5B66Z

Crystal structure analysis of photosystem ii complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b66Z00
5GTHZ 1S5LZ 4UB6Z 4PJ0Z 5KAIZ 2AXTZ 3A0BZ 3JCUZ 3WU2Z 5TISZ 4UB8Z 3A0HZ 3KZIZ 5B5EZ 5E79Z 5GTIZ 5B66Z 5KAFZ 5H2FZ 4IL6Z
chains in the Genus database with same CATH superfamily
1IVSA 1W2BU 5CA1A 3JD0A 3ZHVA 3SYQA 5BMVB 1YEWA 2WLKA 2EIKC 1M56B 3CJHB 1QVGU 1PL4A 4GX2A 1I94B 4CZZA 4FM2A 3DXRB 1N0JA 5J2UA 3WG7B 1P4RA 2QWRB 4PD4F 4F4LA 1VQ4V 4DV2B 5B66Z 1S72V 1WB8A 2GTSA 1PPJH 5J9PC 1X4TA 1N8RW 3WB0A 4MSWC 5IYZB 2E74B 2WLIA 4BIZA 4FLZA 1YI2V 1GMGA 2X6BA 1K97A 2UXBB 2RDCA 1SF9A 1JPXA 5CMUA 2OCCB 4RAIA 2YI9A 3RVZA 1M57B 4O4HA 3CRMA 2B9ZA 1KC8W 2DOSA 2DYRC 2GSMB 1TAEA 5LP6A 2OTJV 1P84F 3MDSA 3ASOB 2QSAA 1IURA 2AHZA 1H2NA 3C90A 2JJ2G 1RP3B 1FS0G 2VRZA 3F5TA 5LHIA 1SERA 2UXNA 3DC6A 1Q7YW 3QTCA 4JZGA 1OCRC 1GH6A 4B3RB 1VP7A 1YF2A 1E79G 4IHJA 3E8HA 4I7ZB 4DR4B 4NTXA 2VQEO 1D5AA 1L1FA 4EFEA 5LYJB 5BXZA 3CCSV 3ZRWA 3CPWU 2IU0A 3JCUZ 4X20A 3BY6A 3OEHG 4LF4O 2BOCC 4KHPO 4R6ZA 4LF7O 3R65A 1UFIA 5HFMA 2RNBA 3T4DA 1P7GA 3BABA 2Q9LA 2KG7A 3HKEB 4LP8A 5GW7A 4IYHA 2QDOA 1XEQA 5JJEB 3OTOO 4OX9B 3ZIAG 1HNWO 2PUSA 3GWKC 3OEEG 2F23A 1FJGO 3ABUA 3L72H 4GX5A 1VQ8V 1SC5B 3GWOA 4TQFA 1I08A 2R72A 4UCRA 4O4LA 4YHHB 2HP8A 3RYCB 3J80N 3W7SA 4FJCC 1WNSA 3E8BA 4UVBA 4DUYB 3N2KA 1NT2B 3ZHSA 4DV5B 5B1OA 2VQFO 3HB3B 2Q6AA 4DV0B 1Q5OA 4Q6GA 4I4TA 2Q4PA 4E4EA 4IIJB 2IJJA 1I5XA 1OZ0A 3VQXA 4FLTA 3OT7A 3B2EE 1WA8B 5JJNB 4AQYO 2YI8A 5EZYB 3L75H 1COWG 2HHHB 4NKGB 1NQTA 2Y0PA 3ABLC 3JD1A 3SPHA 1XNQO 1MNGA 3JALA 1UJWB 5FNVA 4O4JB 2F43G 5HFLA 4HZ3A 4PV1B 4JI1B 5ITZA 5K1XA 4DV4B 3ZHTA 4L87A 3ZMSA 3CE2A 1XHXA 1SA0B 4X1YA 2GV9A 1FFXB 1Q6UA 1Q6IA 3Q4HB 1XNRB 4DV3B 1O9GA 1RSOA 1KU9A 2Y69B 4UUJC 2P67A 3TXSA 3K04A 1YTFD 4O2BA 4PA9A 1ZL8A 5JQGB 1R3KC 5H2FZ 2EIMC 3RT3C 5EYPA 1HNZO 2DN9A 1YJWV 2ZM6O 4JI8B 3HKDB 2H3OA 3T1HO 4JI6B 4LH6A 4UV9A 3ZEDA 3C3SA 2JGUA 3ZRSA 2ZIOA 1MA1A 