JOFA 3UKRC 2CN2A 3NVNA 5IGOA 2J55H 4J73A 5FA5B 2PM7B 3IIWA 3OKYB 4A09A 1OLZA 4NSXA 3KRXB 4JSPC 2GC7A 5JWZA 5AMSA 1GP2B 4A0AB 2YBAA 3SBQA 1R5MA 4L9OA 2P9PC 3EI4A 3CIKB 1N6DA 3I8CA 4GZ8A 4A0BA 4CY1A 3JRPA 5EMKB 2OIZA 3F3FA 5GSAA 1JMXB 5FQDA 3AL9A 3EG6A 3EI2B 3I89A 5EMJB 2BBKH 4JSVC 4KFMB 5EAPA 3RN1D 4O45A 2UZXB 1XIPA 5K1CC 2CN3A 4PSWB 2I3SA 2H3XA 3RFGA 1K32A 3HFQA 3JZNA 3RMZD 2H6KA 4TZ4A 5AFU3 4PNKB 2H47A 2QC5A 3A0FA 2AGLA 2B4EA 2Z2OA 1A0RB 1PBYB 4CY5A 4AEZA 3NVQA 2HXCA 3OKYA 4U7AA 4K3ID 4ZOXA 3MXXA 4JT5C 3L4OD 4PBYA 4PXWA 2YNOA 5EMMB 2IUVA 2H9NA 4A0AA 3PSCB 3DXMC 3SXTD 4J0XA 1GG2B 3IJ1A 3IJ0A 2P9LC 4FA4D 4X63B 5IJ7E 2IWKA 2AGXA 3JZHA 3EI2A 3DSMA 5IC7A 4A08A 3SFZA 1N6FA 2IURA 4J77A 2J56H 2OJYA 2HKMA 3DXKC 2B5LA 3RFHA 5I5JA 1SHYB 3I8EA 4J81A 3I2NA 3K26A 5EARA 2J57G 5TF2A 3FM0A 5AJAA 2AGYA 4CZYA 4FA1D 4CI1A 1SQ9A 3RN0D 5CXCB 4U1EI 5HE3B 3PVUB 4QRJA 5B4WA 4N14A 3PXSD 1FWXA 4EWRA 3V5WB 4H5IA 5HE0B 5A2Qg 1B9XA 4ZOZA 5IGQA 2G9AA 2P9KC 5IT9g 3BWSA 4E5ZB 3ODTA 1PGUA 2GNQA 4O3UB 2PM9B 3MZKA 2H9MA 4O3TB 4BUJC 4GGDA 3SCYA 4LG8A 2AH1A 4O1QD 1RI6A 5KDOB 3V7DB 4A2LA 5C2WB 4J8BA 3AFCA 4CC9A 3JPXA 4OZUA 5IJ8E 3SBPA 3SLED 2Z2NA 3B7FA 2I3TA 4MK0B 5H17A 3UVLA 3OKWA 3VGZA 4FHLA 3I7OA 4JD2C 5H14A 2AGWA 1YFQA 5SXMA 4CI2A 5CXCA 1TBGA 4ESGA 2H9PA 3MKQA 2YNPA 2XL3A 4BH6A 3SJLD 4L3GD 3F3PA 3SWSD 4GQ1A 4HDJA 5GMKn 4E5ZA 4A2MA 2CE9A 2IAAA 1GXRA 2PM9A 3PXTD 2IUPA 4A7JA 2GC4A 3K27A 3JZGA 4D0KA 3UVMA 4GGAA 4IMMA 4CI8A 3F3GA 5TDHB 2YMUA 2XYIA 2HESX 3C5MA 4ZOYA 4Y7RA 5FKRA 3JB9L 1K8KC 5HE1B 2AH0A 3EU7A 2OVPB 4G56B 1N6EA 3DWLC 3ORVD 3BG1A 3UVNA 1VYHC 2P9SC 2W18A 1OMWB 4XYIA 3AH8B 2MTAH 4ZOVA 3SVWD 5I5MA 1SQJA 4GQ2P 3J80g 4JSNC 4PC0A 2YNNA 5HQGA 1NEXB 3BG0A 5TEEA 3C9CA 2CO0C 2H68A 1PI6A 3OL2B 2OK4A 5H1MA 3PSLA 4LG9A 5CXBB 5FKSA 4A11B 3I7KA 2XU7A 2Z2PA 4FA9D 1U4CA 2G99A 4FWWA 2P9UC 1JJUB 4CI3A 5FLXg 4Y5RD 4A09B 3N0DA 4JSXC 2I0TA 2P9NC 3SMRA 2H9LA 2CO0A 4K3JB 4CZVA 4FA5D 3PVWB 3E0CA 2B5MA 3SN6B 4JXMA 3JROA 5CYKB 4GQBB 4QT8A 2I0SA 4ZN4A 4FAND 4GM8A 3EI4B 2UZYB 3J81g 3GFCA 3C99A 4J87A 4AOWA 4GGCA 4GM9A 2H6NA 4UI9R 3DM0A 3OL2A 3RLMD 2OVQB 1QNIA 3C75H 5CXBA 5EALA 4J8GA 4FAVD 5GXIA 4A11A 3OW8A 3AL8B 1TYQC 4X61B 4BL0A 3OKTA 4YVDA 1MG3A 3EMHA 2IWFA 2H13A 3IIYA 3EWEA 2YB8B 3I7PA 5CYKA 2BCJB 4H5JA 3MZLA 4OWRA 2PBIB 