5B66O

Crystal structure analysis of photosystem ii complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 53
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b66O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b66O02
5GTHO 1S5LO 4UB8O 3WU2O 5G3AA 5KAIO 2AXTO 5TISO 5G38A 5GTIO 4PJ0O 5E79O 3A0BO 5G39A 5H2FO 3A0HO 4UB6O 5B66O 3KZIO 5B5EO 4IL6O 3JCUO 5KAFO
chains in the Genus database with same CATH superfamily
2KC0A 3AA7B 8PRNA 1HXUA 4FOZA 2KDYA 3VE2A 4LSFA 4FQEA 5ADXK 1E54A 1Q9GA 1MM5A 4QQ1A 4BUMX 2R88A 2ZLDA 2XE1A 4D5UA 4N59A 4RJWA 2QTKA 5KAIO 1P4TA 5JDPA 3PGUA 4RLCA 4CTDA 3BS0A 3POXA 2R4NA 2ERVA 5G38A 1T16A 4RLBA 3PF1A 3POUA 2R89A 2LHFA 4C00A 2F1VA 1IZNB 2ZFGA 3K19A 5PRNA 5H2FO 1GFMA 5DL7A 3VE1A 4XNLA 2Y0HA 4UB6O 5B66O 3DWNA 5EE2A 3AA6B 3QRAA 1OSMA 3TZGA 2R8AA 4FSPA 4GCPA 3LK3B 3SY9A 2FGQX 1ORMA 4U9CA 5FVNA 4FESA 5KAFO 5GTHO 4O4UA 4GHBA 1QJPA 2XE2A 5DL8A 4Z3TA 1ZHZA 1ZHYA 3AA6A 4FZMA 3LK3A 4GCSA 2F1CX 2Y2XA 1BT9A 3POQA 1OPFA 3LK42 1GFPA 2WJRA 4O3ZA 2J4UP 1ZHXA 4O3YA 2LFUA 1HXXA 4FRTA 4C4VA 3VZUX 3AA7A 2WJQA 4O49A 2MHLA 2PRNA 1G90A 5TISO 2K4TA 3UAQA 1MM4A 1ZHTA 3C5OA 3FYXA 4PJ0O 5E79O 3LK2B 4B61A 3WI4A 1BXWA 4O4XA 3HOLA 7PRNA 3QRCA 4FRXA 2XG6A 4K3CA 3T24A 4PUXA 4E1TA 3A0HO 4FSOA 4GCQA 4XNKA 4AKRB 3A2SX 3DA3A 2W81C 4RJXA 5T5FA 4AKMA 3RBHA 2X27X 4IL6O 1IZNA 3JCUO 2M07A 4FZLA 3PGRA 3WI5A 5AFUL 5D5DA 3JTYA 4AYNA 2XTRA 5DL5A 4LSEA 4AYMC 1GFQA 4N58A 3BRYA 5G3AA 2N2LA 1GFOA 4N74A 3PRNA 4AUIA 5DL6A 2KXPB 2N2MA 2R4OA 3G7GA 2JMMA 3HW9A 4PR7A 4O3WA 4C4VB 2W80C 1H6S1 3PORA 3SYBA 2K0LA 1QJ9A 5ADXL 2IWWA 2AXTO 3SZDA 2F1TA 2FGRA 4AFKA 1MPFA 2KXPA 1PRNA 2JQYA 2ODJA 3GP6A 3EMNX 4FUVA 4G76A 3AAEB 4LSIA 3DA4A 4AYDC 4C69X 2PORA 2Y0KA 3A0BO 4AZLA 5AFUK 4D65A 3PQUA 4O3XB 4F4BA 3NJTA 3HOEA 2IWVA 4KRAA 5G26A 3LK2A 4FT6A 3KZIO 5B5EO 2M06A 5IYUA 4KR4A 2Y7SA 3UU2A 2MNHA 2XE3A 1PHOA 1HXTA 4UB8O 1BH3A 3WU2O 1ZHWA 4JCHA 4KR8A 4E1SA 4AKRA 2R4LA 4D64A 3AA0B 3AA1B 2XTQA 4FZNA 2YNKA 4G75A 4GF4A 4RL9A 3BRZA 2OMFA 2Y0LA 1QJ8A 3SYSA 3UPGA 2R4PA 2XMXA 3VY9X 5GV0A 2X9KA 3T0SA 2KZ7B 3PGSA 2J1NA 3VZTX 3AA0A 3AA1A 4FMSA 5GTIO 3VY8X 4LSHA 2O4VA 4AYEC 2GE4A 4K3BA 2YPVA 3DWOX 1Q9FA 3AAAB 2KZ7A 3HWBA 3LK41 5G39A 3V8UA 1THQA 3PQSA 3VZWX 3SY7A 2XE5A 2WVPA 4N75A 6PRNA 3T20A 3DZMA 3O0EA 3KVDD 1GFNA 4AYID 3SZVA 1YS5A 3NSGA 4JFBA 1T1LA 3AAEA 3AAAA 1S5LO
chains in the Genus database with same CATH topology
5GTHO 1S5LO 4UB8O 3WU2O 5G3AA 5KAIO 2AXTO 5TISO 5G38A 5GTIO 4PJ0O 5E79O 3A0BO 5G39A 5H2FO 3A0HO 4UB6O 5B66O 3KZIO 5B5EO 4IL6O 3JCUO 5KAFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  1S5L O;  4UB8 O;  3WU2 O;  5G3A A;  5KAI O;  2AXT O;  5TIS O;  5G38 A;  5GTI O;  4PJ0 O;  5E79 O;  3A0B O;  5G39 A;  5H2F O;  3A0H O;  4UB6 O;  5B66 O;  3KZI O;  5B5E O;  4IL6 O;  3JCU O;  5KAF O; 
#chains in the Genus database with same CATH topology
 2KC0 A;  3AA7 B;  8PRN A;  1HXU A;  4FOZ A;  2KDY A;  3VE2 A;  4LSF A;  4FQE A;  5ADX K;  1E54 A;  1Q9G A;  1MM5 A;  4QQ1 A;  4BUM X;  2R88 A;  2ZLD A;  2XE1 A;  4D5U A;  4N59 A;  4RJW A;  2QTK A;  5KAI O;  1P4T A;  5JDP A;  3PGU A;  4RLC A;  4CTD A;  3BS0 A;  3POX A;  2R4N A;  2ERV A;  5G38 A;  1T16 A;  4RLB A;  3PF1 A;  3POU A;  2R89 A;  2LHF A;  4C00 A;  2F1V A;  1IZN B;  2ZFG A;  3K19 A;  5PRN A;  5H2F O;  1GFM A;  5DL7 A;  3VE1 A;  4XNL A;  2Y0H A;  4UB6 O;  5B66 O;  3DWN A;  5EE2 A;  3AA6 B;  3QRA A;  1OSM A;  3TZG A;  2R8A A;  4FSP A;  4GCP A;  3LK3 B;  3SY9 A;  2FGQ X;  1ORM A;  4U9C A;  5FVN A;  4FES A;  5KAF O;  5GTH O;  4O4U A;  4GHB A;  1QJP A;  2XE2 A;  5DL8 A;  4Z3T A;  1ZHZ A;  1ZHY A;  3AA6 A;  4FZM A;  3LK3 A;  4GCS A;  2F1C X;  2Y2X A;  1BT9 A;  3POQ A;  1OPF A;  3LK4 2;  1GFP A;  2WJR A;  4O3Z A;  2J4U P;  1ZHX A;  4O3Y A;  2LFU A;  1HXX A;  4FRT A;  4C4V A;  3VZU X;  3AA7 A;  2WJQ A;  4O49 A;  2MHL A;  2PRN A;  1G90 A;  5TIS O;  2K4T A;  3UAQ A;  1MM4 A;  1ZHT A;  3C5O A;  3FYX A;  4PJ0 O;  5E79 O;  3LK2 B;  4B61 A;  3WI4 A;  1BXW A;  4O4X A;  3HOL A;  7PRN A;  3QRC A;  4FRX A;  2XG6 