5B53A

Crystal structure of hydrogen sulfide-producing enzyme (fn1055) from fusobacterium nucleatum
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
334
structure length
334
Chain Sequence
EQKKMKYLENLVGKTPMLELIFDYKGEERRIFVKNESYNLTGSIKDRMAFYTLKKAYEKNEIKKGAPIVEATSGNTGIAFSAMGAILGHPVIIYMPDWMSEERKSLIRSFGAKIILVSRKEGGFLGSIEKTKEFAKNNPDTYLPSQFSNLYNSEAHYYGIGLEIVNEMKSLNLNIDGFVAGVGTGGTVMGIGKRIKENFSNAKICPLEPLNSPTLSTGYKVAKHRIEGISDEFIPDLVKLDKLDNVVSVDDGDAIVMAQKLAKCGLGVGISSGANFIGALMLQNKLGKDSVIVTVFPDDNKKYLSTDLMREEKVKEDFLSKDITLKEIKNVLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hydrogen sulfide-producing enzyme (Fn1055) from Fusobacterium nucleatum
rcsb
source organism Fusobacterium nucleatum subsp. nucleatum atcc 25586
molecule tags Transferase
molecule keywords Cysteine synthase
total genus 124
structure length 334
sequence length 334
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b53A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b53A02
4L0DA 2DH6A 4HPXB 1TZJA 5B53A 1TZ2A 5CVCA 2Q3CA 4JBNA 4NU8X 1KFCB 5BW6B 3SS7X 4D97A 4NEGA 5I7OA 3R0XA 2CLKB 5D86A 1K7FB 5C3UA 1J0EA 4D9EA 3T4PA 1PWEA 4D9NA 1A5SB 4F4FA 1O58A 1QOPB 1D6SA 1A5BB 2CLMB 5I7HA 2CLEB 1WKVA 5KINB 4HPJB 3VBEA 1VB3A 4HN4B 1TDJA 3IAUA 2RHGB 2O2JA 5DBEX 4H27A 2RKBA 1V71A 1A50B 5B55A 5DW3A 5I7RA 5J43A 3SPXA 4D9MA 5B36A 4ZU1X 3DWGA 2C2GA 4AIRA 1K3UB 2ZPUA 1C8VB 2PQMA 3IQIX 4D9BA 2ECOA 4I1YA 5D84A 2BHSA 5B3AA 1UINA 1J0BA 1JBQA 2CLHB 3PC3A 4OFXA 5J5VA 5IWCA 2ZSJA 3PC2A 4LMBA 1V8ZA 4L27A 4Y6GB 3VSCA 3TBHA 1KFBB 1BKSB 2J9XB 5IXJA 1RQXA 1CX9B 1TTQB 3R0ZA 3IQGX 1UIMA 5DW0A 5B1IA 1K8YB 4HO1X 5JJCA 1X1QA 2GN1A 4JBLA 1K8XB 4L28A 5I6DA 3V7NA 2GN2A 4ZU6X 2D1FA 2C2BA 1BEUB 2BHTA 1J0CA 2ZR8A 3DKIA 3VC3A 3X43A 3VSAA 1K8ZB 5IW8A 1VE5A 2WSYB 4D92A 1PWHA 1FCJA 2J9YB 1KL7A 3FCAA 4D8UA 2CLIB 4LI3X 3PR2B 2TYSB 4XUGB 1TJPB 3VSDA 3BM5A 4D9IA 4ZQCB 1QOQB 5I7AA 1KFKB 1WDWB 2CLFB 2Q3BA 5E0KB 3RR2A 3ZEIA 4AECA 2JC3A 3CEPB 1WTCA 1Z7YA 3IQHX 4D9GA 4COOA 4D9CA 4D8WA 3SS9X 1TTPB 1J0DA 3AEXA 5DVZA 2O2EA 5D85A 1Z7WA 1C29B 1OASA 2CLOB 3AEYA 1C9DB 1E5XA 2Q3DA 4D96A 2ECQA 3HMKA 2J9ZB 1UBSB 1FUYB 4QYSA 1Y7LA 3L6BA 5D87A 4LMAA 4OREX 5DBHX 1V7CA 2V03A 1K7EB 4WX2B 1J0AA 1KFJB 2EFYA 4D99A 5JISA 5HBGA 1VE1A 3PC4A 1TZMA 1M54A 1KFEB 2GN0A 5KZMB 1WBJB 1F2DA 1TZKA 3L6CA 3X44A 4KKXB 5EY5B 4D9FA 1A5AB 1K7XB 4HT3B 2TRSB 1TYZA 3DWIA 3L6RA 4PCUA 5CGQB 5B1HA 2DH5A 2CLLB 2ISQA 2RH9B 1CW2B 2TSYB 3FGPA 4L3VA 4D8TA 4D9KA 1P5JA 5T6MA 2EGUA 5I7WA 4IL5A
chains in the Genus database with same CATH superfamily
3AKYA 4IIBA 4AMGA 821PA 1PVDA 3DOIA 3FLAA 3G2QA 5H5JA 3D31A 1U0GA 4LKRA 3H1TA 1GQOA 1YUMA 2V5VA 3NGMA 5H02A 4C14A 1YC2A 4R9NA 4OHZA 3DT8A 2BMJA 3C1AA 3LYHA 4CLOA 4D56A 4RK4A 3BFJA 1X8LA 1XZDA 3UC5A 4CF3A 4LC1A 4W5HA 5A0VA 2ZWPA 3S27A 3UJNA 4CF7A 5AR1A 2X8AA 4WESA 4MWDA 3O5AA 2WIJA 3M7IA 1Q0QA 1T2VA 1CHNA 1CY6A 2PK3A 1K6XA 3OPVA 3PQEA 5DEOA 5AKEA 2VNIA 2FWIA 1I0ZA 1Q0SA 1KI7A 5I7RA 3DA8A 1XMSA 1VKOA 3NVKI 1H42A 3T7KA 3H2ZA 3UK1A 2V6IA 4AWAA 1VMDA 1JIXA 3AL2A 3O90A 3K1TA 1YD7A 5HXAA 3O0DA 2J0UB 3A9TA 4L6IA 3K71B 1T26A 2IZ7A 121PA 2BGLA 2O3TA 3DZKA 3NBFA 4IQ0A 4AMYA 2V3VA 1HF3A 2ONCA 4RNCA 3VDMA 5B3JA 2BTEA 3ZWPA 2C4WA 5THXA 4B85A 2QRJA 5C18A 1F3OA 2PSDA 3CQ9A 4Q4DA 4WV3A 4LSMA 1UJMA 4ZOLF 3KYCB 2ZYGA 3JXEA 4IPTA 621PA 1YUBA 2HV9A 1EVKA 3KWMA 1XD8A 4FNOA 4JBYA 2PT6A 3PWTA 3AHGA 1IH8A 4D6PA 5HZHA 1DUVG 3BZBA 1N1EA 3S2SA 3Q3HA 3DBVO 4Q1EA 3MJRA 3RF7A 2EYUA 2OGSA 1YIAA 5JMOA 1VE5A 1ZI9A 2B94A 1TXGA 1PVVA 3I1IA 1MT3A 4HXEB 2QIPA 1JPJA 1M67A 3DF9A 5JCOA 4XTRA 1VI5A 3IVXA 4C7MA 1ZCAA 3O8NA 1JBEA 1MXHA 2GZ2A 3QY9A 2HY7A 3BWYA 4GM0A 4UVGA 4Z0NA 4LOAA 3CB2A 2ID9A 2OXTA 3FJYA 3BWXA 2ZZMA 1O9GA 3G0HA 2OM2A 1QPGA 1R15A 1M1ZA 2ATCA 1YS2X 4D9GA 3JYOA 3A1VA 3E22A 1G2QA 4R9SA 4ZYUA 4FE4A 4O6VA 4Q9DA 3UJ6A 2FW7A 2DFNA 4UE6A 4WT7A 1XU9A 2GN9A 1CY2A 3GP5A 1YRHA 3FCXA 3WTBA 1JRLA 4W7SA 4AO7A 1PYDA 4J1NA 1F0NA 1UBJS 2O2HA 3R0VA 4WA7A 1N9ZA 5TEVA 2O19A 2GRAA 4LEIA 5C8YF 2HC9A 2R6DA 3JQ8A 1J33A 5HCNA 2CHQA 1LS6A 2A59A 4HS9A 1G98A 4PLTA 3Q8KA 3MBIA 1U7DA 3O3NB 4QT0A 4F46A 4RLHA 3MWLA 3OMWA 1BMFD 4HJXA 1W1UA 1YB1A 4BFTA 2ZUVA 1YR8A 1B8UA 1E0DA 2G0AA 3IEPA 3BGSA 2EBHX 1WMEA 3F90A 1WB4A 2Q0XA 1CWUA 2RHBA 4DV3B 1ODFA 4ZGWA 4HMQA 2D5CA 5L3QB 1PDWA 4PZPA 1UF9A 2P40A 2IWRA 2GAFA 4ZOLB 1XU4A 3EXAA 5ITSA 2PMFA 2EKLA 4AZ3B 1C3OB 5REQB 3H75A 2IYRA 5DGHA 1GXSA 1T9GS 1M6YA 3NTVA 3H7AA 3TCKA 5TPZA 2GXSA 2YN2A 2V9PA 4TPKA 1Y4SA 2CLKB 4E0BA 4R51A 1U2GA 2JCGA 4ISCA 5LJLA 3F46A 1FF9A 5KJEA 3L0CA 5IKMA 2ICAA 3ZCUA 2IUSA 4TTIA 4B34A 5DM0A 5JUWA 5FORA 4CETA 3K31A 3EULA 4JFRA 5KINB 2FLVA 1VA4A 1Q0LA 4HMPA 4FSHA 1BXZA 4HXYA 3OEWA 4RQTA 4AXXA 1OWPA 2RI6A 5JARA 4FW9A 2ZUSA 1RYMA 4UHKA 2DBYA 1D9XA 5EUQB 4Y30A 3EFBA 1RKQA 1UC8A 4JK3A 4AWBA 4DGSA 5I3ZA 1CCWA 4RM3A 3ILSA 2PUAA 1JEOA 1UEJA 3M5PA 4ZQHA 2ONJA 4QBFA 3BRQA 3KIPA 4HYQA 5L45A 1SOAA 4IYRA 1S4QA 4N41A 2DCMA 1EXMA 2GWHA 2OENG 1TU4A 3ABOB 1BFKA 2J5XA 4LNHA 3HGQA 1A97A 3DNPA 3VYVA 1GAXA 2AN9A 2P0EA 3DTTA 2HADA 4BRUA 3PIDA 3UW1A 5EP3A 5F64A 3E8XA 2ADMA 3ZJ5A 1GL3A 3TSYA 