3GREA 2I0RA 5FKQA 4E54B 3MKSB 4I79A 2XL2A 1U2VC 4J82A 3VA6A 4Z8LA 2PM6B 2TRCB 5TEFA 4A08B 4L1QD 4FB1D 4X3EA 1XHMA 2CNXA 3PE7A 4CZXA 4PSXB 4QQEA 3ZWLB 3CFSB 3AL8A 4CY3A 5EMLB 3EI3B 1ERJA 4JT6C 3NVXA 2AGZA 5GXHA 3JAMg 1S4UX 5I5IA 3I7HA 2QXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2V B;  4J79 A;  3EI1 B;  2Q7Q A;  4PBZ A;  4CY2 A;  4GM3 A;  4R7A B;  3FRX A;  3IJC A;  2P9I C;  4LGN A;  3U4Y A;  3SBR A;  4XYH A;  3I7N A;  4IA9 A;  4ERQ A;  4ERZ A;  3PXW D;  1B9Y A;  4E54 A;  2OK6 A;  4XEI C;  2CE8 A;  5EM2 B;  3FGB A;  2H14 A;  1Q47 A;  3V9F A;  4D6V A;  4L3H D;  1MG2 A;  1L0Q A;  5FXY A;  3UVO A;  5HE2 B;  3CFV A;  4GMB A;  3UVK A;  5THA A;  1PEV A;  3RRM C;  4O9D A;  2O9K A;  3I7L A;  3RSE C;  1XKS A;  3UR4 A;  2H6Q A;  4ES0 A;  4X60 B;  3SHF A;  2EBS A;  3ULE C;  3UKU C;  5HYN B;  3MMY A;  3EI3 A;  4J0W A;  3KRW B;  3VH0 A;  3L4M D;  1JMZ B;  1GOT B;  2AQ5 A;  2B5N A;  5K19 A;  2HKR A;  4J86 A;  5FKT A;  4A0B B;  3EI1 A;  4J84 A;  3W15 A;  2HJB A;  4ERY A;  2OVR B;  2IUQ A;  3OTT A;  4J78 A;  4QL1 A;  2HYE A;  5C9Z B;  1MDA H;  5EAM A;  3IKO A;  2HJ4 A;  3P4F A;  5EM2 A;  1P22 A;  1NR0 A;  3N0E A;  1JOF A;  3UKR C;  2CN2 A;  3NVN A;  5IGO A;  2J55 H;  4J73 A;  5FA5 B;  2PM7 B;  3IIW A;  3OKY B;  4A09 A;  1OLZ A;  4NSX A;  3KRX B;  4JSP C;  2GC7 A;  5JWZ A;  5AMS A;  1GP2 B;  4A0A B;  2YBA A;  3SBQ A;  1R5M A;  4L9O A;  2P9P C;  3EI4 A;  3CIK B;  1N6D A;  3I8C A;  4GZ8 A;  4A0B A;  4CY1 A;  3JRP A;  5EMK B;  2OIZ A;  3F3F A;  5GSA A;  1JMX B;  5FQD A;  3AL9 A;  3EG6 A;  3EI2 B;  3I89 A;  5EMJ B;  2BBK H;  4JSV C;  4KFM B;  5EAP A;  3RN1 D;  4O45 A;  2UZX B;  1XIP A;  5K1C C;  2CN3 A;  4PSW B;  2I3S A;  2H3X A;  3RFG A;  1K32 A;  3HFQ A;  3JZN A;  3RMZ D;  2H6K A;  4TZ4 A;  5AFU 3;  4PNK B;  2H47 A;  2QC5 A;  3A0F A;  2AGL A;  2B4E A;  2Z2O A;  1A0R B;  1PBY B;  4CY5 A;  4AEZ A;  3NVQ A;  2HXC A;  3OKY A;  4U7A A;  4K3I D;  4ZOX A;  3MXX A;  4JT5 C;  3L4O D;  4PBY A;  4PXW A;  2YNO A;  5EMM B;  2IUV A;  2H9N A;  4A0A A;  3PSC B;  3DXM C;  3SXT D;  4J0X A;  1GG2 B;  3IJ1 A;  3IJ0 A;  2P9L C;  4FA4 D;  4X63 B;  5IJ7 E;  2IWK A;  2AGX A;  3JZH A;  3EI2 A;  3DSM A;  5IC7 A;  4A08 A;  3SFZ A;  1N6F A;  2IUR A;  4J77 A;  2J56 H;  2OJY A;  2HKM A;  3DXK C;  2B5L A;  