5B66Z

Crystal structure analysis of photosystem ii complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b66Z00
1S5LZ 5TISZ 5GTIZ 3KZIZ 2AXTZ 5B5EZ 5E79Z 4PJ0Z 3A0BZ 5KAFZ 5H2FZ 5B66Z 3A0HZ 3JCUZ 5GTHZ 3WU2Z 5KAIZ 4IL6Z 4UB6Z 4UB8Z
chains in the Genus database with same CATH superfamily
1WP8A 4WFGA 2ZXWC 5F2VO 2F95B 5HFLA 5D5PA 4JI3O 4D7TA 2Q7GA 5L3DA 3DGEA 4X64O 1OJHA 4KUMA 1MZFA 5IYZB 1LR1A 1YXBA 5J2TB 4LWSA 2IJHA 4LFBO 4X8AA 3I56V 1IX9A 2YXYA 4RAIA 2WA3A 1YJ9V 3JYCA 4AI8A 4X1KB 2Q0AA 1YIJV 1YEWA 1E1QG 1ORQC 3CC2V 2ZE8A 4O4LA 4LC1A 1MSDA 4Q6GA 2XTAA 2HVJC 1XHZA 5H6QA 1W0KG 4A5UB 1J95A 4UVBA 2OWOA 4PDLA 3SPIA 1QR9A 4UUJC 4JPRA 4MTOA 2OCCB 1H2SB 1PM9A 3CRCA 1S5JA 3W7WA 4LH7A 3E86A 3U11A 1Q6IA 1VQKV 2NNUA 2Q6AA 4UCSA 2R9AA 2UUAB 5JCOA 1URFA 4Z1MG 1NJIW 4GX5A 4PA7A 5KMGA 2EZPA 2DQ3A 2DYSB 4CS2A 4D6TH 4TQDA 3CMAV 4NXMB 1KUQA 1Q43A 5IT9N 1B6QA 1XOUA 1KU9A 3B40A 2YI8A 4P9OA 2E75B 3JALA 5C8YA 2UUAO 1NH2B 3H9VA 3IFXA 5BR8B 4X89A 2A9HA 1FYJA 4DRXB 3WU2Z 4TV9B 1BL8A 1GK9A 2IJJA 3S3WA 3JCZA 1D2DA 4X65O 5DM6V 4PA9A 1QLEC 1K97A 3OEEG 3OR7C 4PI2A 2JS5A 1RM1B 4PI0A 4JF3A 4X66B 2AHZA 5LHIA 3IC7A 1KMIZ 2HVKC 1KYOF 3CPWU 1VQ5V 2ADQB 4GKJB 2ZXWB 3BCCH 2ADPA 3D3QA 5BR8O 4PDRA 1FXKA 4EFBA 4DV1B 2X6BA 4X88A 3JAMN 1DF5A 1XBLA 1R3LC 1BZKA 1JJ2U 3C90A 1JR9A 3ZX6A 1AI6A 5KUMA 5EBLC 2HFEC 5LP6C 4DR7B 1VP7A 3GWOA 2YXLA 4CZZA 4U3JB 3L74H 1Q8IA 2IJIA 1QHTA 4X66O 3ETGA 4O2BB 4YJ3B 4BIOA 2H8PC 2EIKC 4JI0B 1DTOA 3Q4HB 2JGDB 2UUCO 4GKJO 5BMVB 1AILA 3STZC 5B5EZ 2CK3G 2YS8A 4DV6B 4DV1O 3APOA 4UVCA 3JAWA 4FM1A 1KD1W 1M93A 2YSUB 3D36C 3FAVB 4X20A 5LA6A 2EJRA 4I5SA 5H6RA 4ZBMA 4O4JB 2A7WA 3ABMC 3QG5A 4DR7O 1CPYA 3SR2C 2GDSA 3AG2C 4FIPC 1IURA 4CBCA 2JIZG 4JI1B 2RMKB 1KB9F 3OW2U 4HYOA 4F6RA 3VBBA 5H5NA 5JQGB 1JJOA 4JI0O 3CJHB 1R3JC 4JTAB 4NTXA 2PTMA 1F23A 1GRJA 4I55A 4NXNB 1NQTA 5KHGA 4DV6O 5JCOC 2W6IG 1KP3A 3SYAA 1WA8A 3OMNB 4J11A 4FZ1A 4XDJA 4JI5O 4JI4B 1GM8A 4UFZA 5KA5A 3O65A 5JH7B 4TUYA 2QWPB 5L3FA 5KLVH 4JI1O 4DR6B 1I7FA 2DE0X 3JAKA 1EN5A 2JEUA 2VWJA 1OCCC 1JOYA 1Q90D 2A79B 1EZJA 1JPXA 1M90W 5FLXN 5IYZA 4JI4O 1BE3H 3OEHG 1PNMA 1ZTEA 5EZYB 1QLEB 3AK1A 2PY5A 1M57C 3SPCA 2OTLV 2FL4A 4TT3G 1HNXB 4DR6O 3S3XA 1MSWD 1SESA 3FB8C 4PHZA 4HNAA 5JJNB 3BABA 2UXNA 2PI5A 1H2NA 1L0LH 3ABKB 3RBZA 1XREA 1RPOA 1M56C 2XUMA 1Y4MA 3SYQA 1SQFA 4I9WA 1VMGA 3APQA 3K3WA 1UPGA 1XL6A 3L9DA 3QTCA 5CA0A 1KC8W 1MZEA 2P67A 3UT5B 2R72A 2FYUH 2FB5A 1Q6HA 2AZ2A 2ZCEA 2ZT9B 5AG2A 3OE7G 2ZIOA 4UVAA 3BRCA 4ZIBA 4FVMA 1N32B 3AK2A 4J9ZB 3JD2A 1VQLV 1MG1A 3T1HB 1QNMA 1YJNV 5FPRA 2GUZB 3DC5A 2GTAA 1HNZB 2ZM6B 3ABMB 3WB1A 3AG2B 1J5EB 1RPRA 3RGBA 2Y48A 4G27B 1SRYA 4FK5C 3VQVA 4JZ2A 4JI7B 1AJNA 1UJWB 1SETA 4TWKA 4P9PA 2DJVA 3ASOC 1S0VA 4L8JA 4DRXA 1HR0B 4TV9A 3A2FA 1N32O 5CMUA 1WJZA 2Q7HA 5CB4B 4J7KA 3QO8A 3LDCA 3T1HO 3C3SA 2ETNA 2K9PA 1PPJH 4W4KA 3W7XA 1Y66A 3RN4A 4RUFA 1XHXA 5BZBA 1XMOO 1K5SA 1VF7A 2W0XA 3KCXA 2QTOA 3ZHUA 2ZM6O 5LGNA 4N21A 3LSUA 1J5EO 1F4MA 1H2GA 3B09A 1I5YA 5IJ9A 3VOUA 4JYBA 3FKSG 3SPHA 2XT9A 3JD4A 3WFVA 4IYIA 4JI7O 5E79Z 4UCRA 1R6NA 3B77A 1NI8A 3WG7C 1ZAUA 5DECA 2QM8A 1N34B 3E8HA 1RSOA 1OCCB 4LBEC 1HR0O 5C8YB 1G4YB 1SS3A 2EILC 4FM2A 3ZN0A 2D3OW 4I4TB 4U3JA 2HEPA 4JAAA 2Y4UA 2RDCA 4UCVA 4HBNA 4PJ0Z 4O2BA 2UXCB 1U97A 4RWUA 4EFEA 4QE9A 2KKWA 3Q4HA 2JGDA 1Q5OA 4PELA 3G71V 2QM7A 1Q7YW 3STLC 2CE4A 2UXDB 1FFTB 1L1FA 1E79G 2CTPA 1N34O 1M56B 2B5UA 2MW2B 1BMFG 3SJBC 5EBWC 3FAVA 1JX9A 2JS3A 2ZR2A 3BA9A 5K1PA 1XNRB 3CRRA 3F7YC 2QDOA 4K35A 4U7NA 1NTKH 2IM9A 2YIBA 2NN4A 1HW7A 3ZJZA 5J2UB 1FPOA 3ZHRA 1TUEB 2MK3A 2QEXV 4QJFB 2UXCO 5IYBO 2BTQA 3KKYA 5J9PC 3BA8A 3A0RA 3CJHA 2ARHA 2X7RB 2R70A 2WAMA 1AJPA 3MDSA 1TVKB 3UO3A 2UXDO 2ITCC 3ETDA 5IY5B 3AG4C 2X6CA 2DW4A 4NB5A 3M7MX 1XNRO 