4BR6A 2ZDIC 1NVPD 1J5EB 4MTOA 2Q8VA 2QGNA 3BEHA 1AR1B 4J7ZA 2LJ2A 4U3JB 2V1DA 4O2AB 1ZSPA 1IXBA 4EB6B 2WLHA 2A9HA 1PM9A 4UV8A 3F5WC 2ZKOA 4GT1A 4B3SB 5KHIA 2YDEA 2PF4E 1URFA 2FTKA 2UUBO 2HVJC 1QR9A 3K9SA 2IH3C 3EFFK 4PDVA 2B5UA 3BRCA 2WA4A 2YEVA 3LSQA 4UCUA 5CBGA 4X65B 5EBMC 5L3BA 2P4VA 3UO2A 1BL8A 3JYCA 5CA1B 2UUCO 4JI3O 5D5QA 2Y4UA 1BCCH 4XBFA 5B1NA 3ABTA 4QPJA 4GX1A 3BAAA 5E1AC 1GK9A 2GHYA 2XAFA 4U7NA 4H0LB 4U3FH 5GTHZ 3G80A 4JI0O 4DR2O 4BWAA 4MVQA 3STLC 1NH2B 2WLIB 5H5NA 1EFRG 2UXDO 4B3MB 1K92A 1Y66A 3CRAA 4RQEA 1NBMG 2EJRA 4GKKB 2UUAB 4JAVA 3JAWA 4DXWA 5L3DA 4DV7O 2YICA 4J9ZB 2UXCO 3AG4B 4O4HB 4B3TB 1G6UA 3CSXA 4PDMA 3AK2A 2XT9A 4UB6Z 2CGNA 1K73W 1GN6A 5LP6B 2WLLA 2D3OW 2Y4TA 5EIBC 3FB5C 5JVDA 3SPGA 4XDJA 4TUYA 2ZE8A 1JOYA 2JGDA 4BIOA 4NXMB 4J41A 4JTDB 2AHYA 4WFFA 1MSDA 3ZMTA 4IHJB 2GTAA 3UQ8A 3AG3C 2ZINA 1PP9H 4LF9B 1SQGA 3T4ZA 2F4VO 3TGUH 3CX5F 3UM7A 2AGAA 3ZRWB 1U96A 3JARA 3OUSA 4X20B 5E79Z 4A5UB 4LFBB 4X1IA 1N32O 1NJIW 4NTYA 2KG7B 4K0KO 5GONA 2ZXWC 3IC7A 2XOKG 1XL4A 1BSMA 4ZKIA 4JASA 1R6NA 3SPCA 3ZS8C 5EIBD 3H01A 4DUZB 4FLVA 2NR5A 2XASA 1RPOA 3OGCC 3JASB 4O4LB 1Z2GA 4NVPA 4R50A 4I9QA 3ZN0A 2Q67A 4FZ0A 1JJ2U 1QLEC 2RJZA 2X6CA 1HW7A 3N2KB 1Q90D 4IT5A 3A0RA 2HG5C 4JAAA 2ETNA 5D5PA 1M5IA 4I4TB 4TWKA 2N74A 3AG4C 1BMFG 4DR5B 1K4DC 5EK0A 2OWOA 4LF5O 4IYIA 1PV0A 4W4KA 4DRXA 1OCOB 1VEWA 5LGTA 1N33B 2Z5UA 5A2QN 4JZ2A 3JALB 5FNVB 1U97A 5KX5A 1AJPA 3A2FA 2WWWA 5KAFZ 3MAQA 5ITZB 3E89A 3S3WA 1ZWIC 1FD9A 3L73H 3JD3A 3ZJZA 2QJ1A 1NH2D 4WFEA 4X1YB 1PL0A 1G1XB 3TXQA 1XREA 1M4UA 4HYOA 1HNXB 1AI7A 2PTMA 1PKXA 1RSOB 1NU1H 1KB9F 4FMTA 3OD4A 3EXAA 2IU3A 2ZQMA 4O2BB 3ZHRA 1ZL8B 1Y4MA 2IJIA 5EYPB 2JEXA 2QWQB 3K9AA 5LMUB 5EBWC 1YXBA 3IFXA 3JCZA 2ZNIA 3CYOA 2DQ0A 1DF4A 4KFMA 4UXNA 1Y6XA 4X64O 1QU7A 2QM4A 2FKXA 4UCSA 4DV6O 4FLXA 4B08A 4Q20A 1MABG 3N27A 5C93A 2DYRB 2UU9O 1XOUA 5DN6G 3D36C 1LNQA 2AXTZ 1XMQB 3ICXA 1AJNA 2D2CB 3K79A 2LGQA 1X59A 1AILA 3P3NA 