3RFH A;  5I5J A;  1SHY B;  3I8E A;  4J81 A;  3I2N A;  3K26 A;  5EAR A;  2J57 G;  5TF2 A;  3FM0 A;  5AJA A;  2AGY A;  4CZY A;  4FA1 D;  4CI1 A;  1SQ9 A;  3RN0 D;  5CXC B;  4U1E I;  5HE3 B;  3PVU B;  4QRJ A;  5B4W A;  4N14 A;  3PXS D;  1FWX A;  4EWR A;  3V5W B;  4H5I A;  5HE0 B;  5A2Q g;  1B9X A;  4ZOZ A;  5IGQ A;  2G9A A;  2P9K C;  5IT9 g;  3BWS A;  4E5Z B;  3ODT A;  1PGU A;  2GNQ A;  4O3U B;  2PM9 B;  3MZK A;  2H9M A;  4O3T B;  4BUJ C;  4GGD A;  3SCY A;  4LG8 A;  2AH1 A;  4O1Q D;  1RI6 A;  5KDO B;  3V7D B;  4A2L A;  5C2W B;  4J8B A;  3AFC A;  4CC9 A;  3JPX A;  4OZU A;  5IJ8 E;  3SBP A;  3SLE D;  2Z2N A;  3B7F A;  2I3T A;  4MK0 B;  5H17 A;  3UVL A;  3OKW A;  3VGZ A;  4FHL A;  3I7O A;  4JD2 C;  5H14 A;  2AGW A;  1YFQ A;  5SXM A;  4CI2 A;  5CXC A;  1TBG A;  4ESG A;  2H9P A;  3MKQ A;  2YNP A;  2XL3 A;  4BH6 A;  3SJL D;  4L3G D;  3F3P A;  3SWS D;  4GQ1 A;  4HDJ A;  5GMK n;  4E5Z A;  4A2M A;  2CE9 A;  2IAA A;  1GXR A;  2PM9 A;  3PXT D;  2IUP A;  4A7J A;  2GC4 A;  3K27 A;  3JZG A;  4D0K A;  3UVM A;  4GGA A;  4IMM A;  4CI8 A;  3F3G A;  5TDH B;  2YMU A;  2XYI A;  2HES X;  3C5M A;  4ZOY A;  4Y7R A;  5FKR A;  3JB9 L;  1K8K C;  5HE1 B;  2AH0 A;  3EU7 A;  2OVP B;  4G56 B;  1N6E A;  3DWL C;  3ORV D;  3BG1 A;  3UVN A;  1VYH C;  2P9S C;  2W18 A;  1OMW B;  4XYI A;  3AH8 B;  2MTA H;  4ZOV A;  3SVW D;  5I5M A;  1SQJ A;  4GQ2 P;  3J80 g;  4JSN C;  4PC0 A;  2YNN A;  5HQG A;  1NEX B;  3BG0 A;  5TEE A;  3C9C A;  2CO0 C;  2H68 A;  1PI6 A;  3OL2 B;  2OK4 A;  5H1M A;  3PSL A;  4LG9 A;  5CXB B;  5FKS A;  4A11 B;  3I7K A;  2XU7 A;  2Z2P A;  4FA9 D;  1U4C A;  2G99 A;  4FWW A;  2P9U C;  1JJU B;  4CI3 A;  5FLX g;  4Y5R D;  4A09 B;  3N0D A;  4JSX C;  2I0T A;  2P9N C;  3SMR A;  2H9L A;  2CO0 A;  4K3J B;  4CZV A;  4FA5 D;  3PVW B;  3E0C A;  2B5M A;  3SN6 B;  4JXM A;  3JRO A;  5CYK B;  4GQB B;  4QT8 A;  2I0S A;  4ZN4 A;  4FAN D;  4GM8 A;  3EI4 B;  2UZY B;  3J81 g;  3GFC A;  3C99 A;  4J87 A;  4AOW A;  4GGC A;  4GM9 A;  2H6N A;  4UI9 R;  3DM0 A;  3OL2 A;  3RLM D;  2OVQ B;  1QNI A;  3C75 H;  5CXB A;  5EAL A;  4J8G A;  4FAV D;  5GXI A;  4A11 A;  3OW8 A;  3AL8 B;  1TYQ C;  4X61 B;  4BL0 A;  3OKT A;  4YVD A;  1MG3 A;  3EMH A;  2IWF A;  2H13 A;  3IIY A;  3EWE A;  2YB8 B;  3I7P A;  5CYK A;  2BCJ B;  4H5J A;  