1ZX3A 3K9SA 5FL7G 3JAWB 3G6EV 2DYRC 2DOSA 4LF7B 3X2QC 4X20B 1B04A 4YY3B 3ZHSA 1YI2V 1GAXA 1K34A 3CWBH 2BE3A 2ILMA 2E3CA 3ASOB 3GWKC 5LMNB 1OV9A 1GM7A 3SGIA 3R66A 4JZGA 5LYJA 3RYCB 3SPJA 1N4CA 1BSMA 1S3JA 2QJ1A 5LGTA 4HAMA 1Y74A 3E35A 3MHSC 4RQEA 2QWNB 3F7VC 1WA8B 3CC7V 4LF7O 4DUZB 4LF8B 4CS4A 3N2GA 4H0LB 4ASUG 1IBKB 4LCUC 4ZHQA 4LFBB 1YDXA 1Z2GA 5D5QA 4GX1A 2N74A 2IJKA 3CCVV 4FFKA 4TUYB 2CGOA 1FJGB 2PI4A 4YJ2A 1S5LZ 3WG7B 1VF6C 4DW0A 4TQFA 5LMNO 3H1JH 3JAKB 4R8CA 4OX9B 1EN6A 4CH3A 1PL0A 2OCHA 3CX5F 1VQPV 2QWOB 3AG3C 5LP6A 4LNUA 2Y69B 3UT5A 5LBQA 2YDEA 4OPAA 4DUZO 4LF8O 4K0KB 1NKDA 1IBKO 1QVFU 3L75H 2G38A 4GX2A 5GTIZ 4E4EA 2HR3A 2V7QG 1XEQA 2K1EA 3GVMA 1FJGO 2ZIMA 2JDIG 2DMXA 4RO2A 5IDJA 4X1IA 4HNAB 5EBMC 3L72H 3G6BA 2EX3A 2W6JG 1WAZA 3D36A 4OX9O 2GUZA 4I0XB 1CEZA 2KG7A 1JVMA 3ZRXA 3K0DA 1QVGU 2DQ0A 5KHIA 1M5IA 5CA0B 4K0KO 1NBMG 1NR1A 1YVWA 5CN0A 3EHBB 3N2KB 4WCEV 5KUKA 2WLKA 4YIPA 3L70H 3H1KH 5KAIZ 4FZ0A 2CTRA 5EYPA 3SYOA 4P30A 3A8TA 2E74B 3AG4B 4B3TB 5CB4A 1TUBA 3R65A 3OD4A 1F51A 4CH6A 4DR1B 4LF5O 2HJFC 1R6KA 2ODMA 4OGQB 4X65B 4MTXA 5E1AC 2M7WA 4FPPA 3TXSA 4JAUA 3SYCA 3SDLA 3K5OA 1R3IC 4KP4A 1RFYA 4DV2B 2Q73A 4WFAV 4JAVA 3W7TA 3IGAC 3NXSA 4LFCB 3RWRD 3OM3B 4B3TO 3K5MA 2UXXA 3ASNC 1V55B 3JD3A 4DR1O 4MVRA 2P90A 3T4ZA 3FYEB 3BAAA 4I4TA 4R50A 1Q3EA 4JYAB 2CUGA 1IXMA 5LOVA 2ZDIC 3CCUV 3ZRWA 4GZRB 1G8MA 3RVZA 3LSSA 1Y67A 4LFAB 4R7CA 1FXHA 2O57A 4LF6O 3CS5A 1WNSA 1W59A 4DV2O 5IJ9B 2UUCB 1ZUQA 4LFCO 1W0JG 3LNNA 1LUWA 3EFFK 4OPHA 5EC2C 4JI8B 5JWPA 1RSOB 5J2UA 1AI5A 1N33B 4JYAO 2EZOA 2CDYA 1OCZC 1I94B 1Z5WA 1U96A 3VQXA 2EULA 4G2KA 4LFAO 5LHHA 1TVKA 3OAAG 2N05A 3SYPA 1MA1A 4B08A 2HJDA 5K1XA 1B3QA 1YTFD 3J7AU 3ZMTA 3ZEDA 3I55V 1Q81W 2LFSA 4NR1A 2F43G 2ZE6A 4JI8O 1OZ0A 2P06A 2Q4PA 5GW7A 2Z3YA 4RQFA 4GX0A 1AB3A 4GKKB 4XDKA 4JI5B 1N33O 2JRIA 2CH7B 2LW1A 3CE2A 3HR0A 1VARA 3K79A 1I94O 3E22B 4WFEA 3VQYA 1G1XB 2QWRB 1ZSPA 4JI6B 4QIWF 1JQ0A 1GN4A 5JJJB 1K73W 4UV9A 2QM4A 2BTQB 3OR6C 2F23A 4MW8A 3ZHQA 5KAFZ 3U10A 1K4DC 5B1AC 3RYCA 1NZ6A 1SC5B 2GTSA 1X59A 2AZ0A 4BWAA 1L0NH 2PZSA 3MHHC 5KX5A 1PNLA 2ZNIA 1FAFA 3ZN1A 3OUSA 5JVDA 3K59A 4GKKO 2Q5ZA 1ROPA 1D5AA 3F5WC 4YHHB 2GBOA 1FXVA 4FLTA 1B06A 4J7ZA 5IE9A 1AROP 2EINC 4X9QA 4JI6O 2PYLA 4LF4B 1SZXA 5IWAB 3K0GA 2XAFA 3K08A 2W0FC 1SQXH 1Q82W 1DGSA 2LGWA 1QCEA 2BCCH 3DTUB 4P2ZA 4JYYA 2GHYA 4U3FH 3ASNB 2GV9A 3BY6A 1WPBA 2ZNJA 5LYJB 4DUYB 4KFMA 3VQWA 1SQBH 1NU1H 4YHHO 2KB1A 1YJWV 1Y74B 2Z5UA 4BW9A 1VQ4V 2FMLA 1SQPH 4UCTA 2XAJA 2R9RB 2UU9O 4WF9V 3N2GB 1H2LA 3E8FA 2PUSA 4LF4O 4ZHQB 5IWAO 2YIAA 3BVOA 5L3EA 3TGUH 4JTCB 2D2CB 1IXBA 3AG7A 3RYIB 2HLDG 4I0XA 1SQGA 4YJ2B 1KKDA 5L3GA 3RYFB 1N0NA 1D5NA 3ZCCA 3OMAB 4PDMA 2F4VO 3RYHA 4DUYO 2OIEA 4E2LA 1GO3F 3J80N 4NTWA 2JJ1G 3CCMV 1HP8A 3BFRA 4N23A 3H1LH 3N2KA 1OCZB 1O9HA 5LP6B 4LNUB 4DXWA 1E1RG 1SERA 2PYJA 2EIKB 2PGGA 3G4SV 2QE7G 4B3SB 3CRMA 3IAYA 5FPOA 4X1IB 5LXTA 1DK1A 3TK1A 4TV8A 2KG7B 4O4IB 1XMOB 1M4UA 1K4CC 4B7KA 1WP7A 1F7YA 2HKOA 3E8BA 2YXHA 2IH3C 4MT8A 1BGYH 2JJ2G 4EB6B 1SA0B 3JATB 5B1BC 4O2AB 4DV3B 1VQ7V 1YF2A 3BHPA 5JJEB 4MVSA 1KECA 4DR3B 4B3SO 5EYPB 3W7UA 2A3QA 1PP9H 4DR4B 4FLWA 3P3PA 1TUBB 3ZS8C 3CB2A 1GH6A 4LH6A 2X6AA 2F93B 1ZLZA 2JVDA 3FD9A 3PN1A 4LP8A 2EINB 3E89A 1JCHA 1THZA 5TISZ 1ENVA 1N36B 4J80A 1VF6A 1OCOC 4FLXA 1DF4A 1M9NA 3SJQC 2VS0A 4DV3O 3PJSK 4DR3O 1QLNA 3EXAA 4TOIA 2F66C 2YUAA 1AI7A 3HKEB 4DR4O 1AP6A 3CCJV 1DLBA 1H8HG 3KCYA 1Y6XA 4H33A 4ZI7A 4MVMA 2V1DA 1F4NA 3UM7A 4J10A 2NR5A 2ZE5A 1AR5A 3CXHF 1M57B 1FD9A 5LOVB 1P84F 1PKXA 4DK1A 2DN9A 4O4HA 3ZRWB 1N36O 1L8DA 1S5HC 3K04A 3ZMZA 1VQ9V 3L73H 3JASB 4X1YA 1MABG 3ZRVA 3MAQA 2B1IA 3CCLV 2CH7A 2OT5A 4MTFA 4JV5O 1K5QA 2Z0AA 4FLVA 1PV0A 3E22A 3SJCC 1ZWIC 2C2AA 3FB7C 2B9ZA 3CSXA 2JGUA 3H01A 