5IYCO 4MTGA 5IWAO 1OCRB 5L3CA 1WN7A 1ZTEA 2CTPA 3BFRA 3L71H 3RGBA 3CCVV 1M93A 3ETEA 1H2MA 2YEVB 1GN4A 4LBEC 1SQFA 3LSUA 3WU2Z 1I5YA 5JH7A 4DR1B 1I94O 5KHGA 5KMGA 4KXRA 4PA7A 1UPGA 1HDJA 3CP1A 4DV2O 2XAHA 4UCOA 4DV1B 2JEUA 3SPIA 4P30A 4EFBA 3S3XA 2IJHA 4RUEA 4CBCA 4J7KA 2R9IA 5EC2C 2UXBO 3W7TA 4JI5O 3APQA 3SJAC 5LOVA 3G6EV 4JI4B 1BT8A 4GKJO 3ASNC 1VQ5V 4IL6Z 1N36B 1B3QA 3C3TA 5K1PA 4ZBMA 4G27B 4CS3A 1YCIA 3E86A 2K1EA 3VOUA 3IGAC 4DR3B 1XQ8A 2FMLA 4DW0A 2QR4A 1WB7A 3KCYA 2WLLB 4D7TA 4ABMA 4F6RA 3CC7V 1IBMB 1YTFB 3JATA 4N23A 1Q6HA 2DJVA 4TUYB 4L8JA 2JGDB 4PJ0Z 5B1BC 2P22C 4DR4O 4FLWA 4W4LA 3ABLB 1SQVH 3CC2V 2ODMA 3HR0A 1NVPB 1Y76B 3JARB 2EINC 4P9OA 3BCCH 2X6AA 2HJFC 4X1IB 2HVKC 4K8XA 1OJHA 1AB3A 5GONB 4OX9O 3ZBHA 5LA6A 1W0JG 4OXSA 1TA8A 1BGYH 3BVOA 4YHHO 1GTOA 1QR8A 2DE0X 2ZR3A 2EIMB 2PYJA 2Y48A 4DUYO 2K9PA 1N4CA 3UCSC 1L8DA 1G8MA 1SQBH 3T1CA 1QCEA 3ETDA 4DV0O 3ZHQA 5KHHA 1EZVH 4LC1A 3FD9A 4YY3B 5KUKA 1RFYA 3CMEV 3CB2A 3MD0A 3ML0A 1S5LZ 2HHHO 3D36A 3FKSG 3SR2C 4LF4B 4NYKA 4MTFA 3K59A 1I7FA 3OTFA 2OT5A 5EC1C 4QPKA 2QWPB 2OIEA 1AR5A 5CBFA 4F6EA 2YSUB 2L35A 4JI1O 2H8PC 1BHAA 4DV4O 5KX5B 5FL7G 2DYSC 1Y74A 2BE3A 2ZT9B 3AG7A 1QLNA 4WCEV 4K35A 3SJCC 4JI7B 4MT8A 3ZMUA 4PDLA 2BTQB 2P5OA 3HPLC 1VF6C 3JSNA 3OM3B 2ZD9A 3SJQC 4DV3O 2Q69A 3ZRVA 4LFCB 1BZKA 5KUMA 2WA3A 2A06H 4NTWA 1S77D 3VQWA 1AP5A 2WSSG 3THOA 1KMIZ 3GB7C 4JI8O 1MSWD 1N0NA 2HFEC 3OFNG 4YXWG 3B77A 3K0GA 4ZOLA 4JI6O 4FLYA 4WFGA 2EIJC 5TISZ 4PA6A 2QKCA 1J5EO 1S5HC 2P7TC 1OCCC 2VS0A 1KQSU 1Q3EA 3AG1C 1CEZA 1Q86W 4X66O 1GRJA 5BY1A 1F23A 2JVDA 2ZCEA 1FXHA 4ASUG 5BZBA 1M1KW 3CHXA 4B3SO 2WLJA 3ABMC 1ZUQA 1IBLB 2CGOA 3L9DA 2R9AA 3VQVA 4PI0A 1Q8IA 3ABKB 2ZR2A 4LFAB 4LF8B 3ZHUA 3N2GA 1V54C 1DF5A 2VWKA 1JMKC 4BIUA 2BSKA 2P90A 5IJ9A 2QTOA 1VIBA 2CE4A 4X65O 2HJDA 2E3CA 1XMOB 1KKCA 3W7WA 1WP8A 3AG3B 4RO2A 1N34B 3OW2U 3DSQA 5FLXN 3BA8A 4DW1A 1GM7A 1SQXH 1ZLZA 5JH7B 3F7VC 4IGGA 5KMGB 4TOIA 2DQ3A 1MG1A 