3MZL A;  4OWR A;  2PBI B;  3GRE A;  2I0R A;  5FKQ A;  4E54 B;  3MKS B;  4I79 A;  2XL2 A;  1U2V C;  4J82 A;  3VA6 A;  4Z8L A;  2PM6 B;  2TRC B;  5TEF A;  4A08 B;  4L1Q D;  4FB1 D;  4X3E A;  1XHM A;  2CNX A;  3PE7 A;  4CZX A;  4PSX B;  4QQE A;  3ZWL B;  3CFS B;  3AL8 A;  4CY3 A;  5EML B;  3EI3 B;  1ERJ A;  4JT6 C;  3NVX A;  2AGZ A;  5GXH A;  3JAM g;  1S4U X;  5I5I A;  3I7H A;  2QXV A; 
#chains in the Genus database with same CATH topology
 4G55 A;  1M1X A;  5C2V B;  4J79 A;  3EI1 B;  2Q7Q A;  4UM8 A;  4PBZ A;  4CY2 A;  4GM3 A;  4R7A B;  3FRX A;  3IJC A;  2P9I C;  1O6G A;  4LGN A;  3U4Y A;  3SBR A;  4XYH A;  3I7N A;  4IA9 A;  4ERQ A;  4ERZ A;  3PXW D;  1B9Y A;  4E54 A;  2OK6 A;  4XEI C;  1UOO A;  2CE8 A;  2VDN A;  5EM2 B;  4AX4 A;  3FGB A;  2H14 A;  4L1M A;  1Q47 A;  3V9F A;  4D6V A;  1UOP A;  4L3H D;  1MG2 A;  1L0Q A;  3IUJ A;  5FXY A;  3UVO A;  5HE2 B;  3ZE2 A;  3CFV A;  4GMB A;  3UVK A;  5THA A;  1PEV A;  3RRM C;  2EID A;  2VZ1 A;  2EIB A;  4O9D A;  2O9K A;  3I7L A;  3RSE C;  1XKS A;  3UR4 A;  5FFO A;  2H6Q A;  4QAM A;  4ES0 A;  4X60 B;  3SHF A;  3QI0 A;  2EBS A;  3ULE C;  3UKU C;  5HYN B;  3MMY A;  3EI3 A;  4J0W A;  3KRW B;  3VH0 A;  3L4M D;  1JTD B;  1JMZ B;  1GOT B;  4WJK A;  4AMY A;  2AQ5 A;  2B5N A;  5K19 A;  2HKR A;  4J86 A;  5FKT A;  4A0B B;  2VDQ A;  3EI1 A;  4J84 A;  1YR2 A;  3W15 A;  2HJB A;  4ERY A;  3O4J A;  2OVR B;  2HU5 A;  2IUQ A;  3OTT A;  4J78 A;  3OF7 A;  4AN1 A;  4QL1 A;  2HYE A;  1JV2 A;  3O4I A;  5C9Z B;  1MDA H;  5EAM A;  3IKO A;  1TYE A;  2HJ4 A;  3P4F A;  5EM2 A;  2QZP A;  1P22 A;  1NR0 A;  1H2Y A;  2VZ3 A;  3N0E A;  1JOF A;  3NID A;  3UKR C;  2CN2 A;  3NVN A;  4MMY A;  5IGO A;  4MMZ A;  2J55 H;  4J73 A;  5HDB A;  5FA5 B;  2PM7 B;  3IIW A;  3OKY B;  3FCS A;  4A09 A;  2WQ8 A;  1OLZ A;  4NSX A;  3KRX B;  4JSP C;  1E8N A;  2GC7 A;  5JWZ A;  5AMS A;  1GP2 B;  4A0A B;  2YBA A;  3SBQ A;  1R5M A;  3DDU A;  4L9O A;  1H2Z A;  2P9P C;  3EI4 A;  3CIK B;  1N6D A;  3I8C A;  4GZ8 A;  4A0B A;  3ZE0 A;  4CY1 A;  3JRP A;  5EMK B;  2OIZ A;  3F3F A;  5GSA A;  1JMX B;  5FQD A;  3AL9 A;  3EG6 A;  3EI2 B;  3I89 A;  5EMJ B;  2BBK H;  4JSV C;  4KFM B;  5EAP A;  3RN1 D;  4O45 A;  2UZX B;  1XIP A;  5K1C C;  2CN3 A;  4PSW B;  2I3S A;  2H3X A;  3RFG A;  1K32 A;  3HFQ A;  