5B66O

Crystal structure analysis of photosystem ii complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 53
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b66O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b66O02
5GTHO 5H2FO 5G3AA 4IL6O 5KAIO 4PJ0O 5E79O 3A0HO 3A0BO 3JCUO 4UB8O 2AXTO 5KAFO 5G39A 1S5LO 5B66O 5B5EO 5GTIO 5G38A 3KZIO 5TISO 4UB6O 3WU2O
chains in the Genus database with same CATH superfamily
4N58A 3VZUX 3HOEA 3SYBA 4KRAA 2Y0HA 3A2SX 1Q9FA 4GCSA 1PHOA 4PUXA 5GTHO 4GCQA 2N2MA 1G90A 4LSIA 7PRNA 2MHLA 3POQA 3AAEB 5KAIO 2Y0LA 1HXXA 2W81C 4FOZA 4K3CA 3LK3A 4C4VB 4Z3TA 1E54A 2FGRA 2QTKA 2ZFGA 2R4PA 4B61A 3AA7B 1OSMA 2WJRA 1ZHWA 4G75A 2R88A 2XMXA 4LSFA 3A0BO 4UB8O 4O4UA 3DWOX 5KAFO 3T24A 3SYSA 4AUIA 2X9KA 4C69X 4D65A 6PRNA 1H6S1 5G39A 3UAQA 4FESA 4AYMC 1GFOA 4AYID 1GFMA 1HXTA 1QJ9A 4BUMX 1HXUA 3JTYA 3AA7A 3POXA 5GTIO 2FGQX 2YNKA 3AAAB 3SY9A 2PRNA 4FUVA 3LK3B 5TISO 4AYEC 4C4VA 2Y7SA 4AKRB 3AAEA 2Y2XA 4RLCA 4FRXA 4RLBA 5PRNA 3TZGA 2F1TA 2KC0A 1BT9A 1QJ8A 3BS0A 5AFUK 1YS5A 2JMMA 3HWBA 5G3AA 4RJWA 2XE2A 4O3YA 1ORMA 5GV0A 4G76A 2R4NA 2R4OA 4PJ0O 4U9CA 1PRNA 3AA1A 3LK42 4AYNA 3PQUA 3DZMA 2ZLDA 1MM5A 1ZHTA 3JCUO 3PF1A 4LSHA 5DL8A 3GP6A 3PQSA 2XTQA 2Y0KA 4F4BA 3VE1A 2JQYA 3DA4A 4FQEA 4K3BA 3C5OA 4N74A 5B5EO 2F1CX 3PRNA 4FT6A 3UPGA 3QRAA 4GCPA 5G38A 3WI5A 5EE2A 3SZDA 2O4VA 2XE3A 1ZHYA 2ERVA 1MM4A 1MPFA 2KXPB 1BXWA 1BH3A 1Q9GA 3PGRA 4GHBA 2XE5A 3WI4A 5ADXK 4C00A 2M07A 2R8AA 2N2LA 3QRCA 3LK2A 4QQ1A 3SZVA 4XNKA 5DL5A 3T20A 2KXPA 1ZHZA 1OPFA 4RJXA 1IZNB 5DL6A 3VY9X 1T1LA 4XNLA 5E79O 3POUA 4AZLA 2YPVA 2R89A 3LK41 5JDPA 3AA6A 5FVNA 5G26A 3PGUA 2MNHA 3O0EA 3EMNX 4JCHA 2AXTO 3KVDD 2WJQA 1GFQA 3PORA 1T16A 5B66O 4N75A 4O3WA 3AA6B 2J1NA 2WVPA 2XG6A 3VZTX 4JFBA 1THQA 3HW9A 4D64A 3KZIO 4FRTA 2K4TA 3DWNA 4FZMA 4FMSA 4O3ZA 2KDYA 4RL9A 4UB6O 5IYUA 2J4UP 2XTRA 3T0SA 4PR7A 3VE2A 3LK2B 1GFNA 5DL7A 2XE1A 3BRYA 2W80C 4FZNA 4KR4A 3K19A 2GE4A 3RBHA 3SY7A 3VY8X 5ADXL 5H2FO 4O3XB 4O49A 3DA3A 1ZHXA 4IL6O 4E1SA 4AKRA 