4CH6A 2C2AA 1L0LH 4X62B 2V7QG 4LNUA 2EZPA 2ZXWB 1XHZA 1FKAO 3G67A 3G71V 4B3MO 4JYAB 4PA4A 2QM8A 4GKKO 2UUAO 4UVCA 5LOVB 5J2UB 1R6TA 3JD2A 1JJOA 4HAMA 4TV9A 4B3TO 4PDRA 3VQYA 4I55A 5L3FA 1K9MW 2ATKC 1QLEB 2XNDG 4TQDA 2CH7A 2XUMA 4DR7B 5BR8O 2N04A 3BHPA 5B1AC 3RW0A 3J7AU 2GDSA 2LW1A 1F4MA 1HP8A 3X2QC 4F6RB 5J2TA 2JS5A 2DW4A 4NXMO 3E35A 1DGSA 3JATB 1E1QG 1GO3F 1EBOA 1FXKC 4LF6O 1Q82W 4AILC 3BA9A 3O9OA 3CC4V 4LF9O 3ABKC 2ZE7A 4YIOA 2LGWA 3QNEA 1O9HA 4NXNB 2XAQA 4GYCB 1KYOF 4MVSA 4LFBO 4JYCA 1SQPH 4DR6B 1SS3A 1TUBA 1AJQA 3T1YB 4I0XA 3R66A 1P49A 1VF6A 3KKYA 3MHHC 5DECA 2B1IA 4QIWF 4RWUA 4B7KA 4FFBA 2Z3YA 2UXCB 4EEQA 1F4NA 4DUZO 3CWBH 5LA6B 1H38A 1CP9A 4JI2B 1W59A 4DO2A 5KHKA 1Y67A 5H9CA 1QQCA 3LNNA 3JAKA 1PNLA 5KAIZ 4ICGA 2G38A 3AG2C 1DTOA 2O57A 2YXLA 4WFAV 1R3JC 4UB8Z 1AROP 3B09A 3TK1A 2GUZA 1TGOA 2QKSA 3KZIZ 1V9PA 3P30A 3D8CA 1OCZC 3FYIB 4JV5B 3ZCCA 1V55C 1ZAUA 4KP4A 1GKFA 2ZNJA 4Z1MG 3OE7G 3AK3A 2YIBD 3CCUV 2WAMA 3ETQA 4BAYA 1BQZA 5L3GA 1GN2A 2BOBC 4E2LA 1VQLV 2PYLA 3UO3A 1K3EA 1N33O 2F95B 1LUVA 3TCUA 1YJNV 3LUTB 1IBKB 2YXHA 2WLMA 5JJJB 4LR3A 3CD6V 5LXTA 1Q43A 3H1HH 3H1IH 5IY5B 1SESA 2P4KA 3E83A 4UCVA 1Y74B 1JFFA 1S3JA 2F66C 4H44B 3W7UA 2ADQB 3A0BZ 4U7OA 1ROPA 4DYLA 2NLJC 4QGPA 2IJKA 2Q5ZA 1NR1A 3QO8A 1HNXO 2LW7A 2QWOB 5GTIZ 3FX7A 1HR0B 3UKMA 1AP6A 4O4IA 1OHHG 5LHGA 4G2KA 3B40A 2LFSA 4CC6A 2HEPA 5LMUO 4ZOLB 4TSFG 3IC9A 1Z5WA 3KG2A 1BQ0A 2IBZH 3CMAV 4MS2A 2Y0IA 4UFZA 4NR1A 4P2ZA 1VQ6V 1GM8A 3QO5A 4QE7A 4PI2A 4X9QA 3IJ4A 2L6LA 2Q0AA 1YHQV 4K8ZA 3ASNB 5H6RA 4CH5A 3CCMV 3LDCA 1NS1A 4R8CA 2QWNB 4TV8A 3SJBC 5IDJA 1XMQO 2WPDG 4JYYA 5AG2A 3L74H 4OPHA 1JX9A 4BW5A 1EM1A 4CS4A 3W7XA 3KCXA 2YC0A 3N2GB 2R9RB 4X1KA 1S76D 1JR9A 1EN4A 5CA3A 3OMAB 1FXKA 2ZIMA 5IJ9B 5B1BB 1CPYA 2KQXA 1VF7A 4H37A 2RMKB 5DM6V 3E22A 1XBLA 1QVFU 3RN4A 2CTWA 1AI5A 2E5LB 4DR1O 4FFKA 1JQ0A 4CC5A 4I9WA 5C8YA 5LMNB 4GX0A 1HWYA 3H9VA 3B8MA 5IY5C 3HKBA 3E2EA 2EINB 2YIBA 3QO7A 