3JZN A;  3RMZ D;  2H6K A;  4TZ4 A;  5AFU 3;  1C9I A;  4PNK B;  2H47 A;  4JHN A;  2QC5 A;  3A0F A;  2AGL A;  2B4E A;  2Z2O A;  1A0R B;  1PBY B;  1UTC A;  4CY5 A;  3IUQ A;  4AEZ A;  3NVQ A;  2HXC A;  3OKY A;  4U7A A;  3GD1 I;  4K3I D;  3NIF A;  4ZOX A;  3MXX A;  1GOF A;  3L4O D;  4JT5 C;  4PBY A;  4PXW A;  4DNV A;  2YNO A;  5EMM B;  4WK2 A;  2IUV A;  2H9N A;  4A0A A;  3PSC B;  3DXM C;  3SXT D;  4J0X A;  1GG2 B;  3FCU A;  3IJ1 A;  4Z7N A;  3IJ0 A;  2P9L C;  4FA4 D;  4X63 B;  5IJ7 E;  2QR5 A;  2IWK A;  2AGX A;  3IUM A;  3JZH A;  3EI2 A;  3DSM A;  3IJE A;  5IC7 A;  4A08 A;  3SFZ A;  1N6F A;  2IUR A;  4J77 A;  1H2W A;  2J56 H;  2OJY A;  2HKM A;  3DXK C;  2B5L A;  3RFH A;  1VE7 A;  5I5J A;  3O4G A;  1SHY B;  3I8E A;  4J81 A;  3I2N A;  3IVM A;  3K26 A;  5EAR A;  2J57 G;  5TF2 A;  3K72 A;  3FM0 A;  5M5R A;  5AJA A;  2AGY A;  4CZY A;  4FA1 D;  2VC2 A;  4CI1 A;  1SQ9 A;  3RN0 D;  5M5U A;  5CXC B;  4U1E I;  5HE3 B;  3PVU B;  4QRJ A;  5B4W A;  4N14 A;  3PXS D;  1FWX A;  4EWR A;  3QHY B;  3V5W B;  4H5I A;  5HE0 B;  5A2Q g;  1H2X A;  1B9X A;  4ZOZ A;  5IGQ A;  2G9A A;  1K3I A;  2P9K C;  5IT9 g;  3BWS A;  4E5Z B;  3ODT A;  1PGU A;  4UM9 A;  2GNQ A;  4O3U B;  2PM9 B;  3MZK A;  2H9M A;  4O3T B;  4BUJ C;  2EIC A;  4GGD A;  3SCY A;  1UOQ A;  4LG8 A;  2AH1 A;  2VDO A;  1RI6 A;  2VDK A;  4O1Q D;  5KDO B;  3V7D B;  3ZDX A;  3MUO A;  1VE6 A;  4A2L A;  5C2W B;  4J8B A;  3AFC A;  4CC9 A;  3JPX A;  4OZU A;  5IJ8 E;  3SBP A;  3SLE D;  2Z2N A;  4JHP C;  3B7F A;  2I3T A;  4MK0 B;  5H17 A;  3UVL A;  3OKW A;  3VGZ A;  3T3M A;  2XDW A;  2XE4 A;  3I7O A;  4FHL A;  4JD2 C;  4NEN A;  4AMZ A;  5H14 A;  3VI3 A;  4AN0 A;  2AGW A;  1YFQ A;  5SXM A;  4CI2 A;  5CXC A;  1TBG A;  3MUN A;  4ESG A;  4DNU A;  2H9P A;  3IUN A;  3MKQ A;  4BP8 A;  2YNP A;  2XL3 A;  4BH6 A;  1QFM A;  3SJL D;  4L3G D;  3F3P A;  2JKX A;  4G1M A;  3SWS D;  4GQ1 A;  4HDJ A;  5GMK n;  4E5Z A;  4A2M A;  2CE9 A;  2IAA A;  1GXR A;  2PM9 A;  3PXT D;  2IUP A;  5C92 A;  4A7J A;  2GC4 A;  3K27 A;  3JZG A;  4D0K A;  1E5T A;  4GGA A;  5FFG A;  4IMM A;  3UVM A;  1U8C A;  4CI8 A;  3F3G A;  3GC3 B;  5TDH B;  2YMU A;  2XYI A;  2HES X;  3C5M A;  4ZOY A;  4Y7R A;  4O2W A;  5FKR A;  1E8M A;  3JB9 L;  1K8K C;  5HE1 B;  2HU7 A;  3EU7 A;  2AH0 A;  2OVP B;  4G56 