3Q2OA 4R01A 4HDMA 4DBLC 1TIKA 3EC2A 4PRZA 5JSHA 3K0AA 1A2KC 1CUUA 2ZIFA 2ZJ7A 1GPH1 4K05A 4NYJR 2PX4A 2YRXA 4J4HA 1L5FA 2W43A 3FYUB 1RLUA 1VL5A 1ND5A 1NY6A 1ISGA 3A1DA 3PXDA 1XCOA 3QPCA 2GA9A 1V6AA 1VG0B 4BL5A 1KVUA 2C9YA 3WNZA 5KKCA 1NMEA 2GEBA 3M0EA 4W7HA 1RTKA 4KQMA 3EZ2A 2FEXA 3ZWOA 1E94E 3PICA 2PXCA 2R7LA 3PGLA 4BQPA 5I4IA 1ZUHA 3KL4A 4BWYA 5JXHA 2JD1A 1OYVA 2OZVA 1XZKA 3HVJA 4ZQCB 5I7AA 1KU0A 4TSRA 3A7DA 3SM9A 2QPTA 1FX1A 3KX2A 3A3KA 4LCJA 1FFEA 3L92A 4O0LA 5F2KA 1SURA 1M8KA 1IBSA 2GCEA 2HAEA 2P8SA 2ZQ5A 5TPWA 4L8WB 1W8DA 4CQJA 3P2KA 5K0NA 2ZAOA 3E7PA 3LBFA 3HUEA 4FDLA 4IRMA 2HPAA 5A6VA 3Q9LA 5EVJA 3STYA 4EW6A 1VSVA 4IIYA 3DGEC 3EODA 3I53A 5EXEA 4UARA 3B89A 5TB5A 1ZN8A 5FTJA 4F1JA 2H5IA 3QVOA 1DC8A 3A4MA 5FWDA 3OI7A 4WADA 1V41E 1OI4A 3KJIA 3WR5A 1DP4A 5AW2A 2AC4A 5KS2A 3VOAA 1YDWA 3E53A 3UAWA 5AJXA 5HUJA 1XRPA 1VCMA 4B3GA 5ESDA 4Z1OA 2P69A 5C32A 1U2RA 1F60A 1QTIA 2DKFA 5BW4A 4MR7A 4Y18A 5KYXA 3SZ3A 5EZYF 3L93A 2DM6A 4I5EA 5B1EA 3QWBA 4TYMA 2Z9DA 2H48A 2IU6A 4HSGA 4U3JB 3ANYB 4BLPA 5AKJA 4BBZA 1ZOSA 4Y2UA 2IBTA 2W11A 2J08A 3BRWD 5ALKA 1BO6A 2FXVA 5EINA 1QC5B 1YVEI 4HEQA 4GBMA 1T2FA 3JARA 3PRYA 1D6NA 4GXRA 2W2OA 2YZMA 2EX0A 4TYPA 3RHZA 1MCZA 1QIDA 5DCWA 3SQNA 1MDFA 1J06A 1W35A 3ETHA 2JIMA 5KX5F 3VC1A 4AKSA 4EJ0A 3ND6A 3O94A 2YXLA 1YI0A 2VSOA 5JCZA 2PGOA 1XN1A 2VYVA 3QU7A 3TUIC 3A70A 3FMOB 3MMXA 1T9HA 4P7JA 3C85A 4YRFA 2R6GA 4HDMB 3JZDA 4MKXA 4RFLA 1N5OX 4DC0A 4GPAA 2SKDA 4I8XA 2XCTB 2GSDA 1RW4A 1SFRA 4DN6A 5JZSA 3S1SA 1AKNA 1YCGA 3B3AA 2AYZA 3G1UA 1C3VA 1WDKA 4BLTA 4CZ2A 3VPDA 3KUUA 3AEKB 1SQ6A 3DWGA 2CWDA 2YZGA 3JSXA 1UBRS 1YCHA 4DCOA 3EVGA 1Y1KE 3LYLA 4KQFA 2GAAA 4H1UA 4Q7KA 2P2GA 4MRSA 3HZZA 4FEGA 4I9FA 2SNIE 3TM5A 4PW0A 5HRUA 4XVUA 2WVJA 5HSGA 1Z39A 2I76A 3P8ZA 2UAGA 4L3WA 3W9YA 4KIUA 4MCAA 3LOPA 3N8NA 3GEEA 5CK4A 4ZKDA 1KK0A 2DRIA 10MHA 1SHUX 1QNFA 3ENKA 3OLXA 4JJEA 1GLGA 2XAUA 5BWOA 3LUPA 4NS4A 5DX1A 3ZBQA 4G5OA 4KX3A 3W3AA 4BX3A 2UZ1A 1ZLYA 4XB1A 3BDAA 3SWWA 2UUBB 5DH9A 5EZYA 1BEUB 4KO3S 4EPTA 2WYUA 2Q5HA 3RTEA 4ZYYA 5KTYA 4S35A 3B52X 2DAPA 3EXFA 3LHSA 1A7JA 1W46A 2ZIXB 4KXWA 4D92A 1FP7A 1TE2A 1SBZA 1NJ5A 4EJFA 4UFPA 3AJDA 2GBGA 3DFIA 3DVAA 1SCUB 2G70A 4AY4A 1Z8FA 2W2KA 1E6EA 3PX3A 4JBGA 4D4MA 3VR6D 3WICA 1V5IA 2WTNA 1K63A 1N8NA 4TS1A 3F5MA 4DCSA 4C0JA 2PLFA 2HIAA 5L3RA 4P1ZA 4MS1B 4DJTA 1Q92A 4Q7MB 2UUAB 2EW8A 2F48A 3KSZO 4LHWA 4B31A 3LHFA 1FFYA 3PD7A 3MTDA 3PFNA 4JLSA 2E55A 5LXTF 1N6LA 3LC2O 1AQJA 4KPYA 3KNZA 4N82A 2GEFA 3AKZA 1EPUA 4KVGA 4YMUA 2IIBA 3JQ8B 1QHYA 1XEXB 5TQVA 5AVWA 1YVDA 4Z4QA 1NTOA 1IB6A 1SHTX 5BV0A 4XX0B 3V6LA 4DF3A 2BKEA 1ZJYA 3EPRA 3QPWA 4XOUA 1Z0IA 3RVDA 1XROA 1Z45A 1VXRA 1USKA 2CC2A 4QDJA 4F2PA 1U7UA 3B53X 3DTYA 5CT8A 2XQKA 3QIAA 2AOUB 3O47A 4F1KA 2VPZA 2WSMA 4FYPA 3C3PA 1JL3A 1QORA 4B3RB 1TF5A 4D0GA 1D2GA 2C5LA 2OHOA 1I9CA 4Y6LA 4CKWA 1MC1A 3KPUA 2C9CA 1OC4A 1C8BA 1JEEA 2PH1A 1ZCFA 2QF7A 4LY3A 1NNSA 1TYEB 2B69A 3BWBA 5IAJA 1J42A 1N5IA 4MMZB 1KSHA 2NTEA 2UUPA 4WWHA 4CUZA 2ZBEA 1WULS 4HKTA 4KXNA 4REQA 2BFNA 3A1CA 3PLRA 1JFVA 5JCOC 2F3TA 3IDZA 1NPDA 4RTOA 4YO8A 1QR6A 5C31A 3UN1A 3RWOA 2PJDA 3EXEB 2K6GA 4LTNA 4H3SA 4AJNA 5JQGA 2WYIA 3OUUA 1RRGA 2P9CA 4PZUA 4YDQA 1L7PA 2WKQA 1W36D 2I6FA 2XTAA 2F8SA 1M2NA 1P33A 3ZG6A 2VOEA 4QM7A 3MB8A 4BDTA 3EW9A 1L7EA 4E1BA 2LZ0A 4LXQA 5CHYA 4YGXB 2BH2A 4NESA 3BGOS 4QAJA 3QELB 5CLFA 3HB7A 1NURA 1LRJA 1K3UB 2J0SA 2V5UA 3NI2A 3ENQA 4YCMA 1FU7A 3E2MA 3COYA 4EA8A 1C8KA 1J8VA 3D6VA 1VE3A 2CLDX 3BD6A 1G3QA 4EHBA 2RCYA 4WAUA 4HQLA 4YEDA 3AVQA 1XMJA 2BE9A 3DOFA 5DKFA 3EC1A 5EWLB 4HOYA 2NACA 1E9EA 4EYOA 1EFDN 2QQFA 4NEQA 1DT3A 1UT8A 2FZWA 5AIBA 4FC6A 2OZKA 3FCSB 2X4GA 5BSKA 3GP8A 1EQ2A 2WNHA 2BFCA 3ZCXA 5LD2B 1X38A 3BBPA 2J7KA 3RVKA 1N33B 5TX7A 4QUEA 4ZJYA 4A0HA 4D46A 2Q3EA 3UH0A 3EMKA 1OILA 1LPPA 4OHRA 2VTDA 1QGUA 1P4GA 1UMBB 1YR2A 1P5ZB 5I9TA 3S2IA 3SF8B 4AG3A 5KO2A 3KKPA 1LBIA 3GMSA 1GNPA 3BICA 3QEMA 4RETA 2I03A 2D6FA 4DIUA 1L5KA 3CLUD 4P6VF 1KKMA 4QUGA 3ROTA 2M98A 2ZYRA 3CVXA 5THKA 1W5FA 1AKEA 3EGEA 3QE2A 2QTNA 1OD6A 1OFTA 4LGMA 3TGWA 5KWSA 4RMIA 1CY8A 2PPVA 1A95A 3F3KA 4Z4IA 3ZVNA 2CE7A 3Q7RA 3IO3A 2PU5A 4MW1A 1UXGA 2FVXA 2GPTA 4P7FA 3M9WA 4WLOA 1MHTA 2YV5A 2WILA 1HDXA 4X85A 4X41A 1Y1QA 4GOND 3DPSA 1PQ4A 3QFTA 3QI7A 5F4ZA 2C20A 4R2JA 2JLXA 3UCXA 1JQAA 1P9NA 1JSRA 4IHJF 1Z8DA 2XB4A 4ARIA 4B74A 3MJSA 5B6PA 4PNZA 4W5RA 1IPEA 1YBMA 3ASZA 2B4AA 4TZTA 3RH0A 2BFPA 3R7NA 3C16C 4F2GA 3EIXA 4DDVA 5FEMA 2PTHA 2PNJA 3UMVA 3OWOA 4AZVA 1M72A 2V55B 3PC8A 3DJFA 3NO4A 1P4SA 4YB8A 1E5QA 1FNBA 3DCJA 3DKVA 5DNVA 4HEJA 4ZAYA 3A32A 1AZTA 3VMFA 3W90A 4YONB 5JI3E 1KI6B 2QTTA 3CX6A 3RSSA 1SVMA 3HUDA 3IMKA 3R3VA 4HCJA 4UXHA 4WOCA 2ABWA 1KYIA 3G82C 3PUXA 4PPYA 4QTTB 4MVJP 3W2TA 3ZE6A 5AFSA 2ZCVA 5AH0A 3V32A 1LRKA 4F04A 2ZAIA 2E48A 2QTFA 4X1YB 2PX5A 1A9OA 3M3DA 1EFRD 5KSPA 5IC6A 5HNKA 2JIPA 3JQ7A 3OVMA 2LRHA 2XITA 3IELA 4TVSA 2P41A 4O1MA 5CCBA 4S1NA 4NY1A 5J5AA 5JWOA 1MC8A 3EZXA 4QGAA 4F8YA 1D5WA 1UODA 3X1KA 3SFVA 4IVNA 3R7SA 3R0JA 4R71A 1LZKA 1XCPA 3KKEA 2CFSA 4L76A 3ROXA 2CUTA 4IGFA 4LVUA 3GDHA 2IC5A 1L7VC 1Y82A 4N7MA 3VV2A 1X74A 4WGFA 1RM3A 3C8UA 