4PV1B 4FM0A 1YZBA 3M99B 4GYCB 4B3RB 4WFHA 4DYLA 3IC9A 4Z2WA 2BOCC 3CCRV 3QO7A 1JA8A 5EK0A 1EZVH 2LGQA 3OTOB 4BIZA 3T4DA 4FLYA 3P3NA 4LF9B 4D7SA 4WBNA 1I5XA 4K8XA 4AILC 3OGCC 3D3IA 4DR5B 3G80A 4IGGA 2IBZH 2WLLB 5A9GA 4DK0A 1KKCA 4KXRA 3B8MA 4B3RO 4MVQA 1US6A 2B1GA 4I9QA 1EBOA 3NR7A 1NVPD 2GSMB 3OTOO 3HKCA 4FFBA 3UKMA 4EKWA 3T2MA 3DC6A 4NVPA 4LF9O 3UCSC 1JFFB 3OMIB 4JASA 5KX5B 3K06A 4NTYA 1BS3A 4K3AA 4IIJA 2ZDIA 1SQVH 4QGPA 4DR5O 5JVDB 4CS3A 2HP8A 1NTZH 4PA4A 4IYHA 4MVUA 2XNDG 1SF9A 1WB8A 3DSQA 3RYIA 3W7SA 1OCOB 5BY1A 3CCEV 5HFMA 3RYFA 2Y0PA 1K33A 1P7GA 1SQQH 3FX7A 1R73A 2EIMC 4DV4B 2ZE7A 3A0HZ 1RM1C 2EILB 4QPJA 5A2QN 1UFIA 4J41A 3T1CA 2Q8VA 3E83A 1HWYA 2EBOA 3L71H 2P7TC 3HKDB 5GONA 2YEVB 3B8NA 5BXZA 3SPGA 1M1KW 1TAEA 4ZKIA 4MTGA 4Z1VA 4I50A 4IL6Z 4DV4O 4O4IA 1KBHA 5IJ0B 4LF5B 5EIBC 2FTKA 5KA6A 1Q6UA 3RYHB 3ML0A 2E76B 4DR2B 3ETQA 1Q86W 2NLJC 3OFNG 3A0BZ 2N04A 5CA1B 3DXRB 1VQMV 4EB6A 1SA0A 3JATA 1K92A 4O2AA 1GN6A 4F4LA 1IVSA 1Z5VA 3UQ8A 1K9MW 1W2BU 3AG1C 4ZOLB 3D8CA 1P49A 5CBFA 3K03A 4UCOA 3HKBB 2VQFB 1PL4A 3LNMB 4J7JA 4FMTA 2P5OA 1YTFB 4DV7B 5LXTB 1GTOA 2DYRB 1TGOA 3X2QB 1FFXB 4DR2O 5L3CA 4TV8B 1CP9A 3FB5C 3P30A 3ZHTA 4WFFA 4LF6B 2CTWA 2LJ2A 3ZIAG 2LW7A 4GT1A 2CGNA 3QNEA 1ZL8A 2ZQMA 4CC5A 3HKEA 2WLIB 1H38A 5KHKA 2OIGA 1CXZB 2VQFO 3HB3B 3ABLC 4XBFA 3K57A 4DV7O 2VQEB 3FFQA 4CC6A 3CRQA 2LO1A 5LL6Y 1EN4A 2YIDA 2YI9A 3JD0A 1SKVA 2LFRA 2WWWA 3JASA 1BQZA 5C93A 4H44B 1AR1B 3LUTB 2XOKG 2QKSA 4IHJA 2EIMB 4NXMO 5B3SC 3ZMSA 5LGUA 3AG3B 4R6ZA 2IU3A 4CH5A 2VQEO 2VWKA 2P4VA 1NR7A 4W4LA 5KHJA 3ABKC 4ZI7B 3JSNA 1IBMB 3C3TA 1GN2A 4J42A 4KHPB 3H1HH 2P4KA 1VQ6V 2H94A 3CYOA 4O4HB 3CXCU 3ZHVA 4EEQA 1R6TA 2AXTZ 4DW1A 2Q69A 1XILA 4RUEA 3H1IH 1PD3A 3MD0A 2ZR3A 3TJTA 4ABMA 4X1YB 1R1BA 2WLLA 2XASA 1O9GA 5ITZA 2X0LA 1I0HA 2CAZC 1COWG 5IYCO 1IBMO 4KHPO 3ZBHA 2BSKB 3CHXA 2AGAA 1WLEA 3ZMUA 1JFFA 2P6JA 3AG1B 3OTFA 3E8GA 4AQYB 1EFRG 1VEWA 1XQ8A 2AW9A 1BHBA 1KQSU 1MOFA 1NH2D 2RJZA 2Y0IA 4WBNB 2V4DA 3TETA 2L35A 1NS1A 3J81N 3JARB 2UU9B 3CD6V 1MMMA 1AI4A 3GB7C 1QBZA 3O9OA 1H8EG 1Y76B 4WFBV 2M6YA 1G6UA 4UB6Z 5FNVB 1AP5A 3WB2A 4UCUA 2A0LA 4UXNA 1RP3B 3HKCB 4FFBB 2ITDC 4AQYO 2F4VB 3ABLB 4NYKA 3T1YB 1QU7A 1XNQB 1NT2B 3RW0A 1P4RA 2FKXA 4JYCA 4CH4A 5B1OA 3HKDA 4IIJB 2YEVA 1IBLB 4KL1A 5DN6G 3M8AA 1OCRC 3F5TA 3QF7A 2WLNA 4NXNO 1QR8A 4B3MB 3QVNA 2IU0A 5CBGA 4JI2B 3RT3C 3LDDA 2Q68A 2WLMA 5EIBD 5DEDA 4H13B 5J2TA 2WLHA 3OUFA 3KG2A 5IJ0A 4QPKA 2HG5C 3N27A 4UV8A 5B3SB 2F1MA 3T1YO 2RN9A 1XL4A 3ETEA 1JMKC 3CRAA 1XNQO 1GMGA 4X1KA 1YCIA 5CA1A 3DXRA 1XUQA 1IBLO 2BTOA 2L6LA 4DV5B 5H2FZ 2WSSG 3ZRSA 4B3MO 2AHYA 2YIBD 4PD4F 2UXBB 1VQOV 1GM9A 1QQCA 5GONB 5GTHZ 3CCSV 4JI2O 4OXSA 2WA4A 1FXKC 4ZOLA 3U0ZA 5EC1C 2QKAA 1AJQA 3HKBA 3P32A 4LR3A 2KSDA 1XI1A 4I50B 1GKFA 1HNXO 2ZKOA 1FFXA 3OT7A 4FLZA 4LWSB 3THOA 5B66Z 3E2EA 2QGNA 3JCUZ 4MS2A 5IY5C 1WN7A 4DV5O 4I7ZB 4UB8Z 2UXBO 1BHAA 2JK5C 2QA4V 2WLIA 1K3EA 4O4LB 5B1AB 2QSAA 2PF4E 2YICA 2RNBA 2A06H 1BQ0A 1I08A 2Y4TA 3TXQA 2BOBC 3CEIA 3JSLA 4BIUA 2P22C 2E5LB 4BR6A 1YHQV 3TCUA 2EIJC 2IH1C 3K5LA 2QWQB 1EM1A 3BEHA 3EVKA 3OGIB 1VIBA 4GUNA 4NKGB 2XAQA 1BCCH 3CCQV 4GCZA 4ICGA 3AK3A 5L3BA 1KP2A 5B1NA 2DWEC 1V54C 3ICXA 5KMGB 1AVMA 2OYQA 1HDJA 2JEXA 1VQNV 1ZL8B 3FB6C 1AR4A 3LSQA 1LUVA 1HNZO 4QNHB 2WPDG 3G67A 4JV5B 1NVPB 2E5LO 3ZMVA 5LHGA 1IZ3A 4MVZA 3KZIZ 4QE7A 1IDSA 1MNGA 4FJCC 4X62B 2Q7EA 4U7OA 3IJ4A 1XDCA 1OCRB 1X4TA 5CBHA 2H3OA 1XMQB 3JALB 4TSFG 2UUBB 4BAYA 3K9AA 1A32A 2OTJV 3LDEA 2Y69C 3AEIA 2Q67A 4J9YB 4YIOA 2LQTA 4FLUA 1YITV 3FYIB 1FKAO 4YJ3A 4HZ3A 2VRZA 2ZINA 4IT5A 2HHHB 4F6EA 2XHBA 4IHJB 2RCVA 1T5EA 4YXWG 5BMVA 2Q9LA 1S77D 4X62O 4G28B 3WB0A 4DV0B 2BSKA 5H9CA 1FS0G 4L87A 1XMQO 1NTMH 3RVYA 2UUBO 3ABUA 2DWDC 2IW5A 4MSWC 2XAGA 1SZTA 4C7UA 