3TJTA 4DV1O 2E75B 2KB1A 2YIDA 3B4SA 3ETGA 1FFTB 2DMXA 1SETA 2IM9A 3TETA 4O2AA 4MVUA 2ITCC 3FB8C 4LNUB 2Q68A 3SPJA 1BHBA 1S5JA 4OGQB 4C7UA 1IX9A 4QJFB 4JI4O 3K5MA 3VBBA 2NNUA 3SYCA 1N36O 2V4DA 4TV9B 4I55B 1NTKH 2PZSA 5LL6Y 4RUFA 1RM1C 1FAFA 4DR3O 2CH7B 2EILC 2LP7A 4JAUA 1MZEA 4N21A 1IBMO 3JAWB 1YSCA 1H2LA 2EX3A 3CRQA 1JA8A 5J2TB 3FAVA 1K7DA 4LWSA 3E8GA 4GZRB 4Z2WA 3AK1A 3UT5A 1FYJA 3K57A 5CB4A 2W0FC 4OPAA 2FB5A 2EZOA 4JPRA 4B3RO 5CA0A 3SDLA 5JVDB 2JJ1G 2DYSB 3CCEV 1NTMH 3DTUB 4YJ2A 4FIPC 4FVMA 4JI5B 4JGSA 1TUBB 4I0XB 2LFRA 5IYBO 3QVNA 2ITDC 3CXHF 4GKJB 3JD4A 1OV9A 3RWRD 2YUAA 4FFBB 5LHHA 2ARHA 1QBZA 2BTOA 3MHSC 4UCTA 4EKWA 1KP3A 2KSDA 3K3WA 4QE9A 1VQ9V 1GM9A 4YJ3A 5DEDA 5A9GA 4GCZA 4MVRA 1KUQA 3BPZA 3EHBB 2PGGA 1KD1W 3JAKB 2A7WA 3DGEA 5JCOC 2EIJB 3H1JH 2GUZB 2B1GA 1G4YB 1PNMA 4YY3O 1OCCB 4CH3A 3AG1B 4FZ1A 1NR7A 1B06A 4RQFA 1XI1A 4DK0A 1VF5B 4DV5O 2EJ7A 3ABMB 1BS3A 3LSSA 3CCRV 2E76B 4X88A 1P7BA 2HR3A 1THZA 4I50A 4XDKA 1F51A 3ZMZA 1V54B 2VQEB 5KA6A 1M56C 5LXTB 3NR7A 2OTLV 3EVKA 4JI7O 5IE9A 4QNHB 2JDIG 1JFFB 2MK3A 5B3SB 4LF7B 4KHPB 1WJZA 3WG7C 4P9PA 1WPBA 5CBHA 4DRXB 3OMNB 3FYEB 3JASA 1EZJA 4CS2A 3CS5A 3RYFA 3K5LA 3SYPA 4LFCO 1F7YA 3OMIB 2AW9A 3OTOB 1HNWB 3ZX6A 4O4IB 3HKCA 2OCCC 1FJGB 2Q7HA 2A79B 1E1RG 4MVMA 1M57C 1IZ3A 1XNRO 2JRIA 2OIGA 4FK5C 3F7YC 2JS3A 1VQOV 3ASOC 4FLUA 1S0VA 4GLXA 4ZHQA 3A8TA 1IXMA 2QTSA 3U11A 2ZE5A 2VQFB 2XAGA 2AZ0A 3K5NA 2XAJA 2M7WA 1IBLO 4TV8B 3K08A 1J95A 2F93B 2CDYA 1LR1A 4AQYB 5B1AB 4LFAO 3DC5A 4LF8O 2UXXA 1VQ7V 1GAXA 1K8AW 5IJ0A 1K5SA 3X2QB 2Q73A 3CRRA 1PNKA 1XL6A 3I56V 1XNQB 1RPRA 4X1KB 2EULA 1FXKB 2CTRA 4MVZA 1XMOO 4MW3A 3CCLV 2WLNA 5LGUA 1KBHA 1N34O 5B5EZ 4WFBV 3E22B 2RN9A 2MW2B 3M7MX 1MZFA 1T5EA 5IT9N 3PN1A 5C8YB 2QKAA 1CXZB 2BCCH 3RYIA 3RFRA 1R6KA 3HKBB 5B3SC 4X62O 4HNAA 1US6A 4WBNA 1YDXA 4J9YB 1EN6A 1WAZA 1NKDA 4ZIBA 3A0HZ 1VQNV 3QF7A 2N05A 4LH7A 3FB6C 4WFHA 1HNZB 4JYAO 4X66B 2W0XA 1MOFA 2ZM6B 2PI4A 3T1HB 