B;  1N6E A;  3DWL C;  3ORV D;  3BG1 A;  3UVN A;  1VYH C;  2P9S C;  1GOH A;  3K6S A;  1BPO A;  3KCI A;  2W18 A;  1OMW B;  4O02 A;  3AH8 B;  4XYI A;  2MTA H;  2BKL A;  4ZOV A;  3NIG A;  3SVW D;  5I5M A;  1SQJ A;  4GQ2 P;  3J80 g;  4JSN C;  4PC0 A;  2YNN A;  5HQG A;  1NEX B;  3BG0 A;  5TEE A;  3C9C A;  2CO0 C;  2H68 A;  1PI6 A;  3OL2 B;  2OK4 A;  5H1M A;  3PSL A;  1A12 A;  4LG9 A;  3T3P A;  4BCC A;  5CXB B;  5FKS A;  4NAA A;  3ZE1 A;  4A11 B;  3I7K A;  2XU7 A;  2Z2P A;  4FA9 D;  5M5V A;  1U4C A;  2G99 A;  4FWW A;  2P9U C;  1JJU B;  4CI3 A;  5FLX g;  2VDR A;  4Y5R D;  4A09 B;  3N0D A;  4JSX C;  1VZ3 A;  2I0T A;  2P9N C;  3SMR A;  3O4H A;  3ZDZ A;  2H9L A;  2CO0 A;  4K3J B;  4CZV A;  1C9L A;  4FA5 D;  3PVW B;  3E0C A;  1T2X A;  2B5M A;  3SN6 B;  4JXM A;  3V4P A;  3JRO A;  5CYK B;  4NC4 A;  4GQB B;  4QT8 A;  2I0S A;  4ZN4 A;  4G1E A;  4BCB A;  4FAN D;  3V4V A;  4GM8 A;  3EQ9 A;  3EI4 B;  2UZY B;  3J81 g;  3GFC A;  3C99 A;  4J87 A;  4AOW A;  4RE5 A;  4GGC A;  2VDL A;  4GM9 A;  2H6N A;  4UI9 R;  4Z7O A;  3DM0 A;  1QFS A;  3OL2 A;  3RLM D;  2OVQ B;  5M5T A;  1I2M B;  4IRZ A;  1L5G A;  1QNI A;  3C75 H;  5CXB A;  5EAL A;  4J8G A;  4FAV D;  5GXI A;  4A11 A;  1O6F A;  3OW8 A;  3AL8 B;  2VDM A;  1TYQ C;  4X61 B;  4BL0 A;  3OKT A;  4YVD A;  4Z7Q A;  1MG3 A;  3EMH A;  1GOG A;  2IWF A;  2H13 A;  1VZ2 A;  3IIY A;  3EWE A;  2YB8 B;  3I7P A;  5CYK A;  4WK0 A;  2BCJ B;  5M5S A;  4MMX A;  4H5J A;  4RE6 A;  3MZL A;  4OWR A;  5E6S A;  2PBI B;  3GRE A;  2I0R A;  5FKQ A;  3IUL A;  4E54 B;  3MKS B;  4I79 A;  2VDP A;  4DNW A;  2XL2 A;  1U2V C;  4J82 A;  4BCD A;  4BP9 A;  5C86 A;  2EIE A;  3K71 A;  3ZDY A;  4NBM A;  3IUR A;  3VA6 A;  4Z8L A;  5M61 A;  5E6U A;  2XZG A;  3EQ8 A;  2PM6 B;  2TRC B;  5TEF A;  4A08 B;  4L1Q D;  3VI4 A;  4FB1 D;  4D9S A;  4X3E A;  3MVD K;  1XHM A;  2CNX A;  3PE7 A;  2HU8 A;  4CZX A;  4PSX B;  4QQE A;  3ZWL B;  3CFS B;  3AL8 A;  4CY3 A;  5EML B;  3EI3 B;  1ERJ A;  4JT6 C;  3NVX A;  4WK4 A;  2AGZ A;  5E6R A;  3EQ7 A;  5GXH A;  3JAM g;  1S4U X;  5I5I A;  3I7H A;  2QXV A; 
#chains in the Genus database with same CATH homology