4WY8A 4A2CA 3I8SA 1JBQA 1XG5A 4CL8A 4MQEA 5BQOA 5K0BA 2QTVB 3CXUA 1KAQA 5DXAA 3SD7A 5JSZB 1SVNA 5ALYA 3A6JA 4V0KA 4QZVA 4P58A 3O1LA 4U0JA 4C04A 4KX5A 2ZAYA 5HX7A 5CH8A 2JLBA 1X15A 1OFUA 1Q20A 3SS8A 3URMA 5K99A 1J25A 3LP6A 4XVRA 1E0AA 3CZ4A 5L8VA 1UMDA 5EQDA 4OGLA 2W5UA 4LYDA 3AEZA 4BVKA 4M8KA 1T0PA 2QS9A 4RE6A 2OQIA 1FFHA 5LZ4A 1RAHA 4FGZA 2ZJZA 4XASA 2RHMA 3B5EA 1E3EA 1BMDA 1DG1G 7YASA 3GWZA 5KJCA 4DR1B 1N5RA 2CXQA 2IZZA 4NZYA 4O8CA 5EQJB 3RC9A 3FIJA 5KYGA 3Q7QA 4GPZA 2FSGA 2PHZA 1EUCA 3GDOA 3O74A 4JQCA 4R8RA 1W88B 3JVEA 4MDHA 4E88A 2Y2VA 5JH7A 3TR6A 4U4AA 1DTWB 3L3BA 3B1WA 3ADBA 1Y33E 2RHTA 3N70A 4E12A 1HDEA 4FD2A 1FQWA 3L7LA 2W6PA 3TRDA 3UAXA 1U8TA 2BFCB 2FPOA 5E95A 1O8BA 3IQDB 3OESA 1U3VA 3O4VA 4ZZIA 1W5SA 1CZKA 5EWLA 2GXUA 2O2IA 3NWEA 3VOSA 2O2DA 3BIFA 3OOEA 4Y9SA 1E4VA 1I3CA 1RT9A 2PUVA 3IE0A 4L73A 1NJ8A 3NM4A 4PR0A 5FB3A 4BIMA 2P4UA 4EFNA 3EXG1 4ZOEA 1C7JA 2A86A 2GCGA 2GWRA 4IDCA 2XWJI 3BCUA 4UJ3A 2PQ0A 3T3MB 5A02A 3GRCA 5A1JA 2W7TA 2QQGA 1BKYA 1RWXA 2AZDA 1YJCA 5F7XA 1FSGA 2LCFA 3C6ZA 3IV9A 4RHFA 5JSQA 1PVOA 1PV2A 2OLJA 3GJSA 4Q00A 4ZAFA 1ZJ5A 2OPHA 5JNRA 2YKGA 3L8MA 5HQ3A 4MICA 1KEEB 2FYTA 2NZWA 1D7AA 4FFNA 3VNAA 4DL9A 1L0BA 1NE7A 1VPEA 1QOPB 1L7AA 4PO1A 2NU8B 1QAQA 1MQ9A 4J3JA 5J23A 4YAWA 1SKYE 4KQ2A 1BN6A 4LIPD 4XKJA 2FUKA 4OQXA 4JC4A 5KTRA 1JQJC 3WJ1A 4JUIA 1XVVA 1OSNA 3GT4A 4HDSA 4DIKA 2QL5A 1U7TA 3ZU6A 2YOFA 4CKWB 3B9RA 4M0KA 1FX0A 5BN4A 1SUBA 4GMXA 1A50B 1JLSA 1IUOA 1N5JA 1XLVA 1FTSA 1VM6A 2Y68A 4JQSA 1KI9A 3F4BA 2QPAA 4CKCB 2QQ5A 1OZAA 4UPEA 1ZP6A 3IH5A 1OXXK 1Z9BA 3AESB 3D0RA 5AWFC 4EAAA 1AOXA 1KARA 1PNTA 3BTVA 4D4KA 2MINA 5GM2A 3OIFA 5CCDA 4PS0A 2VF8A 4LE1A 3B70A 1D1SA 3TZQA 4IJWA 1ZXLA 3TEJA 1K7CA 3VDNB 4NU6A 1F2UA 3QG5A 1LLFA 4KMSA 4C2TA 3FM9A 2G5GX 4G5GA 3UWSA 1YT5A 1HORA 2B3DA 2VF4X 2XKBA 3DAYA 4LBWA 3D7LA 4N3BA 3H11B 5C37A 3DLBA 1QVWA 1NKTA 3L02A 1S2MA 1IATA 2QRVA 1G5FA 3QBEA 2QUHA 1XMOB 2WLSA 4BHTA 1JWBB 1U9CA 2C84A 4E3ZA 3AI3A 1SU8A 2JKZA 3OM9A 4U6NA 4ZAVA 1TYAE 2O3RA 2ZI6A 4I4TB 3L1UA 5CNKA 2CFIA 2PUTA 3KWFA 4OF4A 2IEZA 1RYDA 4KMRA 4C88A 4O4JA 4YI3A 3L7DA 1FRNA 2HK9A 5H9WA 2NSYA 2VSXA 4GBGA 4FFMA 3VC2A 1MO6A 221PA 1NOJA 16PKA 3PPYA 1H1TA 4LJ4A 4XFDA 5EZYB 3BD7A 1YU6A 3LBYA 2EX4A 3CLHA 4X1KB 3NUQA 4KQWA 1DINA 3BL6A 4TTJA 2OBLA 2WD7A 2O2ZA 3AOEC 4DMHA 2C03A 2NUPA 4ZQEA 4ZIRA 3B82A 3AKCA 3DL2A 1V8DA 4GVPA 3QEBZ 4KVZA 4MH0R 3GXOA 2P9EA 3URKA 2FFJA 1XO1A 3C6KA 4F0JA 2MT9A 4WNAA 1C1DA 1WF6A 1ENOA 1UK8A 2BKVA 3NC4A 4JOQA 1QHNA 1MJFA 1TF2A 2OB1A 5DN6A 4BC0A 1SPXA 4FFOA 1PEKE 5KQRA 2ZBFA 5M34A 3FHCB 4V0QA 1UT6A 5FTWA 2FRXA 2Z4TA 1YQ9A 2XX3A 1SG0A 2Z6AA 3GAFA 4X94A 3RS8A 3QJGA 2WYWA 3NJRA 1XZIA 5BSTA 2GJSA 5EE1A 5A7GA 4DANA 4QIHA 3TRIA 3W8FA 4DQUA 5ABPA 4MQFB 5B53A 2AJTA 5KKNB 2WWRA 3AP2A 3NQ41 2IGTA 5GINE 2JLYA 4JGBA 2R7MA 4BVEA 1L5QA 3VU8A 1EM6A 3FGNA 2XCSB 2JJYA 2JJ8A 1KMHA 1R3DA 1Z28A 1KGDA 2HNKA 3TAHA 3AUFA 3BYZA 4MGKR 1E2DA 4IHJA 1ZUD1 2ISCA 2HBZA 2QA5A 4TQUS 2JFUA 3S7TA 2XMPA 4E15A 1UFVA 4BAZA 3C3AA 3EUAA 2X13A 4EGJA 4BO6A 4G8CA 5GJWC 4H27A 5HK8A 4KQ6A 2Z2YA 1DWOA 4Q4CA 2E6UX 3P0EA 1UWVA 1JI0A 3OPXA 4G63A 5G0SA 1HOTA 4JL5A 3FTCA 4WA8A 1UPFA 2GAJA 2CHFA 2CXOA 5GPBA 1VXOA 4X64B 4AS3A 1TQ2A 2H5EA 3EXHA 3GJ5A 4V0NA 1CQWA 2PGXA 4EVQA 3WBBA 2Y2UA 3UKJA 4ZYVA 2EQ5A 3CGWA 5EE0A 4URVR 3E0QA 3B3QA 4XD2A 4BJ5A 5CFQA 3H2JA 2L82A 5ECWA 1ZFNA 4M1EA 1DLJA 1Z68A 4FHZA 5FQOA 2QV0A 2VTKA 3EBLA 2OTCA 1PYOA 3TMAA 2NZ2A 4QO7A 1EX1A 1QFMA 3LHKA 4II2A 3N2YA 4YCJA 5FTNA 5CYPA 5KMGA 3A1FA 1Q0TA 2NMVA 2IXFA 3K35A 3WL4A 3T3NA 2JIZA 1V7PC 1FDVA 4B80A 1SBHA 2R1VB 3BH0A 2R4QA 1C7FA 2JEYA 1LA2A 5K5EA 4C1NA 1SBIA 2RHJA 3N2KA 4GEGA 4KBYA 2H7VA 5IP5A 3WDMA 5EIHA 1Z17A 3V34A 3AR7A 2Q4BA 4KPGA 5AKGA 1JHAA 1K0FA 4TKLA 2A0WA 4JITA 4RSHA 3R9XB 2PGNA 1P2GA 2P9YA 5B2EA 1SOMA 1BW9A 2FP4B 3OZEA 2ZRLA 5IT0A 1BEZA 3UY4A 5KWVA 3KJZA 5ADVA 2XZOA 2CDNA 3T34A 5LNK1 4MVWA 4CDRA 4DV1B 2MYTA 4N12A 1ZK1A 3N3BC 2G5TA 1MA0A 2W6JA 5DOVA 3HMKA 5CFMA 2BGIA 1ONOA 2JGDA 3QHPA 1KMQA 2KI5A 4EYSA 1QP7A 2AG8A 1A0OA 3QBJA 4R1OA 5CUQA 4NJMA 4C7JA 3RV4A 2XWBF 2BGUA 1ZXBA 3MJ4A 4RS3A 1E3TA 4JI2B 2NSLA 4XH9B 1X87A 3U81A 3WGIA 3SYNA 2B1RA 2QLLA 1JIQA 2EW1A 3MUFA 4MVJE 4UMVA 4EYGA 4XWWA 4D25A 1D2AA 4WERA 5DXFA 4A5SA 2I55A 1KEWA 3LBHA 2QPOA 2R6ZA 1SCDA 2ZJ4A 2R8ZA 4JHLA 2H17A 2P6MA 3F1LA 2I4OA 1MUUA 3B6KA 4D79A 1LI5A 4XR9A 1E2LA 4OQDA 3JQAD 3ZK9A 3DZFA 4F4JA 3WLNA 2OZEA 5DWQA 5KJFA 1HETA 2O0KA 4LQLA 5AW9A 1I2AA 2QGFA 4P81A 3KLMX 5AVUA 5IYZA 3EH1A 2VDJA 1G42A 3AHIA 4OQPA 5CFNA 4MKZA 1KTIA 1JALA 4F2DA 3I2KA 4DIFA 1KNXA 4EHNA 2R1UA 3HYLA 4PIPA 3G7NA 4GPIB 4IDQA 1NP7A 1H5UA 1SXJE 2C99A 5L7TA 1ELOA 1HFWA 2WV9A 2WVAA 4OHMA 3T4PA 3AEUA 3H16A 3QKTA 2NPOA 3IUNA 1TTHA 2FN9A 4OBXA 3FUWA 3IKVA 2RK3A 2D1QA 3MYYA 2JCBA 2HHAA 3KBBA 2GFQA 1E1QD 4R2LA 1TO6A 3GELA 3MAAC 5ANRB 5FADA 3T4XA 1Z8HA 3WSVA 4B0PA 4M8SA 4CHTA 4V24A 1YOBA 1FFGA 4UPVA 4BV3A 1TQDA 3DKPA 2C1XA 2WM8A 4PIVA 1QHFA 1C3OA 2H1RA 2IE0A 4DZTA 3BMCA 2BF7A 1WW2A 4PAOA 1F4VA 2J5RA 4U6SA 6YASA 2E5LB 5F4BA 3KTDA 3AVWA 1LBEA 5L3QA 4YPVA 1P7PA 3F7MA 4TWAA 2BSQA 4NBSA 4X65B 2QRKA 3WZLA 