3WB2A 2A0LA 1L0NH 2R70A 3FFQA 1AI6A 4UVAA 3T2MA 4JF3A 1YJ9V 2JIZG 3AG2B 5JCOA 4DR7O 2ILMA 3RYHA 1B04A 3D3QA 3WFVA 2PI5A 2QE7G 3FB7C 3NXSA 3E8FA 1OCZB 1K33A 2RCVA 1V55B 1ORQC 1TVKA 4BW9A 1A32A 1ZX3A 3K58A 2UUBB 5CN0A 2RQ6A 4WF9V 2Q0OC 3FAVB 4ZI7A 3U0ZA 1JCHA 4FM1A 4LWSB 4JTCB 2PY5A 3UT5B 5CB4B 3B8NA 5BMVA 4NXNO 1NTZH 3CJHA 4AI8A 4J10A 4X89A 5CA0B 2CTQA 2P06A 3GVMA 2UUCB 4JI3B 4DR6O 3DXRA 3CXCU 2Y69C 3T1YO 3M8AA 4I5SA 4YJ2B 1VARA 2LO1A 2YIAA 2AZ2A 3JSLA 4D6TH 5L3EA 2YS8A 2JK5C 2W6IG 2DWEC 1W0KG 1MMMA 4PELA 5IYZA 4JI0B 4DR2B 2GBOA 3LDEA 1K4CC 2M6YA 1B6QA 1EN5A 2QM7A 1SQQH 1YIJV 4JI2O 2LQTA 2UXDB 5BR8B 4YJ3B 4DK1A 2X0LA 4DV7B 1D5NA 1Q81W 1R3IC 1JVMA 4TT3G 2IW5A 2Q7GA 4JV5O 5KA5A 1YVWA 2QA4V 1LUWA 4LF6B 3K5OA 3I55V 1ENVA 2QEXV 1Z5VA 1R73A 1Y76A 3JAMN 3M99B 1IBKO 1XUQA 3WB1A 3K06A 3ZRXA 4DR5O 5LYJA 2OYQA 4I50B 2EBOA 1WLEA 1NZ6A 3SYOA 4NB5A 1DK1A 2F4VB 4R7CA 5H6QA 2ZE6A 1VQKV 1AR4A 3HKEA 1WPXA 4H33A 1R3LC 1N32B 3RYFB 1IDSA 4J42A 4K0KB 3CEIA 3SYAA 3OGIB 1HR0O 5IYDO 1SZXA 4AHCA 2ZDIA 4YIPA 4K3AA 4J11A 1SRYA 4MW8A 3ZN1A 2XTAA 2VWJA 3HKCB 3QG5A 5LGNA 1R1BA 2KKWA 2FL4A 3RYCA 3LNMB 2F1MA 2Q7EA 4XDLA 5KLVH 5LBQA 5LP6C 4G28B 1PD3A 4ZHQB 2CAZC 3OR6C 1WP7A 4IIJA 1XILA 1GN3A 3CRCA 1WA8A 5EBLC 1KP2A 5EZYA 1RM1B 4FPPA 2EILB 1VMGA 3OR7C 1AVMA 1QHTA 3CCQV 4D7SA 3STZC 2BTQA 4LF5B 1QNMA 1H2SB 2P6JA 4B7EA 5FPOA 5IJ0B 3CCJV 3K03A 1M90W 4O4JA 1H2GA 4LCUC 4JTAB 3P3PA 3U10A 2EIKB 4KL1A 1DLBA 1FXVA 4J80A 4MTXA 4X8AA 2E5LO 3RBZA 1SA0A 5F2VO 3I5DA 4H13B 5LMNO 1FFXA 2A3QA 3G6BA 3OUFA 3Q4HA 1KECA 2BSKB 3J81N 3RYIB 1I0HA 1H2KA 1H8HG 5JQGA 4HNAB 4WBNB 3O65A 2X7RB 3L70H 3HKDA 2XHBA 3P32A 1SZTA 2ADPA 4CH4A 4PHZA 1YZBA 1VQMV 3IAYA 5FPRA 1H8EG 4Z1VA 3APOA 3H1KH 2IH1C 2W6JG 4MVOA 1K5QA 3H1LH 3RVYA 4U3JA 1SKVA 3SGIA 4HBNA 1XDCA 4X64B 2DWDC 3OAAG 4PA3A 4DV6B 1NI8A 4J7JA 3PJSK 4EB6A 2CK3G 4GUNA 3D3IA 3RYHB 5JWPA 2H94A 1TUEB 1K34A 3G4SV 2UU9B 2OCHA 1AI4A 2HKOA 2NN4A 1M9NA 3AEIA 1VQPV 1OCOC 1D2DA 3LDDA 4KUMA 2Z0AA 1TVKB 1BE3H 2FYUH 2HLDG 5IWAB 3ZMVA 2YXYA 2CUGA 3K0DA 1KKDA 4ZI7B 1YITV 5KHJA 1FPOA 4JYBA 4FM0A