 5C2V B;  4J79 A;  3EI1 B;  2Q7Q A;  4PBZ A;  4CY2 A;  4GM3 A;  4R7A B;  3FRX A;  3IJC A;  2P9I C;  4LGN A;  3U4Y A;  3SBR A;  4XYH A;  3I7N A;  4IA9 A;  4ERQ A;  4ERZ A;  3PXW D;  1B9Y A;  4E54 A;  2OK6 A;  4XEI C;  2CE8 A;  5EM2 B;  3FGB A;  2H14 A;  1Q47 A;  3V9F A;  4D6V A;  4L3H D;  1MG2 A;  1L0Q A;  5FXY A;  3UVO A;  5HE2 B;  3CFV A;  4GMB A;  3UVK A;  5THA A;  1PEV A;  3RRM C;  4O9D A;  2O9K A;  3I7L A;  3RSE C;  1XKS A;  3UR4 A;  2H6Q A;  4ES0 A;  4X60 B;  3SHF A;  2EBS A;  3ULE C;  3UKU C;  5HYN B;  3MMY A;  3EI3 A;  4J0W A;  3KRW B;  3VH0 A;  3L4M D;  1JMZ B;  1GOT B;  2AQ5 A;  2B5N A;  5K19 A;  2HKR A;  4J86 A;  5FKT A;  4A0B B;  3EI1 A;  4J84 A;  3W15 A;  2HJB A;  4ERY A;  2OVR B;  2IUQ A;  3OTT A;  4J78 A;  4QL1 A;  2HYE A;  5C9Z B;  1MDA H;  5EAM A;  3IKO A;  2HJ4 A;  3P4F A;  5EM2 A;  1P22 A;  1NR0 A;  3N0E A;  1JOF A;  3UKR C;  2CN2 A;  3NVN A;  5IGO A;  2J55 H;  4J73 A;  5FA5 B;  2PM7 B;  3IIW A;  3OKY B;  4A09 A;  1OLZ A;  4NSX A;  3KRX B;  4JSP C;  2GC7 A;  5JWZ A;  5AMS A;  1GP2 B;  4A0A B;  2YBA A;  3SBQ A;  1R5M A;  4L9O A;  2P9P C;  3EI4 A;  3CIK B;  1N6D A;  3I8C A;  4GZ8 A;  4A0B A;  4CY1 A;  3JRP A;  5EMK B;  2OIZ A;  3F3F A;  5GSA A;  1JMX B;  5FQD A;  3AL9 A;  3EG6 A;  3EI2 B;  3I89 A;  5EMJ B;  2BBK H;  4JSV C;  4KFM B;  5EAP A;  3RN1 D;  4O45 A;  2UZX B;  1XIP A;  5K1C C;  2CN3 A;  4PSW B;  2I3S A;  2H3X A;  3RFG A;  1K32 A;  3HFQ A;  3JZN A;  3RMZ D;  2H6K A;  4TZ4 A;  5AFU 3;  4PNK B;  2H47 A;  2QC5 A;  3A0F A;  2AGL A;  2B4E A;  2Z2O A;  1A0R B;  1PBY B;  4CY5 A;  4AEZ A;  3NVQ A;  2HXC A;  3OKY A;  4U7A A;  4K3I D;  4ZOX A;  3MXX A;  4JT5 C;  3L4O D;  4PBY A;  4PXW A;  2YNO A;  5EMM B;  2IUV A;  2H9N A;  4A0A A;  3PSC B;  3DXM C;  3SXT D;  4J0X A;  1GG2 B;  3IJ1 A;  3IJ0 A;  2P9L C;  4FA4 D;  4X63 B;  5IJ7 E;  2IWK A;  2AGX A;  3JZH A;  3EI2 A;  3DSM A;  5IC7 A;  4A08 A;  3SFZ A;  1N6F A;  2IUR A;  4J77 A;  2J56 H;  2OJY A;  2HKM A;  3DXK C;  2B5L A;  3RFH A;  5I5J A;  1SHY B;  3I8E A;  4J81 A;  3I2N A;  3K26 A;  5EAR A;  2J57 G;  5TF2 A;  3FM0 A;  5AJA A;  2AGY A;  4CZY A;  4FA1 D;  4CI1 A;  1SQ9 A;  3RN0 D;  5CXC B;  4U1E I;  5HE3 B;  3PVU B;  4QRJ A;  5B4W A;  4N14 A;  3PXS D;  1FWX A;  4EWR A;  3V5W B;  4H5I A;  5HE0 B;  5A2Q g;  1B9X A;  4ZOZ A;  5IGQ A;  2G9A A;  2P9K C;  5IT9 g;  3BWS A;  4E5Z B;  3ODT A;  1PGU A;  2GNQ A;  4O3U B;  2PM9 B;  3MZK A;  2H9M A;  4O3T B;  4BUJ C;  4GGD A;  3SCY A;  4LG8 A;  2AH1 A;  4O1Q D;  1RI6 A;  5KDO B;  3V7D B;  4A2L A;  5C2W B;  4J8B A;  3AFC A;  4CC9 A;  3JPX A;  4OZU A;  5IJ8 E;  3SBP A;  3SLE D;  2Z2N A;  3B7F A;  2I3T A;  4MK0 B;  5H17 A;  3UVL A;  3OKW A;  3VGZ A;  4FHL A;  3I7O A;  4JD2 C;  5H14 A;  2AGW A;  1YFQ A;  5SXM A;  4CI2 A;  5CXC A;  1TBG A;  4ESG A;  2H9P A;  3MKQ A;  2YNP A;  2XL3 A;  4BH6 A;  3SJL D;  4L3G D;  3F3P A;  3SWS D;  4GQ1 A;  4HDJ A;  5GMK n;  4E5Z A;  4A2M A;  2CE9 A;  2IAA A;  1GXR A;  2PM9 A;  3PXT D;  2IUP A;  4A7J A;  2GC4 A;  3K27 A;  3JZG A;  4D0K A;  3UVM A;  4GGA A;  4IMM A;  4CI8 A;  3F3G A;  5TDH B;  2YMU A;  2XYI A;  2HES X;  3C5M A;  4ZOY A;  4Y7R A;  5FKR A;  3JB9 L;  1K8K C;  5HE1 B;  2AH0 A;  3EU7 A;  2OVP B;  4G56 B;  1N6E A;  3DWL C;  3ORV D;  3BG1 A;  3UVN A;  1VYH C;  2P9S C;  2W18 A;  1OMW B;  4XYI A;  3AH8 B;  2MTA H;  4ZOV A;  3SVW D;  5I5M A;  1SQJ A;  4GQ2 P;  3J80 g;  4JSN C;  4PC0 A;  2YNN A;  5HQG A;  1NEX B;  3BG0 A;  5TEE A;  3C9C A;  2CO0 C;  2H68 A;  1PI6 A;  3OL2 B;  2OK4 A;  5H1M A;  3PSL A;  4LG9 A;  5CXB B;  5FKS A;  4A11 B;  3I7K A;  2XU7 A;  2Z2P A;  4FA9 D;  1U4C A;  2G99 A;  4FWW A;  2P9U C;  1JJU B;  4CI3 A;  5FLX g;  4Y5R D;  4A09 B;  3N0D A;  4JSX C;  2I0T A;  2P9N C;  3SMR A;  2H9L A;  2CO0 A;  4K3J B;  4CZV A;  4FA5 D;  3PVW B;  3E0C A;  2B5M A;  3SN6 B;  4JXM A;  3JRO A;  5CYK B;  4GQB B;  4QT8 A;  2I0S A;  4ZN4 A;  4FAN D;  4GM8 A;  3EI4 B;  2UZY B;  3J81 g;  3GFC A;  3C99 A;  4J87 A;  4AOW A;  4GGC A;  4GM9 A;  2H6N A;  4UI9 R;  3DM0 A;  3OL2 A;  3RLM D;  2OVQ B;  1QNI A;  3C75 H;  5CXB A;  5EAL A;  4J8G A;  4FAV D;  5GXI A;  4A11 A;  3OW8 A;  3AL8 B;  1TYQ C;  4X61 B;  4BL0 A;  3OKT A;  4YVD A;  1MG3 A;  3EMH A;  2IWF A;  2H13 A;  3IIY A;  3EWE A;  2YB8 B;  3I7P A;  5CYK A;  2BCJ B;  4H5J A;  3MZL A;  4OWR A;  2PBI B;  3GRE A;  2I0R A;  5FKQ A;  4E54 B;  3MKS B;  4I79 A;  2XL2 A;  1U2V C;  4J82 A;  3VA6 A;  4Z8L A;  2PM6 B;  2TRC B;  5TEF A;  4A08 B;  4L1Q D;  4FB1 D;  4X3E A;  1XHM A;  2CNX A;  3PE7 A;  4CZX A;  4PSX B;  4QQE A;  3ZWL B;  3CFS B;  3AL8 A;  4CY3 A;  5EML B;  3EI3 B;  1ERJ A;  4JT6 C;  3NVX A;  2AGZ A;  5GXH A;  3JAM g;  1S4U X;  5I5I A;  3I7H A;  2QXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...