3HPLC 1FXKB 1OHHG 4O4JA 2Q0OC 2QTSA 4PA3A 1HNWB 1YSCA 2OCCC 2QKCA 3CMEV 2HHHO 2XAHA 5JQGA 5LMUB 3K5NA 3JARA 4B7EA 4BW5A 4DV0O 5ITZB 4JTDB 1Y76A 2LP7A 3ABTA 5FNVA 1S76D 1V9PA 1LNQA 4Q20A 3UO2A 3K58A 1H2KA 2EJ7A 5B1BB 4K8ZA 4PA6A 4PDVA 5CA3A 5JH7A 2DYSC 1K8AW 2WLJA 4GLXA 5LA6B 1HNWO 2CTQA 2ZD9A 4AHCA 1N0JA 5LMUO 1TA8A 1K7DA 3I5DA 1S72V 2EIJB 1WPXA 3QO5A 1PNKA 4F6RB 2KQXA 1WB7A 1V55C 3JD1A 3BPZA 5KHHA 4JI3B 4I55B 4DO2A 3B4SA 1P7BA 2R9IA 2RQ6A 5EZYA 2ATKC 1V54B 1BT8A 4X64B 1H2MA 4JGSA 1VQ8V 4MVOA 1R3KC 3CC4V 4XDLA 5IYDO 4YY3O 3RFRA 2QR4A 4H37A 3B2EE 1VF5B 1N8RW 4MW3A 1GN3A 3SJAC 3CP1A 2YC0A
chains in the Genus database with same CATH topology
1S5LZ 5TISZ 5GTIZ 3KZIZ 2AXTZ 5B5EZ 5E79Z 4PJ0Z 3A0BZ 5KAFZ 5H2FZ 5B66Z 3A0HZ 3JCUZ 5GTHZ 3WU2Z 5KAIZ 4IL6Z 4UB6Z 4UB8Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L Z;  5TIS Z;  5GTI Z;  3KZI Z;  2AXT Z;  5B5E Z;  5E79 Z;  4PJ0 Z;  3A0B Z;  5KAF Z;  5H2F Z;  5B66 Z;  3A0H Z;  3JCU Z;  5GTH Z;  3WU2 Z;  5KAI Z;  4IL6 Z;  4UB6 Z;  4UB8 Z; 
#chains in the Genus database with same CATH topology
 1WP8 A;  4WFG A;  2ZXW C;  5F2V O;  2F95 B;  5HFL A;  5D5P A;  4JI3 O;  4D7T A;  2Q7G A;  5L3D A;  3DGE A;  4X64 O;  1OJH A;  4KUM A;  1MZF A;  5IYZ B;  1LR1 A;  1YXB A;  5J2T B;  4LWS A;  2IJH A;  4LFB O;  4X8A A;  3I56 V;  1IX9 A;  2YXY A;  4RAI A;  2WA3 A;  1YJ9 V;  3JYC A;  4AI8 A;  4X1K B;  2Q0A A;  1YIJ V;  1YEW A;  1E1Q G;  1ORQ C;  3CC2 V;  2ZE8 A;  4O4L A;  4LC1 A;  1MSD A;  4Q6G A;  2XTA A;  2HVJ C;  1XHZ A;  5H6Q A;  1W0K G;  4A5U B;  1J95 A;  4UVB A;  2OWO A;  4PDL A;  3SPI A;  1QR9 A;  4UUJ C;  4JPR A;  4MTO A;  2OCC B;  1H2S B;  1PM9 A;  3CRC A;  1S5J A;  3W7W A;  4LH7 A;  3E86 A;  3U11 A;  1Q6I A;  1VQK V;  2NNU A;  2Q6A A;  4UCS A;  2R9A A;  2UUA B;  5JCO A;  1URF A;  4Z1M G;  1NJI W;  4GX5 A;  4PA7 A;  5KMG A;  2EZP A;  2DQ3 A;  2DYS B;  4CS2 A;  4D6T H;  4TQD A;  3CMA V;  4NXM B;  1KUQ A;  1Q43 A;  5IT9 N;  1B6Q A;  1XOU A;  1KU9 A;  3B40 A;  2YI8 A;  4P9O A;  2E75 B;  3JAL A;  5C8Y A;  2UUA O;  1NH2 B;  3H9V A;  3IFX A;  5BR8 B;  4X89 A;  2A9H A;  1FYJ A;  4DRX B;  3WU2 Z;  4TV9 B;  1BL8 A;  1GK9 A;  2IJJ A;  3S3W A;  3JCZ A;  1D2D A;  4X65 O;  5DM6 V;  4PA9 A;  1QLE C;  1K97 A;  3OEE G;  3OR7 C;  4PI2 A;  2JS5 A;  1RM1 B;  4PI0 A;  4JF3 A;  4X66 B;  2AHZ A;  5LHI A;  3IC7 A;  1KMI Z;  2HVK C;  1KYO F;  3CPW U;  1VQ5 V;  2ADQ B;  4GKJ B;  2ZXW B;  3BCC H;  2ADP A;  3D3Q A;  5BR8 O;  4PDR A;  1FXK A;  4EFB A;  4DV1 B;  2X6B A;  4X88 A;  3JAM N;  1DF5 A;  1XBL A;  1R3L C;  1BZK A;  1JJ2 U;  3C90 A;  1JR9 A;  3ZX6 A;  1AI6 A;  5KUM A;  5EBL C;  2HFE C;  5LP6 C;  4DR7 B;  1VP7 A;  3GWO A;  2YXL A;  4CZZ A;  4U3J B;  3L74 H;  1Q8I A;  2IJI A;  1QHT A;  4X66 O;  3ETG A;  4O2B B;  4YJ3 B;  4BIO A;  2H8P C;  2EIK C;  4JI0 B;  1DTO A;  3Q4H B;  2JGD B;  2UUC O;  4GKJ O;  5BMV B;  1AIL A;  3STZ C;  5B5E Z;  2CK3 G;  2YS8 A;  4DV6 B;  4DV1 O;  3APO A;  4UVC A;  3JAW A;  4FM1 A;  1KD1 W;  1M93 A;  2YSU B;  3D36 C;  3FAV B;  4X20 A;  5LA6 A;  2EJR A;  4I5S A;  5H6R A;  4ZBM A;  4O4J B;  2A7W A;  3ABM C;  3QG5 A;  4DR7 O;  1CPY A;  3SR2 C;  2GDS A;  3AG2 C;  4FIP C;  1IUR A;  4CBC A;  2JIZ G;  4JI1 B;  2RMK B;  1KB9 F;  3OW2 U;  4HYO A;  4F6R A;  3VBB A;  5H5N A;  5JQG B;  1JJO A;  4JI0 O;  3CJH B;  1R3J C;  4JTA B;  4NTX A;  2PTM A;  1F23 A;  1GRJ A;  4I55 A;  4NXN B;  1NQT A;  5KHG A;  4DV6 O;  5JCO C;  2W6I G;  1KP3 A;  3SYA A;  1WA8 A;  3OMN B;  4J11 A;  4FZ1 A;  4XDJ A;  4JI5 O;  4JI4 B;  1GM8 A;  4UFZ A;  5KA5 A;  3O65 A;  5JH7 B;  4TUY A;  2QWP B;  5L3F A;  5KLV H;  4JI1 O;  4DR6 B;  1I7F A;  2DE0 X;  3JAK A;  1EN5 A;  2JEU A;  2VWJ A;  1OCC C;  1JOY A;  1Q90 D;  2A79 