4ZU3A 4WFQA 3WV4A 2L2QA 4GIBA 2MWMA 2JW5A 1CUZA 2H6EA 4QBHA 1IZ7A 4FDTA 1M73E 3BQMB 2P27A 1X7YA 1NXWA 1Q11A 3MQ4A 1DADA 3K1ZA 5DV9A 2HYIC 1XJCA 1A1SA 2RH8A 1PR4A 3PDJA 3NIFB 5AESA 4XIYA 1IBRA 1Y5RA 2WTBA 2ZVDA 4PONA 1ZS9A 3GWGA 3MJEA 4NCXA 2HK7A 2WHYA 3WLSA 2EP5A 3U4QA 5JAZA 1OI7A 3GNTA 3P32A 5LFAA 4ZI7F 5JCPA 2CL0X 4LXHA 1ZAKA 2IIQA 1FFXA 1GZ4A 2FEMA 5HOQA 1N34B 4HDCA 1CDEA 2R7NA 1SKQA 4CF5A 8MHTA 1P7ZA 1J49A 3WB1A 3SQWA 4QUHA 2QSUA 4EB3A 3NDPA 2QR5A 3PQFA 3GPIA 3LC1O 5LQKA 1WBDA 2COEA 5JS6A 3IAEA 1XZNA 4BLVA 4DR5B 3EGDB 1PZFA 4TMFA 5K8UA 1R0WA 4WEOA 4AG6A 1WTCA 2I6UA 1NVKA 2NU9A 3N0TA 3WJ2A 4B3HA 5MF6A 2P5SA 3M1YA 3GOHA 1P2VA 3PDIA 3AIKA 1JAHA 3PUKA 4MRAA 4UATA 3CUKA 4H59A 1L5ZA 2N75A 4ZP1A 2HQBA 2PV7A 3H5LA 2IGBA 4Q24A 5JVDB 3S8EA 2E85A 3PVZA 4XUDA 5DLEA 1ODLA 4HFMA 2OYSA 1OXKB 3I5MA 4HYTA 4AMZA 2Q6KA 1GZ6A 1ULAA 1J2YA 2ACEA 2OB2A 4KL8S 4ZO4A 4ZI3A 1T10A 2XQGA 3GC6A 1C0PA 2C5FA 4X60A 3G8CA 1YULA 2ZSFA 1IIRA 2IUTA 3VVMA 1LVGA 1WBBA 1EUDA 5T4EA 1LXCA 3JQ9A 4XLLA 2B83A 5G3ZA 1ZVVA 4RADA 2GD1O 4LXUA 1PR3A 2J0UA 3F67A 3PHIA 4KGVA 4LXIA 4N6OA 4O2AB 1ZG3A 1AGNA 4AJ2A 4DDKA 3L7AA 4QHTA 1VYHA 1NN3A 2O3QA 3TIGA 3ZD8A 3C4VA 3JY6A 3HJNA 1W2GA 3P2OA 4UUOA 3MWGA 1N2JA 3HRKA 4ZZ1A 2HSEA 1YBVA 4QX6A 2YQ5A 3ROKA 2FW9A 2FW8A 5HFAA 3MJTA 2Q9UA 3ZNNA 4E5KA 2G82A 3P1JA 4F12A 1HUQA 3PZBA 1FBTA 3PYXA 1GKUB 2CD7A 1ZSYA 1CIJA 1GTG1 1G4UR 1PJ3A 1UJNA 1XCMA 2FN3A 3D7KA 4GYYA 2GJKA 3SX4A 3WIVA 4MNTA 2EJVA 2IZ5A 3RFTA 1MX5A 3WL3A 3AB8A 3Q41A 4CTOA 3I9MA 4CLOB 4H7PA 3MOIA 1P0PA 2IZOA 2F3UA 5BR8B 1XRLA 1UZLA 3UBMA 1YDHA 1GLVA 3ZHOA 4ZHQA 5IMSA 3FMFA 4U6QA 4D3ZA 3OCWA 4UVEA 4BP1A 4MITA 4ZCIA 2SKCA 3GRKA 1DCFA 3MINB 3HU3A 1AQLA 1D5CA 1Q6ZA 3TIFA 1KK2A 1NUTA 4PU0A 3UG6A 1WXHA 3IHLA 2AXQA 4PG7A 1S02A 4DVGA 2L19A 3WWEA 3OY2A 4AI6A 1EG7A 3DE2X 4BEJA 1O4VA 2NVBA 1OJ7A 3F2IA 4E4RA 4WGGA 4DDTA 2W6NA 1DTEA 5KUTA 1OH7A 4ESOA 2PMCA 3EZYA 4Q37A 1ZW1A 2HWKA 4PZ0A 3A6EA 4ACAA 4IF4A 2J6CA 2B4KA 4Z49A 4ND3A 4OLAA 1XXHA 4NSNA 2INGX 5K8TA 4OHPA 2O50A 3HLYA 4QJ5A 2XODA 3HZRA 1LH0A 4W4TA 1QS0A 2DJ5A 1E0JA 3THSA 1UAGA 2H4ZA 1JFFB 4FS8A 4ZPJA 1AKTA 1GRQA 1UM8A 5BVGA 3BMNA 1R0XA 5EPUA 1V16A 1KYXA 1FZQA 2B9VA 2OG1A 2Y27A 1VHWA 5H83A 4J2HA 4FIDA 4OAQA 3TLXA 5IARA 5KYTA 3PEEA 3IEVA 2WM2A 3E3OA 4B6SA 3P9CA 2KE5A 2C3OA 2P9ZA 4KO4S 4RTSA 1B6TA 1P8AA 3ILHA 2R7KA 3OEHA 1C7ZA 2OXIA 2G17A 4DIEA 1OLSB 1MO3A 2YR0A 1GVHA 5KHLB 1Z6XA 1W0JA 4KHZA 4K1XA 3AWDA 5BWNA 2NLOA 1Z6YA 3GMIA 4BKUA 3ASYA 2AH5A 4BPRA 1OXSC 3LFHA 1Q0PA 2ZJ8A 3GV0A 3TGPA 1MAWA 1W4CA 2FWJA 2HRDA 2J6HA 2IXBA 2PO7A 1JGTA 3QZUA 4PG5A 4PLYA 1IHUA 3THRA 3UJAA 4M1YA 3RYHB 3V4RA 1NUPA 1OX4B 4B6RA 1KZ1A 2VDMB 1XJQA 1A27A 2Q50A 2J3MA 1JPUA 2GHIA 3L0OA 5F78A 3VGPA 1A2OA 1XLTA 4YCBA 5AJUA 5H1YA 4UNPA 3H5NA 1S8FA 3O8QB 4JLPA 3BE4A 4TZKA 4YJ2A 1Y8QB 2BY4A 3X2SA 1N8KA 5SYAA 1OA1A 1Y3CE 4J0EA 1L8XA 2P4QA 2R97A 3PJFA 1PKXA 2IUFA 3I6BA 5E9JA 4R1LA 2BP7A 5JWRA 3BT7A 4KDEA 2GN0A 2BKXA 3RIEA 2ZYTX 3OQIA 2ZYDA 4QQRA 1LGYA 3RFVA 3MVEA 2JCYA 4JJGA 3S2UA 5LP6B 3MW8A 4UVIA 3BPSA 3KOUA 1E2BA 3ZHYA 1Y1SA 2XUHA 3MXTA 3O2JA 4KQJA 4URXR 2PY6A 3QVGB 4PYMA 2EP7A 1AS0A 1CIPA 2I99A 3GF4A 4R83A 4MWSA 2XBMA 1KRWA 1P81A 1QHIA 3ND7A 2ODTX 4GQAA 3U6KA 3HO8A 5EA2A 2VHQA 4HR7A 4RCZA 1C5KA 1D8AA 2Q1YA 4Y2SA 2WIBA 4EG1A 1HYBA 2GEDA 1EVEA 3V8MA 2AV6A 4P4SB 4ZQGA 2M6RA 2P65A 1CEXA 4HFJA 2QN3A 4I99A 2VJNA 1AGRA 2HUPA 4BQOA 2K2WA 3R5SA 2C54A 3L6EA 1Y4DE 2F1JA 1PUJA 1XTJA 1EZ1A 1W44A 2BM0A 4DSNA 1HNWB 1ID1A 4P4LA 1Z4PX 2RC6A 3IP7A 1YCDA 2HTEA 2GPAA 4X20A 1JU3A 1FLVA 4XI9A 5DN6D 3EEOA 4XVHA 5FWXA 3UXYA 4DYHA 1KP3A 1DG9A 4TMVA 5EMNA 3DAHA 2CVOA 1XQYA 4G1MB 3KUDA 1O2DA 1NVXQ 1JT9A 2DWQA 5JNLA 3QUTA 4HPWA 3R6LA 3WOVA 1NF9A 3K9GA 4IQ8A 4IKOA 1JEAA 1X80A 3FCEA 2MSKA 3LY8A 2FHSA 4FYHA 2VJAA 2D0IA 4DABA 3TRKA 1GRNA 3D7RA 4RORA 3SZLA 5G53C 2VLIA 4HQ0A 1UWLA 4TLAA 3FWKA 5HBRA 3W7BA 2ZJYA 5BQ3A 4DZZA 1N0VC 3GOQA 2XUQA 4KB5A 4KPUA 5ALWA 4B3XA 4YJ2B 2YINC 2J9GA 3KZKA 1A9ZA 1DX9A 1SHLA 1RBMA 2ODBA 2VAMA 5GV7A 4BUCA 3LKZA 4RENA 1QUEA 3O91A 4KE8A 3G68A 3FRIA 4IOKA 4CM4B 5IJ0B 4X5OA 1MQAA 1CERA 3H5OA 1HLPA 5J5CA 1VP9A 4BFWA 3J80A 2PD6A 2Z8YA 4JVNA 2ZLBA 1TVMA 3L84A 1AA9A 3BFXA 5ICSA 2JZOA 1SXQA 2IQIA 3E9MA 2AUMA 2DECA 3RAJA 2NVWA 3H1BA 4M8NE 1K8XB 4IIJF 1QR2A 1V6SA 2XNJA 1X70A 5HJ5A 5DX8A 4XSGA 3NDRA 4WFIA 4U2BA 4GLLA 3PXAA 1RHMA 1BE1A 5I4KA 2IVFA 2FG5A 1LRLA 1L5VA 1QAMA 4P34A 2P68A 2QR2A 2DU8A 2JIOA 2XUIA 4BYGA 4QGGA 4B45A 3R3UA 5GJVC 4X00A 3ZGOA 1BIFA 3VR0A 3WKAA 1NBAA 4CKBB 3TKAA 4E5MA 1YE3A 1QS0B 1NLZA 3ZY3A 2MSWA 3DV9A 1KAOA 4LX8A 2W4MA 1PUIA 1VLHA 1K5GA 2R4UA 1YC5A 1D2RA 2WJ6A 3AB3A 3CF6R 4MPJA 4RGBA 3TAUA 3TSAA 2O3JA 1ZUNA 4KPFC 2JI8A 4KYTA 5EP4A 4F5DA 2A5JA 2XUAA 2CYAA 3V1UA 4MUFA 2OGZA 3IJ5A 2ALJA 2X7JA 3H8JA 2TMGA 3VPGA 4RANA 1IRIA 2HOQA 2WWFA 3E18A 3A26A 3R7FA 3P2EA 4FCVA 3PCTA 4MAFA 1GZDA 1ESNA 1U0FA 4MVYA 1KVQA 1EJ2A 1XLWA 1M6EX 2QD4A 2I1WA 4PYQA 4FINA 1CP2A 3P2IA 2AW5A 1IEWA 3B2QA 1QG6A 4PQRA 1MRZA 3ASVA 3CEJA 4Q3NA 4B84A 4F3NA 5C7IO 1E7WA 4RHYA 3FTNA 3J7AC 3J7TA 1PX0A 3P9YA 4PAWA 5E38A 4RHEA 2FAXA 1Z2DA 1LEHA 4L5IA 1ZGJA 3IKLA 