A;  4K3C A;  3T24 A;  4PUX A;  4E1T A;  3A0H O;  4FSO A;  4GCQ A;  4XNK A;  4AKR B;  3A2S X;  3DA3 A;  2W81 C;  4RJX A;  5T5F A;  4AKM A;  3RBH A;  2X27 X;  4IL6 O;  1IZN A;  3JCU O;  2M07 A;  4FZL A;  3PGR A;  3WI5 A;  5AFU L;  5D5D A;  3JTY A;  4AYN A;  2XTR A;  5DL5 A;  4LSE A;  4AYM C;  1GFQ A;  4N58 A;  3BRY A;  5G3A A;  2N2L A;  1GFO A;  4N74 A;  3PRN A;  4AUI A;  5DL6 A;  2KXP B;  2N2M A;  2R4O A;  3G7G A;  2JMM A;  3HW9 A;  4PR7 A;  4O3W A;  4C4V B;  2W80 C;  1H6S 1;  3POR A;  3SYB A;  2K0L A;  1QJ9 A;  5ADX L;  2IWW A;  2AXT O;  3SZD A;  2F1T A;  2FGR A;  4AFK A;  1MPF A;  2KXP A;  1PRN A;  2JQY A;  2ODJ A;  3GP6 A;  3EMN X;  4FUV A;  4G76 A;  3AAE B;  4LSI A;  3DA4 A;  4AYD C;  4C69 X;  2POR A;  2Y0K A;  3A0B O;  4AZL A;  5AFU K;  4D65 A;  3PQU A;  4O3X B;  4F4B A;  3NJT A;  3HOE A;  2IWV A;  4KRA A;  5G26 A;  3LK2 A;  4FT6 A;  3KZI O;  5B5E O;  2M06 A;  5IYU A;  4KR4 A;  2Y7S A;  3UU2 A;  2MNH A;  2XE3 A;  1PHO A;  1HXT A;  4UB8 O;  1BH3 A;  3WU2 O;  1ZHW A;  4JCH A;  4KR8 A;  4E1S A;  4AKR A;  2R4L A;  4D64 A;  3AA0 B;  3AA1 B;  2XTQ A;  4FZN A;  2YNK A;  4G75 A;  4GF4 A;  4RL9 A;  3BRZ A;  2OMF A;  2Y0L A;  1QJ8 A;  3SYS A;  3UPG A;  2R4P A;  2XMX A;  3VY9 X;  5GV0 A;  2X9K A;  3T0S A;  2KZ7 B;  3PGS A;  2J1N A;  3VZT X;  3AA0 A;  3AA1 A;  4FMS A;  5GTI O;  3VY8 X;  4LSH A;  2O4V A;  4AYE C;  2GE4 A;  4K3B A;  2YPV A;  3DWO X;  1Q9F A;  3AAA B;  2KZ7 A;  3HWB A;  3LK4 1;  5G39 A;  3V8U A;  1THQ A;  3PQS A;  3VZW X;  3SY7 A;  2XE5 A;  2WVP A;  4N75 A;  6PRN A;  3T20 A;  3DZM A;  3O0E A;  3KVD D;  1GFN A;  4AYI D;  3SZV A;  1YS5 A;  3NSG A;  4JFB A;  1T1L A;  3AAE A;  3AAA A;  1S5L O; 
#chains in the Genus database with same CATH homology
 5GTH O;  1S5L O;  4UB8 O;  3WU2 O;  5G3A A;  5KAI O;  2AXT O;  5TIS O;  5G38 A;  5GTI O;  4PJ0 O;  5E79 O;  3A0B O;  5G39 A;  5H2F O;  3A0H O;  4UB6 O;  5B66 O;  3KZI O;  5B5E O;  4IL6 O;  3JCU O;  5KAF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...