chains in the Genus database with same CATH topology
5GTHZ 1S5LZ 4UB6Z 4PJ0Z 5KAIZ 2AXTZ 3A0BZ 3JCUZ 3WU2Z 5TISZ 4UB8Z 3A0HZ 3KZIZ 5B5EZ 5E79Z 5GTIZ 5B66Z 5KAFZ 5H2FZ 4IL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH Z;  1S5L Z;  4UB6 Z;  4PJ0 Z;  5KAI Z;  2AXT Z;  3A0B Z;  3JCU Z;  3WU2 Z;  5TIS Z;  4UB8 Z;  3A0H Z;  3KZI Z;  5B5E Z;  5E79 Z;  5GTI Z;  5B66 Z;  5KAF Z;  5H2F Z;  4IL6 Z; 
#chains in the Genus database with same CATH topology
 1IVS A;  1W2B U;  5CA1 A;  3JD0 A;  3ZHV A;  3SYQ A;  5BMV B;  1YEW A;  2WLK A;  2EIK C;  1M56 B;  3CJH B;  1QVG U;  1PL4 A;  4GX2 A;  1I94 B;  4CZZ A;  4FM2 A;  3DXR B;  1N0J A;  5J2U A;  3WG7 B;  1P4R A;  2QWR B;  4PD4 F;  4F4L A;  1VQ4 V;  4DV2 B;  5B66 Z;  1S72 V;  1WB8 A;  2GTS A;  1PPJ H;  5J9P C;  1X4T A;  1N8R W;  3WB0 A;  4MSW C;  5IYZ B;  2E74 B;  2WLI A;  4BIZ A;  4FLZ A;  1YI2 V;  1GMG A;  2X6B A;  1K97 A;  2UXB B;  2RDC A;  1SF9 A;  1JPX A;  5CMU A;  2OCC B;  4RAI A;  2YI9 A;  3RVZ A;  1M57 B;  4O4H A;  3CRM A;  2B9Z A;  1KC8 W;  2DOS A;  2DYR C;  2GSM B;  1TAE A;  5LP6 A;  2OTJ V;  1P84 F;  3MDS A;  3ASO B;  2QSA A;  1IUR A;  2AHZ A;  1H2N A;  3C90 A;  2JJ2 G;  1RP3 B;  1FS0 G;  2VRZ A;  3F5T A;  5LHI A;  1SER A;  2UXN A;  3DC6 A;  1Q7Y W;  3QTC A;  4JZG A;  1OCR C;  1GH6 A;  4B3R B;  1VP7 A;  1YF2 A;  1E79 G;  4IHJ A;  3E8H A;  4I7Z B;  4DR4 B;  4NTX A;  2VQE O;  1D5A A;  1L1F A;  4EFE A;  5LYJ B;  5BXZ A;  3CCS V;  3ZRW A;  3CPW U;  2IU0 A;  3JCU Z;  4X20 A;  3BY6 A;  3OEH G;  4LF4 O;  2BOC C;  4KHP O;  4R6Z A;  4LF7 O;  3R65 A;  1UFI A;  5HFM A;  2RNB A;  3T4D A;  1P7G A;  3BAB A;  2Q9L A;  2KG7 A;  3HKE B;  4LP8 A;  5GW7 A;  4IYH A;  2QDO A;  1XEQ A;  5JJE B;  3OTO O;  4OX9 B;  3ZIA G;  1HNW O;  2PUS A;  3GWK C;  3OEE G;  2F23 A;  1FJG O;  