1K06A 4AUKA 4EUEA 1XDGA 3O4IA 2AC2A 2H31A 3S8YA 4CQNA 1TL7C 4BLUA 3MWEB 1O1YA 4OL9A 3E9EA 1QG0A 3W5CA 2GM4A 4NP6A 3OZ7A 4ZO7A 4R1QA 3DEHA 5IK2A 3IBYA 1KDZA 1TGVA 4HD8A 4N7JA 1SCBA 3BRCA 4GQIA 2C57A 3FI0A 5AUPB 1XVIA 1WB6A 3NTQA 4Q4AB 1BVYF 2B8NA 3W5HA 3F0TA 1Y6JA 1MMFB 3PXBA 2PIDA 3VHLB 2FWNA 5CA1F 5JDIA 4JELA 3ZW8A 1DBRA 4HDNA 4Q0MA 1T9GR 4DW8A 3VPBA 4E2WA 2NU6A 3EQ2A 2J4CA 2HQRA 4BX8A 2ZYVX 2I8CA 2QM8A 4HB3A 2YJTD 4FSDA 3F6CA 2B8EA 3L8YA 4A36A 1IDN1 1X8KA 4LE0A 3QP9A 3CURA 4LHYA 2YMMA 3H9QA 4QNMA 3O7WA 4ZMBA 1CS0A 3EGXB 3NWBA 4DLPA 2V5AA 3NRCA 4YHBA 4WDQA 5DYTA 1A98A 5E7JA 4CCYA 3MWDA 4LZJA 3CNOA 2ZB8A 4GYJA 3QEJA 2FH5B 5EUCA 2JK0A 4W9NC 4XWTA 3MQ2A 3CH6A 4IEFB 5AI5A 4UJ5A 3IAXA 5BSFA 5EJ7A 1V7QA 1K7YA 1CUIA 4AMUA 3DDNA 4I7EA 4M98A 5K3FB 2ST1A 3GJ0A 1G6KA 1Y0BA 1EEHA 3AF5A 3ILXA 3TB4A 1EH5A 3BB4A 1RQXA 1A72A 1XRRA 2PGIA 2YX1A 3HXLA 1U8AA 3DXZA 3FPSA 4YJHA 4NYIR 3EGDA 5CW1A 5F2OA 2JDIA 5LC1A 4AICA 4CM5A 5FNZA 2OAP1 1EDEA 4BZWA 1N8TA 3OBIA 2ZSHA 3ITNA 3FVQA 1RWWA 3KR2A 3TLCA 1IEQA 1NI5A 3JPYA 1K8QA 4RIGA 1E1MA 1Z0KA 4PV7A 2AOVA 5HF8A 3M4NA 1BQ3A 3OZGA 5HF6A 3C39A 3RVMA 2PS3A 3W2HA 1F51E 3VTZA 4KNWA 3UTCA 3WYEA 1ZNZA 1M8JA 4U7JA 5LA6F 3U44A 3HR8A 3IT2A 4NYJQ 4CU5A 4UDNA 2H7YA 1PHRA 1W19A 4OUDA 4BUJA 1UKBA 4UQLA 4J94A 1HBJA 2UVDA 3LT4A 4IS3A 2FR8C 3O8OB 4QQKA 5FKJA 4MQUA 2WOOA 3T7EA 3ZUGA 3PB3A 5TF0A 1YRBA 2OE2A 3TBFA 1ZVKA 1KY4A 4ASUD 1THTA 4URHA 1FSFA 4KC0A 4RVCA 3ORHA 2RBEA 5JO0A 2B21A 4WZZA 4JLDA 1F8UA 2DJIA 2VT3A 3WGHA 4NOMA 2P7HA 2IV3A 2FSFA 3UH1A 1Q0UA 2BDUA 3O4JA 3W04A 3MT8A 3AOGA 1XTKA 5F12A 1P5RA 4B46A 2G06A 4Q18A 1U7PA 2JAPA 4YUZA 1FDRA 1WF3A 1C3EA 4LJAA 4TT3A 4YFVA 1U0RA 2GPSA 3GRZA 1GU0A 2H4WA 2JHPA 3DE7X 1KOLA 4JEMA 1CD5A 1MTZA 1I94B 1TUBB 2YXBA 4R2XA 2OR3A 5TARA 1QCDA 4HRYA 2PEYA 2PWBA 2AFHA 2I2CA 3L6RA 3CVJA 3NEJA 4D4GA 1L7BA 2VYVD 1DL5A 3DR5A 4MV3A 3IUEA 1T2AA 1D04A 3NWJA 4LGVA 1FUIA 3IMCA 3LRTA 4W1PA 1L7MA 5FWAA 2PV0A 1I5RA 2E49A 2Q4RA 3NG1A 1JT2A 5AM1A 2PGJA 1JHYA 5LWHA 3KYDB 3CLRC 4M55A 2PUCA 2YN0A 1QGDA 1JE1A 3ZDYB 3RUEA 2XKAA 4LHVA 4V1CB 1PYGA 2B1JA 3AUJB 1AGXA 2PUDA 2AOTA 1GSAA 1ADBA 2J5KA 3U17A 1P2BA 5TVGA 2HO5A 3N6VA 4AJIA 1I6MA 1L4UA 4AY6A 3N2GB 2ID7A 1GGVA 5TJ9A 4IDAA 1ZBQA 4LHXA 3M4YA 1PK8A 3CLSD 4C4AA 4E5YA 1K2WA 4FXPA 3ZJYA 4D5GA 1UT5A 4I8DA 5BVHB 2MIIA 1C9NA 5HQJA 3CPJB 4ZVNA 3NP7A 3NX4A 3IE1A 4QOFA 5BP7A 2FGKA 3FW1A 2CK3A 3OPNA 3H9GA 4MXDA 4UREA 2IL1A 3QV1A 2A9FA 2XCRB 1ES9A 1GDDA 2HWUA 4FE3A 2PS0A 5B36A 1B6SA 3V33A 5B4TA 4J1SA 4NABA 4ER0A 2C92A 4KDRA 3DTNA 1RLJA 2ERCA 2HF9A 2W8ZA 1BMTA 4NJMB 1LCIA 1T36A 1CQJB 3I72A 2WY2D 4WKCA 2GM9A 3GZNB 1V47A 2WTUA 1NYLA 2Z5LA 4AJLA 2QLFA 3UM9A 1ID8A 5CXUA 2XXAB 4YWJA 1D0IA 2YOHA 1AQ6A 5KNCA 3P94A 2NUTA 1GQYA 4Q4JA 3U4DA 1OU0A 1GKKA 4G41A 4N49A 2Z5FA 1D2CA 4OJMX 4JEUA 4BO5A 4TV8B 2ZVPX 2PSHA 4K9SA 4PZDA 3ZDFA 1V1MB 1ZD3A 2AR0A 2ISSD 3BA6A 5TS3A 3ZJTA 2I87A 2NU7B 3L2OB 2OO7A 3D2BA 2XVAA 3EF0A 3HDGA 1EZZA 1NW6A 5BVHA 4GI1A 4AP5A 2F1OA 4URYR 4RZIA 2WJHA 3EAFA 1VSUA 2R5FA 1Z4OA 2P2LA 1HDOA 1JHQA 2DMRA 2EJWA 2FR1A 3H1PA 3K5WA 1B2LA 3T52A 3U1VA 5EXDA 3GJZA 3WGKA 2AS0A 2BMVA 5A3JA 1D4FA 1F4LA 1W96A 2ZJ6A 4K9QA 1GNTA 3L1KA 4IIXA 4R9UC 3RTCA 2AJ8A 4D9JA 5HHTA 2XUJA 2G8LA 2E5WA 3EE6A 4NZ9A 1RPNA 4RC9A 4TS9A 4IM7A 3DEIA 1ONSA 3KQQA 4XOIA 3HG7A 4DYDA 5KJ1A 4RTNA 3KSAC 5CTAA 3ET5A 3LMKA 3QX7A 1EU1A 3V2GA 4UOQA 2QM7A 1CY7A 2D4HA 2R6JA 1QDEA 2RGAA 1E3WB 3M4JA 4J43A 2ZUUA 3D1JA 4DHWA 3IJPA 3VKGA 2JAWA 5AKZA 3RHFA 2D1SA 3VDQA 3H86A 1VPLA 2FF7A 3A9CA 3LKBA 4GVLA 4IXTA 3DFKA 4DIMA 1FFSA 4CEIB 3NH6A 1XIVA 2H92A 2OHVA 2P9BA 2X5JO 4QE3A 2ZYAA 3EFEA 1MJNA 1SIUA 4CWAA 4MUXA 2CF6A 4JVLA 4GX5A 4Y6RA 5LJIA 3K2IA 4PX5A 5K51A 1YE8A 2DT8A 5F1PA 1II9A 2FPRA 3PG5A 2XOXA 2TRSB 3H65A 3U3ZA 2E3JA 2H54A 1TOAA 3GN2A 5CB0A 3EIHA 2WU0A 1OAAA 2BCJQ 3IAS6 1NZDA 4L6AA 4BBJA 2C3PA 3U1TA 4R0VA 5K6AA 3MWJA 2V4UA 2E21A 3K1YA 1O5IA 1VE7A 4CMBA 3IKTA 3REGA 1JR3E 1CNFA 1YB5A 2DUMA 2MU1A 3EVDA 2IT1A 5I7SA 1Z3IX 3SIXA 4LQDA 5EHIA 1TZ2A 5C3MA 1P3JA 1ECGA 1KZ7B 1XV5A 5T3UA 2TECE 2VAWA 3FSEA 3PYMA 3ZNPA 1ZM3A 1F1BA 3ABSB 4OCZA 4PE5B 2A5FA 4WBNF 4AWXA 3LX8A 4U00A 1K5DA 1M34E 4BMNA 3FNGA 5JO9A 3VNSA 4ON9A 1MAVA 4B4OA 2ZUFA 1U9JA 3PQ2A 3U7QA 2L18A 4BZXA 4E5NA 4MK4A 1MU0A 2WE7A 1OROA 3OCCA 1VIMA 4HHEA 5FF9A 5DYYA 3MCUA 1PG0A 2WUVA 4MVJF 4GZMA 4QSMA 4QNNA 3FBWA 1SXPA 1R12A 3DDOA 3L8CA 3MLBA 3A1SA 3PDWA 1LBTA 5IM5A 1O7JA 2R96A 1F7VA 2HU2A 2Z3ZA 2UYYA 4IG9A 1Y80A 4RCYA 1USIA 2QE7A 3DW3X 3I9OA 4TMYA 3DFMA 4CQMB 4UCWA 3PQ3A 2Z1DA 4FMDB 2V7WA 4XCXA 1EWVA 5AKXA 1DQZA 4QYMA 1I36A 5ETJA 3EFOA 1GPAA 4UHDA 1K88A 1V11A 3G23A 1GO2A 3OECA 1YWGO 2D3TA 2AK3A 2CVZA 2WSBA 1FYXA 1Q6YA 4S1VA 4FZ3A 4D43A 1C3XA 1OC2A 2RGNC 1U7HA 1Z07A 3IKJA 3OC6A 3PC2A 3WGGA 4U5QA 5AVRA 3Q0EA 2YJ4A 4FHDA 4J4BA 2GUWA 4JVMA 3EUWA 3VXKA 3PCRB 1BGWA 3O26A 4O4JB 3LHDA 2NTJA 4LISA 3PA6A 1MZPA 1JR4A 1WU8A 1OBVA 1I6WA 1R9MA 4EH1A 3CZQA 5AOVA 5ARBA 3HJBA 2FU5C 3K96A 5LKRA 2CVQA 1N6KA 1QAOA 2X77A 1MG0A 2I3ZA 2VP0A 4JI5B 3SVZA 3I73A 1PWHA 1FCJA 3TVTA 1YB4A 4FX5A 2IYTA 4JP5A 4U7FA 1YQEA 3H99A 2HTFA 1LDBA 2QZJA 1TECE 