3G7GA 3V8UA 2K0LA 2M06A 2IWWA 3AAAA 3NSGA 4FZLA 2X27X 2KZ7A 4FSPA 4AFKA 2LFUA 3A0HO 2OMFA 2PORA 4GF4A 4E1TA 3HOLA 3AA0A 5T5FA 2ODJA 3AA0B 5D5DA 2LHFA 1S5LO 4LSEA 2IWVA 4KR8A 8PRNA 4FSOA 2KZ7B 2F1VA 3FYXA 4AYDC 3AA1B 2R4LA 3PGSA 4D5UA 3VZWX 5AFUL 1GFPA 4AKMA 4CTDA 4O4XA 1IZNA 1QJPA 1P4TA 3UU2A 4N59A 3NJTA 3BRZA 3WU2O
chains in the Genus database with same CATH topology
5GTHO 5H2FO 5G3AA 4IL6O 5KAIO 4PJ0O 5E79O 3A0HO 3A0BO 3JCUO 4UB8O 2AXTO 5KAFO 5G39A 1S5LO 5B66O 5B5EO 5GTIO 5G38A 3KZIO 5TISO 4UB6O 3WU2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  5H2F O;  5G3A A;  4IL6 O;  5KAI O;  4PJ0 O;  5E79 O;  3A0H O;  3A0B O;  3JCU O;  4UB8 O;  2AXT O;  5KAF O;  5G39 A;  1S5L O;  5B66 O;  5B5E O;  5GTI O;  5G38 A;  3KZI O;  5TIS O;  4UB6 O;  3WU2 O; 
#chains in the Genus database with same CATH topology
 4N58 A;  3VZU X;  3HOE A;  3SYB A;  4KRA A;  2Y0H A;  3A2S X;  1Q9F A;  4GCS A;  1PHO A;  4PUX A;  5GTH O;  4GCQ A;  2N2M A;  1G90 A;  4LSI A;  7PRN A;  2MHL A;  3POQ A;  3AAE B;  5KAI O;  2Y0L A;  1HXX A;  2W81 C;  4FOZ A;  4K3C A;  3LK3 A;  4C4V B;  4Z3T A;  1E54 A;  2FGR A;  2QTK A;  2ZFG A;  2R4P A;  4B61 A;  3AA7 B;  1OSM A;  2WJR A;  1ZHW A;  4G75 A;  2R88 A;  2XMX A;  4LSF A;  3A0B O;  4UB8 O;  4O4U A;  3DWO X;  5KAF O;  3T24 A;  3SYS A;  4AUI A;  2X9K A;  4C69 X;  4D65 A;  6PRN A;  1H6S 1;  5G39 A;  3UAQ A;  4FES A;  4AYM C;  1GFO A;  4AYI D;  1GFM A;  1HXT A;  1QJ9 A;  4BUM X;  1HXU A;  3JTY A;  3AA7 A;  3POX A;  5GTI O;  2FGQ X;  2YNK A;  3AAA B;  3SY9 A;  2PRN A;  4FUV A;  3LK3 B;  5TIS O;  4AYE C;  4C4V A;  2Y7S A;  4AKR B;  3AAE A;  2Y2X A;  4RLC A;  4FRX A;  4RLB A;  5PRN A;  3TZG A;  2F1T A;  2KC0 A;  1BT9 A;  1QJ8 A;  3BS0 A;  5AFU K;  1YS5 A;  2JMM A;  3HWB A;  5G3A A;  4RJW A;  2XE2 A;  4O3Y A;  1ORM A;  5GV0 A;  4G76 A;  2R4N A;  2R4O A;  4PJ0 O;  4U9C A;  1PRN A;  3AA1 A;  3LK4 2;  4AYN A;  3PQU A;  3DZM A;  2ZLD A;  1MM5 A;  1ZHT A;  3JCU O;  3PF1 A;  4LSH A;  5DL8 A;  3GP6 A;  3PQS