B;  1EZJ A;  1JPX A;  1M90 W;  5FLX N;  5IYZ A;  4JI4 O;  1BE3 H;  3OEH G;  1PNM A;  1ZTE A;  5EZY B;  1QLE B;  3AK1 A;  2PY5 A;  1M57 C;  3SPC A;  2OTL V;  2FL4 A;  4TT3 G;  1HNX B;  4DR6 O;  3S3X A;  1MSW D;  1SES A;  3FB8 C;  4PHZ A;  4HNA A;  5JJN B;  3BAB A;  2UXN A;  2PI5 A;  1H2N A;  1L0L H;  3ABK B;  3RBZ A;  1XRE A;  1RPO A;  1M56 C;  2XUM A;  1Y4M A;  3SYQ A;  1SQF A;  4I9W A;  1VMG A;  3APQ A;  3K3W A;  1UPG A;  1XL6 A;  3L9D A;  3QTC A;  5CA0 A;  1KC8 W;  1MZE A;  2P67 A;  3UT5 B;  2R72 A;  2FYU H;  2FB5 A;  1Q6H A;  2AZ2 A;  2ZCE A;  2ZT9 B;  5AG2 A;  3OE7 G;  2ZIO A;  4UVA A;  3BRC A;  4ZIB A;  4FVM A;  1N32 B;  3AK2 A;  4J9Z B;  3JD2 A;  1VQL V;  1MG1 A;  3T1H B;  1QNM A;  1YJN V;  5FPR A;  2GUZ B;  3DC5 A;  2GTA A;  1HNZ B;  2ZM6 B;  3ABM B;  3WB1 A;  3AG2 B;  1J5E B;  1RPR A;  3RGB A;  2Y48 A;  4G27 B;  1SRY A;  4FK5 C;  3VQV A;  4JZ2 A;  4JI7 B;  1AJN A;  1UJW B;  1SET A;  4TWK A;  4P9P A;  2DJV A;  3ASO C;  1S0V A;  4L8J A;  4DRX A;  1HR0 B;  4TV9 A;  3A2F A;  1N32 O;  5CMU A;  1WJZ A;  2Q7H A;  5CB4 B;  4J7K A;  3QO8 A;  3LDC A;  3T1H O;  3C3S A;  2ETN A;  2K9P A;  1PPJ H;  4W4K A;  3W7X A;  1Y66 A;  3RN4 A;  4RUF A;  1XHX A;  5BZB A;  1XMO O;  1K5S A;  1VF7 A;  2W0X A;  3KCX A;  2QTO A;  3ZHU A;  2ZM6 O;  5LGN A;  4N21 A;  3LSU A;  1J5E O;  1F4M A;  1H2G A;  3B09 A;  1I5Y A;  5IJ9 A;  3VOU A;  4JYB A;  3FKS G;  3SPH A;  2XT9 A;  3JD4 A;  3WFV A;  4IYI A;  4JI7 O;  5E79 Z;  4UCR A;  1R6N A;  3B77 A;  1NI8 A;  3WG7 C;  1ZAU A;  5DEC A;  2QM8 A;  1N34 B;  3E8H A;  1RSO A;  1OCC B;  4LBE C;  1HR0 O;  5C8Y B;  1G4Y B;  1SS3 A;  2EIL C;  4FM2 A;  3ZN0 A;  2D3O W;  4I4T B;  4U3J A;  2HEP A;  4JAA A;  2Y4U A;  2RDC A;  4UCV A;  4HBN A;  4PJ0 Z;  4O2B A;  2UXC B;  1U97 A;  4RWU A;  4EFE A;  4QE9 A;  2KKW A;  3Q4H A;  2JGD A;  1Q5O A;  4PEL A;  3G71 V;  2QM7 A;  1Q7Y W;  3STL C;  2CE4 A;  2UXD B;  1FFT B;  1L1F A;  1E79 G;  2CTP A;  1N34 O;  1M56 B;  2B5U A;  2MW2 B;  1BMF G;  3SJB C;  5EBW C;  3FAV A;  1JX9 A;  2JS3 A;  2ZR2 A;  3BA9 A;  5K1P A;  1XNR B;  3CRR A;  3F7Y C;  2QDO A;  4K35 A;  4U7N A;  1NTK H;  2IM9 A;  2YIB A;  2NN4 A;  1HW7 A;  3ZJZ A;  5J2U B;  1FPO A;  3ZHR A;  1TUE B;  2MK3 A;  2QEX V;  4QJF B;  2UXC O;  5IYB O;  2BTQ A;  3KKY A;  5J9P C;  3BA8 A;  3A0R A;  3CJH A;  2ARH A;  2X7R B;  2R70 A;  2WAM A;  1AJP A;  3MDS A;  1TVK B;  3UO3 A;  2UXD O;  2ITC C;  3ETD A;  5IY5 B;  3AG4 C;  2X6C A;  2DW4 A;  4NB5 A;  3M7M X;  1XNR O;  1ZX3 A;  3K9S A;  5FL7 G;  3JAW B;  3G6E V;  2DYR C;  2DOS A;  4LF7 B;  3X2Q C;  4X20 B;  1B04 A;  4YY3 B;  3ZHS A;  1YI2 V;  1GAX A;  1K34 A;  3CWB H;  2BE3 A;  2ILM A;  2E3C A;  3ASO B;  3GWK C;  5LMN B;  1OV9 A;  1GM7 A;  3SGI A;  3R66 A;  4JZG A;  5LYJ A;  3RYC B;  3SPJ A;  1N4C A;  1BSM A;  1S3J A;  2QJ1 A;  5LGT A;  4HAM A;  1Y74 A;  3E35 A;  3MHS C;  4RQE A;  2QWN B;  3F7V C;  1WA8 B;  3CC7 V;  4LF7 O;  4DUZ B;  4LF8 B;  4CS4 A;  3N2G A;  4H0L B;  4ASU G;  1IBK B;  4LCU C;  4ZHQ A;  4LFB B;  1YDX A;  1Z2G A;  5D5Q A;  4GX1 A;  2N74 A;  2IJK A;  3CCV V;  4FFK A;  4TUY B;  2CGO A;  1FJG B;  2PI4 A;  4YJ2 A;  1S5L Z;  3WG7 B;  1VF6 C;  4DW0 A;  4TQF A;  5LMN O;  3H1J H;  3JAK B;  4R8C A;  4OX9 B;  1EN6 A;  4CH3 A;  1PL0 A;  2OCH A;  3CX5 F;  1VQP V;  2QWO B;  3AG3 C;  5LP6 A;  4LNU A;  2Y69 B;  3UT5 A;  5LBQ A;  2YDE A;  4OPA A;  4DUZ O;  4LF8 O;  4K0K B;  1NKD A;  1IBK O;  1QVF U;  3L75 H;  2G38 A;  4GX2 A;  5GTI Z;  4E4E A;  2HR3 A;  2V7Q G;  1XEQ A;  2K1E A;  3GVM A;  1FJG O;  2ZIM A;  2JDI G;  2DMX A;  4RO2 A;  5IDJ A;  4X1I A;  4HNA B;  5EBM C;  3L72 H;  3G6B A;  2EX3 A;  2W6J G;  1WAZ A;  3D36 A;  4OX9 O;  2GUZ A;  4I0X B;  1CEZ A;  2KG7 A;  1JVM A;  