4Z9YA 1QP4A 4NEHB 2BR3A 1VA5A 1BROA 2RHLA 4G67A 2I2AA 5DTMA 5G40A 4EF5A 1B2RA 2WP8J 4MGIR 5C53B 4AJHA 1L3BA 3MBOA 1B43A 4Q34A 5ERYA 1SHZA 3DCNA 3L5OA 1P29A 2EEZA 4QU8A 1PTKA 1JG6A 1QV9A 1F8YA 3OLWA 3PPIA 1ZHHA 2Q3DA 4UZEA 1GSIA 3CUSA 5CFOA 5KSZA 4MCJA 4LOKA 5JISA 4XIIA 4R9VA 1ZESA 2HJWA 1GFSA 4RPJA 2DTEA 3TIXB 4LF6B 2B7LA 4BIIA 1QIEA 2JLVA 1QIMA 2PPLA 3UJPA 3U3OA 3AETA 3RSLA 3BSFA 2CV2A 3P9IA 4TUYA 4BNFA 1O8CA 5A6SB 2O6LA 2X41A 2AN5A 4LWPA 4RQBA 4CLRA 1WEKA 2RH9B 2VBIA 4WVLA 1EXVA 2XLBA 1CB0A 2OV8A 1ZUNB 1BQ4A 4JBIA 2M1ZA 1RLOA 1QBGA 2PUJA 3GQBB 1L4NA 4QWMA 4PX9A 1HLGA 2ZJOA 3RS0A 3A3PA 5ITZB 4R7ZA 4Y2TA 1FVFA 5K3DA 4UMFA 4QBTA 3BD9A 3KT3A 1EG2A 1DGQA 3I9FA 4PYNA 4OFWA 4IDNA 3VZSA 3DDZX 1IUNA 5DTEA 4JEHA 3BD8A 3HA7A 4JOCA 4DV4B 3LP8A 3TD9A 5AIAA 4B9AA 4YDRA 1ZNWA 1PSDA 4J49A 3KVYA 3NM5A 5GP1A 1V4VA 4RZQA 2OO5C 4EUSA 2PRIA 2OA0A 1GZ5A 1YDFA 3DAPA 3FUUA 4NTZA 4HFNA 1IZ8A 1N1GA 1HYHA 1RXIA 2PR2A 4RPLA 5A7HA 4EPVA 1ZHOA 3VJKA 4PHGA 1MT0A 1MJGA 1J8QA 1SOWA 3PGA1 1PGNA 2HU5A 1N3LA 2AD5A 2YWBA 2YC4C 3P9NA 2PJZA 4JMLA 4NBRA 1RMQA 4K3UA 3LGXA 4RV4A 3TKYA 4HWOA 2O7VA 3SYMA 2BEWA 4DAEA 1CZOA 1BWPA 3DULA 3KYBA 1S7CA 2PGAA 3QQ5A 3DKKA 4Z3KA 5A4FS 2GJ4A 3IPCA 5ICFA 2ZJBA 1HT2E 2QVXX 3IQIX 4D9BA 3M6XA 4AKGA 2P9JA 4RIEA 4K0KB 2MSDB 4DTCA 4F2WA 4IDHA 1NJ1A 4DXAA 4OU5A 2IDJA 2VXYA 5HF9A 3TOVA 3TLMA 1LBSA 4B6PA 3TSCA 3KOZA 1JVSA 2XNKA 4JVSB 4OG2A 4R3NA 4I3GA 1DIHA 3LA6A 3ZVLA 3GLGB 4DKJA 3V3TA 1PS0A 3LVRE 2PX6A 3GUZA 1YZYA 4Q3BA 3CH7A 2DG2A 2F43B 1NRIA 3D9QX 4QRHA 3AZPA 5DISB 2XR1A 3ECSA 3AM1A 3PNOA 2P0YA 4P2GA 4LGCA 1H4VB 2YN4A 2ZXUA 1L4BA 3ETNA 1FJ2A 4FDVA 3DKIA 4A6PA 3T3OA 1XD2B 4CEHA 3I9JA 3P96A 2HXGA 3L7JA 4N54A 4GSYA 1NAHA 1DXOA 3CCFA 5M7EA 1GPUA 2G0TA 2QT0A 4OAOA 5BN5B 5A5DA 5LN1A 4R0MA 5IM4A 2BSXA 4HQ6A 2IEIA 1N0WA 1KMNA 1EBBA 3IP6A 4BNDB 4EFKA 1Y63A 2V58A 3P9SA 3R24A 1OLXA 3S70A 5IUKC 3QVKA 5D3KA 4U2DA 3WRYC 4BVAA 2R87A 4F7DA 3ED1A 2V65A 3SBXA 5JTTA 5HP4A 4KGDA 2JKYA 2IF0A 5K4AA 1E5LA 4HMOA 1PZEA 1XT6A 1H8HA 3R77A 2OVFA 1JG3A 4U5XA 1O6GA 2UYHA 3D8HA 3CSUA 3V1LA 1AZSC 4FYJA 1OWMA 4R6XA 4B33A 1FFWA 4M86A 2ZP1A 2R11A 1M10A 1X8JA 2C7BA 2G6TA 2ZUBA 3RSQA 1FXSA 3DUFA 2VF5X 2QX7A 3M6FA 4P7BA 4N9WA 5DHPA 1R4NA 4XGQA 2C95A 5F5NA 1O94C 2PRJA 1O5OA 2I80A 4YT4A 5DNEA 3GNLA 4C3ZA 4EBFA 2XKJE 4XIFA 1HKHA 3ND5A 2XOEA 2GZAA 1M83A 2AXEA 3JAKA 3OQIB 4BX9A 4P4NA 3TI9A 3EOZA 4YDSA 5IT9A 1KDVA 4HB4A 3SLRA 2NP6A 4BZPA 2WF5A 2PD3A 3T3DA 1KRHA 1R0SA 1P3DA 5B58C 1F12A 4L57A 4RGVA 2RFLA 4X1YA 3VX3A 1Y8QA 4MQ6A 4QVKA 3PVCA 3KETA 3OFNA 4PPFA 1O3YA 4ISBA 2PRYA 3GBVA 4LXTA 1W2WB 3PPXA 1E3DA 4DCJA 4Q6WA 3RYHA 1JWAB 4PFKA 2R6R1 2CVFA 1YKFA 5LMUB 1P3Y1 3JWJA 3TZCA 2GJ9A 3OFKA 4JXJA 1JH8A 1ZMBA 3KVNA 1YR3A 3R1IA 3V46A 2R1TA 4WFKA 5EJ6A 3ZZNA 3IHTA 4L75A 4J0FA 4ZI5A 2B4TO 1OB5A 3IQEA 5EJ4A 4ZCRA 3BJIC 5CFRA 3AR6A 4ERXA 2GRJA 1G7SA 2J0VA 4G6ZA 2QXTA 2WVGA 3ANSA 4X1OA 5JMTA 1G291 3KS9A 1DBSA 1HE3A 4B71A 1E69A 3IVCA 2P91A 4D4IA 2X5OA 2LKCA 3PHGA 4ZYZA 5LU8A 1VB3A 4Q9IA 1QF6A 1IY2A 2DQZA 5HF5A 1VJDA 3K9CA 4G0OA 2Y1LA 5LNK6 5J4VA 5DPMA 1QM5A 2P1RA 1SJ9A 1PV1A 1V16B 2P4EA 3BDVA 1QTQA 3BMNB 3QVUA 2P30A 5BVGB 1OU4A 3RUFA 4JJ4A 5IABA 4Y2HA 3B1VA 4CPDA 2HHJA 4NV1A 2AF3C 3AV3A 1DJNA 4QODA 2IUUA 4XQ9A 1Y8AA 1I0LA 3V8PA 5KTSA 4PZCA 4DLUA 1SZCA 4INOA 3KBOA 3MD9A 1Z6PA 4IOJA 1NN0A 1NLUA 3ZGVA 3F3YA 2PWYA 1L9KA 1GPKA 4BVJA 5C35A 5F76A 2FPLA 1OH8A 2ZIVB 4CM8A 4G36A 4EW2A 1A7KA 1M2VA 5B7NA 5KYNA 2CK3D 2I2WA 2BFWA 1DAKA 1G6OA 2NSHA 2WAAA 4JENA 2XRFA 1PFGA 4QQFA 4Y9RA 4ZOAA 1IXSB 1NT4A 3NFYA 4Q01A 3QKIA 2Q3LA 1JDBC 5GJBA 3ESXA 2VHTA 5FPPA 2VP9A 3SC3A 3JVVA 4DCPA 2BHTA 2XIQA 4CMKA 1R8XA 2L69A 5JH7F 2BGGA 3SIWA 4JCCA 1JZTA 3L82B 2DSTA 1CJSA 1KC1A 3NHUA 4P5PA 4BAUA 4ZHQB 1ADYA 1EGAA 1KEPA 2CZGA 3GJ4A 3MMZA 2WG1A 2F62A 4KN6A 1TD9A 4P82A 4DMUB 3JAWA 3HMQA 4D98A 2WZCA 4BNVA 1VCHA 2RI0A 2W2VA 2AQHA 3DL0A 2MMCA 3VAAA 6NULA 4LZOA 2ZAMA 3V4ZA 3BG5A 3GGJA 4H6WA 4DMGA 1DIGA 1XZAA 1NVUQ 3DOEA 1YJ8A 4QPJC 4GKAA 3MYRA 3JAMA 3PQ7A 4PAQA 4Z9XA 3ONNA 3AL0C 3G2LA 4K46A 3I2FA 1G18A 3D1LA 3FWPA 3HUFA 3VUEA 3I0MA 1R0YA 3UJCA 2ZUEA 3L7NA 3SN6A 1A8IA 3E61A 3DO8A 5U4XA 3KPVA 1ESZA 2TS1A 4TV9F 1XXHE 3CV3A 2Q2NA 2B3TA 4UAUA 1L3CA 1C4WA 1Y3HA 4BKMA 4MLDA 3NEYA 4DA6A 2Y0BA 4NBNA 3ICPA 2X5NA 1POWA 2WFMA 4LJYA 2VDUE 4XM0A 4ZVLA 4CMEA 4KE6A 1G64A 1EDDA 1P45A 4EY6A 2EZTA 5IKXA 1SBQA 3A14A 2REOA 4IIDA 1U98A 1ZU4A 3BRSA 4XJXA 3R7AA 4NOLA 1GHTA 4B8ZA 2CXXA 1R2QA 5EFOA 3WA7A 2J5BA 2ZU6A 4D4HA 1AGPA 1QVRA 3NVDA 3U80A 4Y2YA 5JD6A 4UU7A 5SY6A 2QTMA 3QE3A 1UBCA 1Y5LA 3LUHA 1Y6FA 3PDIB 4RACA 4BPBA 3E84A 2BZGA 1PFQA 3BJEA 2NU9B 1L9XA 5DWDA 3R5KA 5JFTA 2C7OA 5KHAA 3ZHZA 3RSHA 2R8XA 1KR5A 3CS3A 4DDHA 3ST7A 4Z53A 1OZFA 4D74A 4FWIB 5AW3A 3G2JA 2HCRA 3A1TA 3JQGA 1W87A 5KNCH 1VQ1A 1Z4KA 3EYWA 3H4IA 1ZH2A 3E70C 1IMOA 2OC9A 1S2IA 4US1R 5CT6A 3TQIA 2AOUA 3BMOB 4ND4A 4U9HS 3JU3A 2E2WA 4J03A 5HM8A 3KALA 1KK1A 2G76A 2PMEA 5CU7A 4BRZA 2WLTA 5CYFA 4RPKA 2JA2A 4GOXA 4EYKA 2EC5A 5CFPA 3KEGA 1W36C 4FZJA 2Z2XA 3BCRA 4XX0A 3R5TA 4DG9A 3KB6A 1YZHA 4ATNA 4A2WA 3LTEA 1DO0A 2VXOA 2P75A 2XDQA 3A7EA 1GU1A 2Y67A 