A;  2XTQ A;  2Y0K A;  4F4B A;  3VE1 A;  2JQY A;  3DA4 A;  4FQE A;  4K3B A;  3C5O A;  4N74 A;  5B5E O;  2F1C X;  3PRN A;  4FT6 A;  3UPG A;  3QRA A;  4GCP A;  5G38 A;  3WI5 A;  5EE2 A;  3SZD A;  2O4V A;  2XE3 A;  1ZHY A;  2ERV A;  1MM4 A;  1MPF A;  2KXP B;  1BXW A;  1BH3 A;  1Q9G A;  3PGR A;  4GHB A;  2XE5 A;  3WI4 A;  5ADX K;  4C00 A;  2M07 A;  2R8A A;  2N2L A;  3QRC A;  3LK2 A;  4QQ1 A;  3SZV A;  4XNK A;  5DL5 A;  3T20 A;  2KXP A;  1ZHZ A;  1OPF A;  4RJX A;  1IZN B;  5DL6 A;  3VY9 X;  1T1L A;  4XNL A;  5E79 O;  3POU A;  4AZL A;  2YPV A;  2R89 A;  3LK4 1;  5JDP A;  3AA6 A;  5FVN A;  5G26 A;  3PGU A;  2MNH A;  3O0E A;  3EMN X;  4JCH A;  2AXT O;  3KVD D;  2WJQ A;  1GFQ A;  3POR A;  1T16 A;  5B66 O;  4N75 A;  4O3W A;  3AA6 B;  2J1N A;  2WVP A;  2XG6 A;  3VZT X;  4JFB A;  1THQ A;  3HW9 A;  4D64 A;  3KZI O;  4FRT A;  2K4T A;  3DWN A;  4FZM A;  4FMS A;  4O3Z A;  2KDY A;  4RL9 A;  4UB6 O;  5IYU A;  2J4U P;  2XTR A;  3T0S A;  4PR7 A;  3VE2 A;  3LK2 B;  1GFN A;  5DL7 A;  2XE1 A;  3BRY A;  2W80 C;  4FZN A;  4KR4 A;  3K19 A;  2GE4 A;  3RBH A;  3SY7 A;  3VY8 X;  5ADX L;  5H2F O;  4O3X B;  4O49 A;  3DA3 A;  1ZHX A;  4IL6 O;  4E1S A;  4AKR A;  3G7G A;  3V8U A;  2K0L A;  2M06 A;  2IWW A;  3AAA A;  3NSG A;  4FZL A;  2X27 X;  2KZ7 A;  4FSP A;  4AFK A;  2LFU A;  3A0H O;  2OMF A;  2POR A;  4GF4 A;  4E1T A;  3HOL A;  3AA0 A;  5T5F A;  2ODJ A;  3AA0 B;  5D5D A;  2LHF A;  1S5L O;  4LSE A;  2IWV A;  4KR8 A;  8PRN A;  4FSO A;  2KZ7 B;  2F1V A;  3FYX A;  4AYD C;  3AA1 B;  2R4L A;  3PGS A;  4D5U A;  3VZW X;  5AFU L;  1GFP A;  4AKM A;  4CTD A;  4O4X A;  1IZN A;  1QJP A;  1P4T A;  3UU2 A;  4N59 A;  3NJT A;  3BRZ A;  3WU2 O; 
#chains in the Genus database with same CATH homology
 5GTH O;  5H2F O;  5G3A A;  4IL6 O;  5KAI O;  4PJ0 O;  5E79 O;  3A0H O;  3A0B O;  3JCU O;  4UB8 O;  2AXT O;  5KAF O;  5G39 A;  1S5L O;  5B66 O;  5B5E O;  5GTI O;  5G38 A;  3KZI O;  5TIS O;  4UB6 O;  3WU2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...