3ZRX A;  3K0D A;  1QVG U;  2DQ0 A;  5KHI A;  1M5I A;  5CA0 B;  4K0K O;  1NBM G;  1NR1 A;  1YVW A;  5CN0 A;  3EHB B;  3N2K B;  4WCE V;  5KUK A;  2WLK A;  4YIP A;  3L70 H;  3H1K H;  5KAI Z;  4FZ0 A;  2CTR A;  5EYP A;  3SYO A;  4P30 A;  3A8T A;  2E74 B;  3AG4 B;  4B3T B;  5CB4 A;  1TUB A;  3R65 A;  3OD4 A;  1F51 A;  4CH6 A;  4DR1 B;  4LF5 O;  2HJF C;  1R6K A;  2ODM A;  4OGQ B;  4X65 B;  4MTX A;  5E1A C;  2M7W A;  4FPP A;  3TXS A;  4JAU A;  3SYC A;  3SDL A;  3K5O A;  1R3I C;  4KP4 A;  1RFY A;  4DV2 B;  2Q73 A;  4WFA V;  4JAV A;  3W7T A;  3IGA C;  3NXS A;  4LFC B;  3RWR D;  3OM3 B;  4B3T O;  3K5M A;  2UXX A;  3ASN C;  1V55 B;  3JD3 A;  4DR1 O;  4MVR A;  2P90 A;  3T4Z A;  3FYE B;  3BAA A;  4I4T A;  4R50 A;  1Q3E A;  4JYA B;  2CUG A;  1IXM A;  5LOV A;  2ZDI C;  3CCU V;  3ZRW A;  4GZR B;  1G8M A;  3RVZ A;  3LSS A;  1Y67 A;  4LFA B;  4R7C A;  1FXH A;  2O57 A;  4LF6 O;  3CS5 A;  1WNS A;  1W59 A;  4DV2 O;  5IJ9 B;  2UUC B;  1ZUQ A;  4LFC O;  1W0J G;  3LNN A;  1LUW A;  3EFF K;  4OPH A;  5EC2 C;  4JI8 B;  5JWP A;  1RSO B;  5J2U A;  1AI5 A;  1N33 B;  4JYA O;  2EZO A;  2CDY A;  1OCZ C;  1I94 B;  1Z5W A;  1U96 A;  3VQX A;  2EUL A;  4G2K A;  4LFA O;  5LHH A;  1TVK A;  3OAA G;  2N05 A;  3SYP A;  1MA1 A;  4B08 A;  2HJD A;  5K1X A;  1B3Q A;  1YTF D;  3J7A U;  3ZMT A;  3ZED A;  3I55 V;  1Q81 W;  2LFS A;  4NR1 A;  2F43 G;  2ZE6 A;  4JI8 O;  1OZ0 A;  2P06 A;  2Q4P A;  5GW7 A;  2Z3Y A;  4RQF A;  4GX0 A;  1AB3 A;  4GKK B;  4XDK A;  4JI5 B;  1N33 O;  2JRI A;  2CH7 B;  2LW1 A;  3CE2 A;  3HR0 A;  1VAR A;  3K79 A;  1I94 O;  3E22 B;  4WFE A;  3VQY A;  1G1X B;  2QWR B;  1ZSP A;  4JI6 B;  4QIW F;  1JQ0 A;  1GN4 A;  5JJJ B;  1K73 W;  4UV9 A;  2QM4 A;  2BTQ B;  3OR6 C;  2F23 A;  4MW8 A;  3ZHQ A;  5KAF Z;  3U10 A;  1K4D C;  5B1A C;  3RYC A;  1NZ6 A;  1SC5 B;  2GTS A;  1X59 A;  2AZ0 A;  4BWA A;  1L0N H;  2PZS A;  3MHH C;  5KX5 A;  1PNL A;  2ZNI A;  1FAF A;  3ZN1 A;  3OUS A;  5JVD A;  3K59 A;  4GKK O;  2Q5Z A;  1ROP A;  1D5A A;  3F5W C;  4YHH B;  2GBO A;  1FXV A;  4FLT A;  1B06 A;  4J7Z A;  5IE9 A;  1ARO P;  2EIN C;  4X9Q A;  4JI6 O;  2PYL A;  4LF4 B;  1SZX A;  5IWA B;  3K0G A;  2XAF A;  3K08 A;  2W0F C;  1SQX H;  1Q82 W;  1DGS A;  2LGW A;  1QCE A;  2BCC H;  3DTU B;  4P2Z A;  4JYY A;  2GHY A;  4U3F H;  3ASN B;  2GV9 A;  3BY6 A;  1WPB A;  2ZNJ A;  5LYJ B;  4DUY B;  4KFM A;  3VQW A;  1SQB H;  1NU1 H;  4YHH O;  2KB1 A;  1YJW V;  1Y74 B;  2Z5U A;  4BW9 A;  1VQ4 V;  2FML A;  1SQP H;  4UCT A;  2XAJ A;  2R9R B;  2UU9 O;  4WF9 V;  3N2G B;  1H2L A;  3E8F A;  2PUS A;  4LF4 O;  4ZHQ B;  5IWA O;  2YIA A;  3BVO A;  5L3E A;  3TGU H;  4JTC B;  2D2C B;  1IXB A;  3AG7 A;  3RYI B;  2HLD G;  4I0X A;  1SQG A;  4YJ2 B;  1KKD A;  5L3G A;  3RYF B;  1N0N A;  1D5N A;  3ZCC A;  3OMA B;  4PDM A;  2F4V O;  3RYH A;  4DUY O;  2OIE A;  4E2L A;  1GO3 F;  3J80 N;  4NTW A;  2JJ1 G;  3CCM V;  1HP8 A;  3BFR A;  4N23 A;  3H1L H;  3N2K A;  1OCZ B;  1O9H A;  5LP6 B;  4LNU B;  4DXW A;  1E1R G;  1SER A;  2PYJ A;  2EIK B;  2PGG A;  3G4S V;  2QE7 G;  4B3S B;  3CRM A;  3IAY A;  5FPO A;  4X1I B;  5LXT A;  1DK1 A;  3TK1 A;  4TV8 A;  2KG7 B;  4O4I B;  1XMO B;  1M4U A;  1K4C C;  4B7K A;  1WP7 A;  1F7Y A;  2HKO A;  3E8B A;  2YXH A;  2IH3 C;  4MT8 A;  1BGY H;  2JJ2 G;  4EB6 B;  1SA0 B;  3JAT B;  5B1B C;  4O2A B;  4DV3 B;  1VQ7 V;  1YF2 A;  3BHP A;  5JJE B;  4MVS A;  1KEC A;  4DR3 B;  4B3S O;  5EYP B;  3W7U A;  2A3Q A;  1PP9 H;  4DR4 B;  4FLW A;  3P3P A;  1TUB B;  3ZS8 C;  3CB2 A;  1GH6 A;  4LH6 A;  2X6A A;  2F93 B;  1ZLZ A;  2JVD A;  3FD9 A;  3PN1 A;  4LP8 A;  2EIN B;  3E89 A;  1JCH A;  1THZ A;  5TIS Z;  1ENV A;  1N36 B;  4J80 A;  1VF6 A;  1OCO C;  4FLX A;  1DF4 A;  1M9N A;  3SJQ C;  2VS0 A;  