2C2WA 3AR4A 1I9GA 1KOJA 4D8VA 4B7CA 1CZHA 1N2XA 1S01A 3CBQA 4MJXA 3RYCB 3U5TA 4JA2A 3WVNA 1AG9A 1L1RA 3H1GA 3R3ZA 1HX7A 1BXGB 1F8XA 1KMIY 4I4CA 3ZGNA 5IZCA 3OPYI 4LHSA 2BEUA 1YS6A 1H2YA 4Q7EA 3EWAA 2VJQA 1HA3A 4OI0A 1JJ7A 3GEPA 4AU1A 4ESVA 4D82A 2L42A 4O2LA 1RE0A 2JK1A 2OGUA 3C1OA 3CNBA 3IBTA 1GP2A 3S2ZA 4A0GA 2ZIEA 4ZU6X 1GGEA 1HWYA 2QN8A 3ZV7A 4RKFA 1IBKB 2OV6A 3RT7A 4PYRA 2ZIXA 3NYRA 1J2JA 1Q84A 1CR4A 2XDWA 1SCQA 1VJGA 3EXFB 3L4KA 5F7ZA 2FZKA 1J39A 1X3SA 2NQ8A 3JQGB 5CNMA 2E37A 3STWA 3T1YB 3PR2B 4BS9A 2RJOA 3IEUA 1PTJC 2Z30A 4XRGA 5JC1A 2Q3BA 2JIDA 3ZWQA 3K70D 1OFVA 1G8MA 4LOLA 1JX6A 1SVUA 3CISA 4IGIA 5BRNA 3ZJVA 1KF0A 3ZV4A 4X8OA 3OKAA 4URZR 4TRMA 3RTBA 2HT6A 1Y8ZA 4PQYA 4YT8A 2PCJA 5HJ2A 4UM9B 3HNRA 1QE0A 2WNIA 1A8UA 3VU3A 2XYVA 4PZ9A 5LLDA 3E1GA 3EISA 1SIBE 1DRWA 2HA3A 3GRAA 2ZRKA 1K89A 1Z0UA 3OEED 4KGZA 4KFUA 4MB2A 3QPVA 1CJMA 1G8KA 3VPFA 5C0OE 3P20A 4WX2B 1C7QA 4Q05A 1HZZC 4LDAA 2VJPA 3GLSA 1NMQA 1SC4A 3OZSA 4A0SA 4A27A 4CGZA 3A1UA 1J07A 3PFBA 3UWKA 2G83A 1YDMA 3C70A 2QENA 4Z2YA 3AF1A 3UHPA 2CMHA 2ZANA 4FOSA 4MARA 1AHHA 1CF2O 3PQCA 3HYCA 3OLQA 1NIJA 1I1HA 1QB8A 4Q1CA 4R69A 4TWRA 1EXNA 4P5DA 4KE9A 1JA0A 1LC0A 1MB0A 4RU1A 2TSYB 5ICMA 5ALSA 1FU8A 1Q22A 3TOXA 1FMTA 1NL3A 1QDUA 3RJ5A 4AKTA 3WLAA 5PGMA 5I45A 1HQYE 3ZE7A 4DADA 5TQ0A 3ACCA 4BBAA 1RPJA 2O52A 2Z08A 4OQZA 5FT9A 2WWYA 3CJQA 3E7WA 1IWOA 3ESDA 5E9QA 2JGAA 2CNDA 3O75A 3FGOA 2BBSA 4CG0A 1BW9B 4MV1A 2NYAA 1YBHA 1QC5A 1PL0A 5FI3A 5FL3A 5KAPA 2Q2WA 1ZVMA 1IPFA 1GA4A 1SD5A 3KR1A 1XF1A 1YXMA 5I9IA 1NSTA 2D5IA 1YFLA 4OM7A 3AR3A 1AQNA 3ZTTA 2GJ8A 1QX4A 2CMKA 1ZSVA 4MW5A 1V2HE 2D62A 5I7HA 3DGFC 3Q2IA 5KDDA 1EFKA 3IGFA 5KYXB 4R7TA 3N2KB 1KAHA 2B78A 2J45A 521PA 5THQA 3PUHA 3AKDA 4BXOA 1JILA 3PCXA 4H7DA 4KW7A 3AF3A 3PKIA 3AJEA 3IO5A 2WDPA 4QXOA 3ESZA 4QUBA 4WD3A 4C0QC 1ZXXA 3L8DA 1WY7A 4BFZA 3DYIA 1WXFA 3F4KA 3F97A 3JWPA 4FJ1A 4IZHA 4N3CA 4YQYA 5TS2A 5AVTA 2FP3A 3TLBA 3ZWDA 1VLMA 3VO1A 4PYOA 4EG8A 1ZZEA 4EHFA 5CW2A 4WI1A 1HFJA 2A0KA 2GUGA 2GZDA 2PH7A 3I9NA 2NUAB 3GFVA 3OQ6A 4MCIA 2K4MA 1NSYA 4H6XA 2DKOA 3L46A 2WWWA 4MTCA 3V4VB 4CF6A 1BC5A 1SUDA 2RDMA 3QU2A 4D3SA 5C7OO 2O5EA 1MD9A 4C3UA 4X66B 2QRLA 3HSYA 5KVAA 2FZVA 3AVPA 3I32A 1YJQA 5CA0A 5TRTA 1DX4A 5TNXA 1MFPA 1I4DD 2OYCA 4PN3A 3GA0A 5BUZA 2RAUA 4PG8A 1OHHD 3FPKA 3I6IA 3ISJA 4MA5A 2OOSA 2BGKA 2VHYA 1FRZA 5EIBC 2GASA 1V37A 1WLYA 4UHEA 2EFEB 2H0QA 4M89A 2GN2A 4W8HA 3WIBA 2O8CA 4EG4A 5EMHA 4LGYA 1G17A 4MLZA 2AKAB 3FOAA 3OX4A 4CV1A 2PS1A 5ILQA 3DQZA 3I39X 4L5YA 5FJJA 3V7FA 2AG0A 4FEAA 5JHHB 1KGSA 1OIXA 3HWX1 2LUOA 3NJ8A 1J4AA 4V39A 5CT4A 4RFVA 3VH4A 3VZQA 9ABPA 3PWKA 2JCXA 4C2UA 3KCQA 5FUVA 3G17A 1HQCA 3TRJA 4ZTZB 3CE6A 1P5HA 1RM5A 4AECA 2QGZA 5HZKA 3WY9A 3NEPX 4FHEA 4WOPA 4P3OA 3U7FB 4DUYB 2JFHA 3K0AB 1RZVA 1E2IA 2XA9A 3U26A 1N1DA 2J85A 4L85A 4IDBA 1TK9A 2YC2C 4DV6B 3AEYA 3A4TA 5H16A 2ORED 2WWIA 4OBEA 2HGZA 2BYTA 3PL1A 5IAOA 4JSYA 4NFHA 1X9IA 3DB2A 5AK4A 2X1MA 3R5FA 4TTSA 1U0LA 5SY9A 3U13A 2PBZA 1H2XA 2WUGA 3LLSA 4MW9A 4XLTA 5HRAA 5FR2A 3KQTA 5K4GA 4OGKA 5AVSA 3WNVA 1M8FA 3WK5A 3IBCA 4CMIA 2RMKA 5FFNA 4JC0A 1JG4A 1PR9A 2H8GA 4WNAB 1TIBA 2Q45A 1KQNA 4ZYXA 2A4KA 1F48A 1MKYA 4CDGA 5FYDA 1CDOA 1E3LA 1A9TA 3WAJA 2NNLD 4U7WA 1WQ1R 3FJOA 5ALXA 4EDHA 3UJ3X 1WL8A 2FQQA 1XKQA 2Z8ZA 3ENZA 2OD7A 3HN7A 4W9RA 3PXUA 4K9NA 1H8HD 1UDWA 1Z29A 1W94A 2P3OA 3MMSA 1B15A 3BHIA 2WUEA 4PEVA 4ZC1A 4BJ1A 5ALQA 1VL1A 2YWDA 2YV1A 4BAGA 4E22A 4KRFA 4HDKB 1P7VA 5C5IA 4R8MA 2QZPA 4BNGA 1GILA 1YFJA 2J07A 3GU3A 2LW7A 3CZ9A 1J00A 3VR2A 3WK8A 1IPHA 2B6HA 3GLUA 3MTQA 4TSFA 4BGEA 1V6CA 4DSTA 3NHJA 4NE9A 3Q0TA 1J0EA 3GMDA 3SR4A 1TFUA 4BTVA 4FFBA 3ICEA 3WHPA 2ZBDA 4IFEA 2BTQB 3DD5A 1OYOA 4NICA 4P5EA 3D4PA 4OHWA 4BMZA 1ZQ9A 1XD2A 2RAPA 4CEHB 2GZ3A 2A3NA 1F20A 4HDOB 4U9UA 4Y7CA 5CJJA 5DI3B 5C8VA 3SGLA 3PJEA 2VBGA 3CFYA 4F11A 5EQTA 3FLMA 5CCEA 4MVJM 1K86A 2F43A 5T4BA 3CCCA 3B20A 4ZDWA 2R6CA 2R00C 2A5YB 3GPLA 2P4SA 1F2UB 3BB1A 1XZGA 1FVXA 1Q91A 1QKJA 1UAYA 4GD3Q 1R4MB 1KYVA 3FTEA 3U6BA 2I6QA 5KOHA 3ZN2A 2LD4A 5FOSA 1IEVA 4JZKA 4MIKA 3OEHD 5SY4A 4B7XA 2WF6A 4F06A 3K6RA 4C0LA 2VUIB 1XDBA 2QYSA 2Z56A 2CSUA 3ZLVA 3BFVA 3EBOA 4RH1A 5HGXA 3GVHA 3L4EA 4W7IA 3RLIA 4UBIA 4E32A 3O84A 5A2QA 1TNDA 3C5EA 4JR1A 4ZRDA 3G0DA 4FXOA 2ZR0A 2VA8A 2YZNA 1ULUA 1HDIA 3KXKA 3OZXA 4PBRA 3HCBA 4NZPA 1PW7A 3FYDA 2LVBA 1UAAA 1Q3TA 1XCLA 1YZUA 4K0RA 4NOKA 4ZK6A 1MO2A 4N4AA 2PO5A 3HQ4O 2JFFA 3GEGA 3CEAA 4EKGA 3DZGA 1BCRB 4M8LA 5KOIA 2AI1A 4KBFA 1ZUWA 2G0NA 2H29A 2ZIUB 4HNUA 1Z26A 2JH8A 8OHMA 1PV4A 3Q1KA 3N0RA 2HA4A 4EKEA 1IZZA 1O54A 4BQRA 3ISTA 1RQGA 1VL8A 1QH8A 2B98A 3F9CA 1ABEA 4DJDC 4IH1A 1GA1A 4Q5IA 3ZEIA 1Z6QA 4RWZA 2P35A 2F3RA 3BERA 2G67A 1VPDA 3EK2A 1RPAA 4FMCB 4RMHA 4HNTA 2XYQA 3V55A 2EKZA 1W4RA 1QU3A 3OUZA 4BLWA 1PS9A 3GAAA 5F98A 1SEPA 2ZZNA 2F67A 3TW4A 4FEEA 4FWBA 2O5CA 4BNKA 3KZXA 1O6CA 4OQYA 4W6ZA 4D41A 3UMYA 1KHHA 2WT9A 2I7CA 4RTPA 1U2EA 4F72A 5CEEA 3AI7A 2X5XA 4LDNA 3D1VA 4EKIA 1P1IA 5A0FA 4IBOA 1YTLA 4RH0A 3O73A 3AETB 1W9MA 1ZOPA 3K2QA 3KSMA 1TZKA 3LYAA 3RUAA 3UATA 5E2AA 5AXCA 1UDCA 4UPDA 5BUCA 1QO9A 1QVZA 2VZEA 3FB1A 1VCIA 4MRMB 5AJTA 2AMFA 2OBYA 1GADO 1V45E 4JLKA 4PHFA 3ESAA 4RJJA 3P9KA 4CJXA 3H2SA 2Q6VA 1TO2E 5EIBD 3ZVMA 3FVRA 1YZTA 2QAGB 1NJFA 2VXCA 5F3WB 1JHOA 2SCUA 5JQWA 3UT5A 4JR2A 1JLLA 1E9CA 4WXEA 1Z37A 4ZVKA 3RUDA 3ORFA 5EXPA 4GPBA 3VNRA 5KNBA 2E4YA 3PFGA 2QDKA 1ZGGA 3QK7A 1XI2A 4HGOA 5E2IA 5EE5B 4ENVA 3W7AA 3D0QA 2JJ1A 4D9EA 3DVLA 5LMZA 1M1YA 1NXXA 3QBTA 4RIIA 2Q27A 1E1CB 1GGHA 2JLRA 2Z8XA 5FUWA 5KYWB 5TQJA 2DYKA 2EWVA 1VECA 3HYNA 3KU4A 4KRYA 2Z2IA 4M1SA 3GVPA 1LWOA 5C7YA 2JGRA 2IF2A 2NYVA 3QTTA 1ORDA 4FQ8A 4G0NA 3LPDA 4H08A 4E1AA 4W5TA 5KTOA 2PA0A 4MWOA 2PLNA 4KO1S 3R3HA 4DSAA 1DZ3A 1CEYA 4PC2A 3CVOA 2VBCA 1D03A 3SK0A 3MTIA 2QXYA 1XUOA 5E7QA 1COWD 5ECDA 4BP8A 2IY7A 5MGNA 4KE7A 3JQCA 4YXFA 4K3VA 1GQQA 5AI0A 1Z7GA 1STOA 2VDRB 3PD1A 2A0YA 3R9IA 4AURA 5A03A 2PFKA 3OSUA 2Z9BA 1MJHA 3TZBA 2WHXA 4YRTA 2AL7A 2MDTA 1FDOA 4MX8A 4NWIA 4RZUA 1GEEA 1Z3CA 3DTVD 4CQMA 2R2GA 1KDOA 4JN6B 3TZKA 4AZWA 2O07A 5CAEB 2XGGA 3L41A 4Y0VA 5JFGA 3CU5A 3BEOA 4JQZA 2H8KA 1N7GA 2OFXA 2ZBQA 4CCAA 3NT5A 3TXYA 3TDMA 4D0LB 1FU4A 4FKMA 2YMLA 1CB7A 2GNPA 1LK0A 3OHMA 1MW9X 4IJVA 5MGBA 3JQ7B 4J0QA 5K3BA 3X43A 5H82A 4N03A 1C7RA 2Q8NA 1VIVA 3FVWA 4OBWA 4AJ1A 3VR4D 2FJUA 2BTOA 5C8DA 4MDEA 2IPNA 1TW3A 4C7BA 4H7FA 3UB3A 3OF2A 3D54D 1U3CA 3FHLA 4TTAA 3R7BA 5UKDA 3SBEA 4AULA 1RIIA 4NBKA 2VS1A 4Q9KA 2JFBA 3Q9SA 2OD9A 4UVDA 1KI6A 4KLZA 2O3UA 1P62B 3QXJA 1LJUA 3AB7A 3VI3B 2IYUA 4FKBA 5BSHA 4HQOA 4W5OA 2IPLA 1SCAA 2GK6A 1JLMA 2BCGY 1SIOA 5CIQA 5AI6A 4F8JA 5BUSA 4QHYA 4CKXA 3F71A 4LMAA 2PFGA 2LDBA 2W2QA 3KJHA 1EP1B 3LP5A 3QYFA 4E7PA 2FPIB 1W30A 4Q9NA 1DWQA 2F64A 4KQHA 5IK2D 4D0SA 1FDSA 2AT1A 4GICA 2Z8YM 4Z7OB 4X7BA 4QGHA 4WBNA 4TVBA 5FHRA 3HA5A 4RWEA 3A0RB 3OQVA 4F5WA 3K0CA 5HIJA 5FTLA 4MSUA 3WRWA 6LDHA 2BD0A 4AIIA 1IVYA 4ALIA 4CU2A 7ADHA 2PL3A 3MAJA 3B1KA 4INJA 4IICA 1DEKA 1KC3A 2Q8QA 1GL9B 1QCZA 2R9VA 3II6X 4JU8A 3VU9A 4HPXB 1D0VA 1TLFA 3BZWA 3IUBA 2VATA 4A8TA 4C2BA 5CFLA 4I4TF 4OQEA 2C7RA 1OT5A 3I9V6 5BO5A 5EIAA 3IB3A 1RM0A 5BSVA 2YY5A 4XB2A 4CUJA 1M6VB 3LZDA 4KMMA 2DX7A 2GPBA 5EKXA 2H18A 1TM5E 4B4WA 2LIVA 1KS9A 1M0EA 1WNTA 1L7NA 2IU3A 1UMBA 1U0TA 1Y9AA 4DCUA 4ALJA 3HJUA 4DIOA 4MIEA 5ALEA 4EX6A 1S2LA 1U8EA 1K3FA 3KT6A 3F78A 3LGSA 1ZSNA 3TEMA 2QN2A 3Q2KA 2ZJAA 3QWFA 3U2QA 4MW0A 4F97A 4GZLA 3U7HB 4L6CA 2DE0X 3QW2A 4I08A 2WA2A 1VFNA 5EZQA 3LZCA 1NPTO 3DDSA 2A9RA 2FA9A 4WZBE 4Q4JB 5JRZA 3FNEA 4WE3A 1URPA 1NN5A 5LDHA 2IEAA 1SBYA 1G8AA 1I14A 2GD2A 1FLAA 1QG2A 2A67A 2Z2JA 1ZI8A 4MR9A 3Q11A 3SU8A 3VVLA 4DNXA 2B5OA 4R4JA 1HSOA 2GJAA 1E1RA 3EDQA 3LFTA 3P5BA 2BRUC 1RYFA 4U1RA 1AV6A 1UM9B 3EQ6A 1CQJA 1SVOA 3MGKA 3PEUA 4RXUA 2OILA 3I05A 3PC3A 4QT4A 2YASA 2LCIA 4UTZA 2ZSJA 3ETEA 2QM3A 1E18A 2Y6VA 2FE1A 3IV7A 2VRWA 4DPLA 2W6CX 1E62A 3RS4A 3Q10A 4CT5A 3X2EA 1M2EA 4ZICA 3T5PA 3KKZA 4TXMA 3K9FC 2OMEA 2RB5A 3ZV6A 3S4YA 3IPXA 2QR3A 1QJ4A 3DQQA 4JP1A 4X6YA 3WHKA 3ZHBA 4OQMA 2Y1KA 1TGYA 2YVUA 5I6DA 2EU8A 5KVSA 1B26A 3AI2A 1OPXA 1ZN9A 1RXUA 2A9PA 3EQZA 3ES9A 3FHJA 4IGAA 1Y6GA 2ZT8A 1ISIA 5J1TB 3L8FA 5HKKA 5KSWB 2AR7A 1M33A 2ONZA 3WFIA 2ECFA 3EXEA 3CVVA 4HK4A 4MTLA 3AM5A 1QXSA 3OFSA 3KOMA 1JEYA 1DBQA 2BZSA 1TT5B 1US8B 4RKQA 3KRTA 4REQB 2ZI3A 3IHWA 1LU9A 1Q12A 1Z0JA 2ZYSA 2PMKA 2ZU0C 2PANA 1H05A 3TW8A 1A8PA 3C48A 3MRTA 2C5HA 1E7SA 4J7UA 1OASA 3SEQA 2MJLA 2WVHA 3AC0A 4J90A 3OT4A 3RS9A 3HCDA 3R9WA 1F6BA 4A10A 1AURA 3GEIA 4FZ5A 3ETDA 1H69A 1XYGA 1UFOA 5IT5A 2Z3VA 2HRQA 4ES6A 4IDPA 3N5CA 4DA8A 2G09A 2HJVA 3OIGA 1GCGA 1SUIA 2X0JA 4UD6A 3SYRA 3DQPA 3K70B 5MHTA 2VK8A 1MX9A 1Z13A 1W581 4WSOA 1J9ZA 3E03A 3PNBA 2Q6LA 4KKXB 1H2BA 4RJLA 5E6RA 2PSSA 2PZKA 4ZVVA 1A5AB 1MVNA 2ZKIA 1U2SA 2ZBRA 2HIMA 1YMUA 3DWIA 1XTQA 4LC0A 2AFIB 4UM8B 3SMVA 3T1QA 5I7FA 1OXBB 2ZS7A 3JQAB 3MHTA 2PZMA 5TDHA 2F17A 3VO9A 4N8DA 1SQ0A 2QNBA 3ZW9A 4YP0A 4F4DA 1Z47A 2QNRA 2GMWA 2XDQB 3QA3E 2O7RA 3I9LA 3LW8A 4B3CA 4RLFA 3HV0A 5JALA 3IP8A 3STHA 1P61B 5FV4A 1FJHA 2E1PA 3RVJA 1XCJA 3ZQJA 4DBVO 1D0SA 1S3SA 2AKYA 1JMVA 2YHIA 4GR4A 4HEA6 1CNEA 3LF2A 3RRYA 4C08A 3B36A 5FOQA 3T7SA 1S1CA 4CKEA 1ZA1A 3DVAB 1QSGA 2OFPA 3F2VA 3FKSA 3ZZUA 2RD2A 2YVLA 4D42A 1GTVA 4F84A 4ZRNA 3T15A 3CZAA 3HCRA 3E35A 4MEAA 1WVMA 3H9BA 4HPJB 5K3EA 4WOBA 1N2BA 1TUEA 4P2BA 2C78A 5EIOA 4BWGA 2H2IA 4WJKB 5FOWA 4YJHB 4DKXA 3RUHA 2PKXA 2X9LA 1ORVA 1SHJA 3P2MA 1CRLA 5K9ZA 1RVV1 3C3WA 1V3TA 3A6GA 4JP3A 3SPXA 5I7EA 1NBME 5JDCA 5LOVF 4ZEVA 3ADDA 2FN7A 1ZOLA 2E4WA 4CG2A 3ID6C 3DF7A 1K9VF 5BQXA 3OY7A 1WDLA 4GU5A 4L0CA 2I8LA 3ZDEA 2DFDA 3M3PA 4Z3OA 1J0BA 2V96A 1R6TA 3BREA 4RVDA 2ET6A 4YVFA 5HWSA 3PTAA 1P80A 4CI9A 3MJCA 1GM5A 1VL6A 2H3HA 3FDZB 4MPPA 5JQGF 1CQPA 1BHJA 1AQYA 1CUDA 3SHQA 4H3HB 2JVJA 2R79A 4JLNA 3ZCSA 4GWGA 1UIRA 2Y77A 3E48A 3OTWA 4MEJA 2QTCA 3Q4GA 5K0SA 4L8GA 2CV1A 2DSNA 5K8JB 4P0QB 3I2YX 4HVTA 1DDIA 4JI4B 1TJ5A 3H5TA 1ODTC 1LTQA 4Y1RB 1RAAA 1EWRA 4U7PB 2H4XA 2POQX 1IWPB 1JHZA 3IUYA 2F9MA 3ZDAA 5AVYA 3KVVA 4JJFA 2W98A 2YWXA 4S2EA 4HEHA 2FMHA 4C4TA 5EJ8A 4IQFA 3I12A 4PO8A 4NJEB 1CUAA 1N2ZA 3K32A 5K0ZA 3IOBA 4MWCA 3QUAA 4Q3KA 3D4LA 1SUAA 3LQYA 3I42A 2VNAA 1ZIOA 1Z0SA 2GKSA 4IJMA 5T4FA 3WGZA 4DCMA 1HDCA 2HCBA 2H59A 4FZVA 3ETJA 4JFAA 3RSGA 3NHBA 5CD9A <