4DV3 O;  3PJS K;  4DR3 O;  1QLN A;  3EXA A;  4TOI A;  2F66 C;  2YUA A;  1AI7 A;  3HKE B;  4DR4 O;  1AP6 A;  3CCJ V;  1DLB A;  1H8H G;  3KCY A;  1Y6X A;  4H33 A;  4ZI7 A;  4MVM A;  2V1D A;  1F4N A;  3UM7 A;  4J10 A;  2NR5 A;  2ZE5 A;  1AR5 A;  3CXH F;  1M57 B;  1FD9 A;  5LOV B;  1P84 F;  1PKX A;  4DK1 A;  2DN9 A;  4O4H A;  3ZRW B;  1N36 O;  1L8D A;  1S5H C;  3K04 A;  3ZMZ A;  1VQ9 V;  3L73 H;  3JAS B;  4X1Y A;  1MAB G;  3ZRV A;  3MAQ A;  2B1I A;  3CCL V;  2CH7 A;  2OT5 A;  4MTF A;  4JV5 O;  1K5Q A;  2Z0A A;  4FLV A;  1PV0 A;  3E22 A;  3SJC C;  1ZWI C;  2C2A A;  3FB7 C;  2B9Z A;  3CSX A;  2JGU A;  3H01 A;  4PV1 B;  4FM0 A;  1YZB A;  3M99 B;  4GYC B;  4B3R B;  4WFH A;  4DYL A;  3IC9 A;  4Z2W A;  2BOC C;  3CCR V;  3QO7 A;  1JA8 A;  5EK0 A;  1EZV H;  2LGQ A;  3OTO B;  4BIZ A;  3T4D A;  4FLY A;  3P3N A;  4LF9 B;  4D7S A;  4WBN A;  1I5X A;  4K8X A;  4AIL C;  3OGC C;  3D3I A;  4DR5 B;  3G80 A;  4IGG A;  2IBZ H;  2WLL B;  5A9G A;  4DK0 A;  1KKC A;  4KXR A;  3B8M A;  4B3R O;  4MVQ A;  1US6 A;  2B1G A;  4I9Q A;  1EBO A;  3NR7 A;  1NVP D;  2GSM B;  3OTO O;  3HKC A;  4FFB A;  3UKM A;  4EKW A;  3T2M A;  3DC6 A;  4NVP A;  4LF9 O;  3UCS C;  1JFF B;  3OMI B;  4JAS A;  5KX5 B;  3K06 A;  4NTY A;  1BS3 A;  4K3A A;  4IIJ A;  2ZDI A;  1SQV H;  4QGP A;  4DR5 O;  5JVD B;  4CS3 A;  2HP8 A;  1NTZ H;  4PA4 A;  4IYH A;  4MVU A;  2XND G;  1SF9 A;  1WB8 A;  3DSQ A;  3RYI A;  3W7S A;  1OCO B;  5BY1 A;  3CCE V;  5HFM A;  3RYF A;  2Y0P A;  1K33 A;  1P7G A;  1SQQ H;  3FX7 A;  1R73 A;  2EIM C;  4DV4 B;  2ZE7 A;  3A0H Z;  1RM1 C;  2EIL B;  4QPJ A;  5A2Q N;  1UFI A;  4J41 A;  3T1C A;  2Q8V A;  3E83 A;  1HWY A;  2EBO A;  3L71 H;  2P7T C;  3HKD B;  5GON A;  2YEV B;  3B8N A;  5BXZ A;  3SPG A;  1M1K W;  1TAE A;  4ZKI A;  4MTG A;  4Z1V A;  4I50 A;  4IL6 Z;  4DV4 O;  4O4I A;  1KBH A;  5IJ0 B;  4LF5 B;  5EIB C;  2FTK A;  5KA6 A;  1Q6U A;  3RYH B;  3ML0 A;  2E76 B;  4DR2 B;  3ETQ A;  1Q86 W;  2NLJ C;  3OFN G;  3A0B Z;  2N04 A;  5CA1 B;  3DXR B;  1VQM V;  4EB6 A;  1SA0 A;  3JAT A;  1K92 A;  4O2A A;  1GN6 A;  4F4L A;  1IVS A;  1Z5V A;  3UQ8 A;  1K9M W;  1W2B U;  3AG1 C;  4ZOL B;  3D8C A;  1P49 A;  5CBF A;  3K03 A;  4UCO A;  3HKB B;  2VQF B;  1PL4 A;  3LNM B;  4J7J A;  4FMT A;  2P5O A;  1YTF B;  4DV7 B;  5LXT B;  1GTO A;  2DYR B;  1TGO A;  3X2Q B;  1FFX B;  4DR2 O;  5L3C A;  4TV8 B;  1CP9 A;  3FB5 C;  3P30 A;  3ZHT A;  4WFF A;  4LF6 B;  2CTW A;  2LJ2 A;  3ZIA G;  2LW7 A;  4GT1 A;  2CGN A;  3QNE A;  1ZL8 A;  2ZQM A;  4CC5 A;  3HKE A;  2WLI B;  1H38 A;  5KHK A;  2OIG A;  1CXZ B;  2VQF O;  3HB3 B;  3ABL C;  4XBF A;  3K57 A;  4DV7 O;  2VQE B;  3FFQ A;  4CC6 A;  3CRQ A;  2LO1 A;  5LL6 Y;  1EN4 A;  2YID A;  2YI9 A;  3JD0 A;  1SKV A;  2LFR A;  2WWW A;  3JAS A;  1BQZ A;  5C93 A;  4H44 B;  1AR1 B;  3LUT B;  2XOK G;  2QKS A;  4IHJ A;  2EIM B;  4NXM O;  5B3S C;  3ZMS A;  5LGU A;  3AG3 B;  4R6Z A;  2IU3 A;  4CH5 A;  2VQE O;  2VWK A;  2P4V A;  1NR7 A;  4W4L A;  5KHJ A;  3ABK C;  4ZI7 B;  3JSN A;  1IBM B;  3C3T A;  1GN2 A;  4J42 A;  4KHP B;  3H1H H;  2P4K A;  1VQ6 V;  2H94 A;  3CYO A;  4O4H B;  3CXC U;  3ZHV A;  4EEQ A;  1R6T A;  2AXT Z;  4DW1 A;  2Q69 A;  1XIL A;  4RUE A;  3H1I H;  1PD3 A;  3MD0 A;  2ZR3 A;  3TJT A;  4ABM A;  4X1Y B;  1R1B A;  2WLL A;  2XAS A;  1O9G A;  5ITZ A;  2X0L A;  1I0H A;  2CAZ C;  1COW G;  5IYC O;  1IBM O;  4KHP O;  3ZBH A;  2BSK B;  3CHX A;  2AGA A;  1WLE A;  3ZMU A;  1JFF A;  2P6J A;  3AG1 B;  3OTF A;  3E8G A;  4AQY B;  1EFR G;  1VEW A;  1XQ8 A;  2AW9 A;  1BHB A;  1KQS U;  1MOF A;  1NH2 D;  2RJZ A;  2Y0I A;  4WBN B;  2V4D A;  3TET A;  2L35 A;  1NS1 A;  3J81 N;  3JAR B;  2UU9 B;  3CD6 V;  1MMM A;  1AI4 A;  3GB7 C;  1QBZ A;  3O9O A;  1H8E G;  1Y76 B;  4WFB V;  2M6Y A;  1G6U A;  4UB6 Z;  5FNV B;  1AP5 A;  3WB2 A;  4UCU A;  2A0L A;  4UXN A;  1RP3 B;  3HKC B;  4FFB B;  2ITD C;  4AQY O;  2F4V B;  3ABL B;  4NYK A;  3T1Y B;  1QU7 A;  1XNQ B;  1NT2 B;  3RW0 A;  1P4R A;  2FKX A;  4JYC A;  4CH4 A;  5B1O A;  3HKD A;  4IIJ B;  2YEV A;  1IBL B;  4KL1 A;  5DN6 G;  3M8A A;  1OCR C;  3F5T A;  3QF7 A;  2WLN A;  4NXN O;  1QR8 A;  4B3M B;  3QVN A;  2IU0 A;  5CBG A;  4JI2 B;  3RT3 C;  3LDD A;  2Q68 A;  2WLM A;  5EIB D;  5DED A;  4H13 B;  5J2T A;  2WLH A;  3OUF A;  3KG2 A;  5IJ0 A;  4QPK A;  2HG5 C;  3N27 A;  4UV8 A;  5B3S B;  2F1M A;  3T1Y O;  2RN9 A;  1XL4 A;  3ETE A;  1JMK C;  3CRA A;  1XNQ O;  1GMG A;  4X1K A;  1YCI A;  5CA1 A;  3DXR A;  1XUQ A;  1IBL O;  2BTO A;  2L6L A;  4DV5 B;  5H2F Z;  2WSS G;  3ZRS A;  4B3M O;  2AHY A;  2YIB D;  4PD4 F;  2UXB B;  1VQO V;  1GM9 A;  1QQC A;  5GON B;  5GTH Z;  3CCS V;  4JI2 O;  4OXS A;  2WA4 A;  1FXK C;  4ZOL A;  3U0Z A;  5EC1 C;  2QKA A;  1AJQ A;  3HKB A;  3P32 A;  4LR3 A;  2KSD A;  1XI1 A;  4I50 B;  1GKF A;  1HNX O;  2ZKO A;  1FFX A;  3OT7 A;  4FLZ A;  4LWS B;  3THO A;  5B66 Z;  3E2E A;  2QGN A;  3JCU Z;  4MS2 A;  5IY5 C;  1WN7 A;  4DV5 O;  4I7Z B;  4UB8 Z;  2UXB O;  1BHA A;  2JK5 C;  2QA4 V;  2WLI A;  1K3E A;  4O4L B;  5B1A B;  2QSA A;  2PF4 E;  2YIC A;  2RNB A;  2A06 H;  1BQ0 A;  1I08 A;  2Y4T A;  3TXQ A;  2BOB C;  3CEI A;  3JSL A;  4BIU A;  2P22 C;  2E5L B;  4BR6 A;  1YHQ V;  3TCU A;  2EIJ C;  2IH1 C;  3K5L A;  2QWQ B;  1EM1 A;  3BEH A;  3EVK A;  3OGI B;  1VIB A;  4GUN A;  4NKG B;  2XAQ A;  1BCC H;  3CCQ V;  4GCZ A;  4ICG A;  3AK3 A;  5L3B A;  1KP2 A;  5B1N A;  2DWE C;  1V54 C;  3ICX A;  5KMG B;  1AVM A;  2OYQ A;  1HDJ A;  2JEX A;  1VQN V;  1ZL8 B;  3FB6 C;  1AR4 A;  3LSQ A;  1LUV A;  1HNZ O;  4QNH B;  2WPD G;  3G67 A;  4JV5 B;  1NVP B;  2E5L O;  3ZMV A;  5LHG A;  1IZ3 A;  4MVZ A;  3KZI Z;  4QE7 A;  1IDS A;  1MNG A;  4FJC C;  4X62 B;  2Q7E A;  4U7O A;  3IJ4 A;  1XDC A;  1OCR B;  1X4T A;  5CBH A;  2H3O A;  1XMQ B;  3JAL B;  4TSF G;  2UUB B;  4BAY A;  3K9A A;  1A32 A;  2OTJ V;  3LDE A;  2Y69 C;  3AEI A;  2Q67 A;  4J9Y B;  4YIO A;  2LQT A;  4FLU A;  1YIT V;  3FYI B;  1FKA O;  4YJ3 A;  4HZ3 A;  2VRZ A;  2ZIN A;  4IT5 A;  2HHH B;  4F6E A;  2XHB A;  4IHJ B;  2RCV A;  1T5E A;  4YXW G;  5BMV A;  2Q9L A;  1S77 D;  4X62 O;  4G28 B;  3WB0 A;  4DV0 B;  2BSK A;  5H9C A;  1FS0 G;  4L87 A;  1XMQ O;  1NTM H;  3RVY A;  2UUB O;  3ABU A;  2DWD C;  2IW5 A;  4MSW C;  2XAG A;  1SZT A;  4C7U A;  3HPL C;  1FXK B;  1OHH G;  4O4J A;  2Q0O C;  2QTS A;  4PA3 A;  1HNW B;  1YSC A;  2OCC C;  2QKC A;  3CME V;  2HHH O;  2XAH A;  5JQG A;  5LMU B;  3K5N A;  3JAR A;  4B7E A;  4BW5 A;  4DV0 O;  5ITZ B;  4JTD B;  1Y76 A;  2LP7 A;  3ABT A;  5FNV A;  1S76 D;  1V9P A;  1LNQ A;  4Q20 A;  3UO2 A;  3K58 A;  1H2K A;  2EJ7 A;  5B1B B;  4K8Z A;  4PA6 A;  4PDV A;  5CA3 A;  5JH7 A;  2DYS C;  1K8A W;  2WLJ A;  4GLX A;  5LA6 B;  1HNW O;  2CTQ A;  2ZD9 A;  4AHC A;  1N0J A;  5LMU O;  1TA8 A;  1K7D A;  3I5D A;  1S72 V;  2EIJ B;  1WPX A;  3QO5 A;  1PNK A;  4F6R B;  2KQX A;  1WB7 A;  1V55 C;  3JD1 A;  3BPZ A;  5KHH A;  4JI3 B;  4I55 B;  4DO2 A;  3B4S A;  1P7B A;  2R9I A;  2RQ6 A;  5EZY A;  2ATK C;  1V54 B;  1BT8 A;  4X64 B;  1H2M A;  4JGS A;  1VQ8 V;  4MVO A;  1R3K C;  3CC4 V;  4XDL A;  5IYD O;  4YY3 O;  3RFR A;  2QR4 A;  4H37 A;  3B2E E;  1VF5 B;  1N8R W;  4MW3 A;  1GN3 A;  3SJA C;  3CP1 A;  2YC0 A; 
#chains in the Genus database with same CATH homology
 1S5L Z;  5TIS Z;  5GTI Z;  3KZI Z;  2AXT Z;  5B5E Z;  5E79 Z;  4PJ0 Z;  3A0B Z;  5KAF Z;  5H2F Z;  5B66 Z;  3A0H Z;  3JCU Z;  5GTH Z;  3WU2 Z;  5KAI Z;  4IL6 Z;  4UB6 Z;  4UB8 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...