3ABU A;  3L72 H;  4GX5 A;  1VQ8 V;  1SC5 B;  3GWO A;  4TQF A;  1I08 A;  2R72 A;  4UCR A;  4O4L A;  4YHH B;  2HP8 A;  3RYC B;  3J80 N;  3W7S A;  4FJC C;  1WNS A;  3E8B A;  4UVB A;  4DUY B;  3N2K A;  1NT2 B;  3ZHS A;  4DV5 B;  5B1O A;  2VQF O;  3HB3 B;  2Q6A A;  4DV0 B;  1Q5O A;  4Q6G A;  4I4T A;  2Q4P A;  4E4E A;  4IIJ B;  2IJJ A;  1I5X A;  1OZ0 A;  3VQX A;  4FLT A;  3OT7 A;  3B2E E;  1WA8 B;  5JJN B;  4AQY O;  2YI8 A;  5EZY B;  3L75 H;  1COW G;  2HHH B;  4NKG B;  1NQT A;  2Y0P A;  3ABL C;  3JD1 A;  3SPH A;  1XNQ O;  1MNG A;  3JAL A;  1UJW B;  5FNV A;  4O4J B;  2F43 G;  5HFL A;  4HZ3 A;  4PV1 B;  4JI1 B;  5ITZ A;  5K1X A;  4DV4 B;  3ZHT A;  4L87 A;  3ZMS A;  3CE2 A;  1XHX A;  1SA0 B;  4X1Y A;  2GV9 A;  1FFX B;  1Q6U A;  1Q6I A;  3Q4H B;  1XNR B;  4DV3 B;  1O9G A;  1RSO A;  1KU9 A;  2Y69 B;  4UUJ C;  2P67 A;  3TXS A;  3K04 A;  1YTF D;  4O2B A;  4PA9 A;  1ZL8 A;  5JQG B;  1R3K C;  5H2F Z;  2EIM C;  3RT3 C;  5EYP A;  1HNZ O;  2DN9 A;  1YJW V;  2ZM6 O;  4JI8 B;  3HKD B;  2H3O A;  3T1H O;  4JI6 B;  4LH6 A;  4UV9 A;  3ZED A;  3C3S A;  2JGU A;  3ZRS A;  2ZIO A;  1MA1 A;  4BR6 A;  2ZDI C;  1NVP D;  1J5E B;  4MTO A;  2Q8V A;  2QGN A;  3BEH A;  1AR1 B;  4J7Z A;  2LJ2 A;  4U3J B;  2V1D A;  4O2A B;  1ZSP A;  1IXB A;  4EB6 B;  2WLH A;  2A9H A;  1PM9 A;  4UV8 A;  3F5W C;  2ZKO A;  4GT1 A;  4B3S B;  5KHI A;  2YDE A;  2PF4 E;  1URF A;  2FTK A;  2UUB O;  2HVJ C;  1QR9 A;  3K9S A;  2IH3 C;  3EFF K;  4PDV A;  2B5U A;  3BRC A;  2WA4 A;  2YEV A;  3LSQ A;  4UCU A;  5CBG A;  4X65 B;  5EBM C;  5L3B A;  2P4V A;  3UO2 A;  1BL8 A;  3JYC A;  5CA1 B;  2UUC O;  4JI3 O;  5D5Q A;  2Y4U A;  1BCC H;  4XBF A;  5B1N A;  3ABT A;  4QPJ A;  4GX1 A;  3BAA A;  5E1A C;  1GK9 A;  2GHY A;  2XAF A;  4U7N A;  4H0L B;  4U3F H;  5GTH Z;  3G80 A;  4JI0 O;  4DR2 O;  4BWA A;  4MVQ A;  3STL C;  1NH2 B;  2WLI B;  5H5N A;  1EFR G;  2UXD O;  4B3M B;  1K92 A;  1Y66 A;  3CRA A;  4RQE A;  1NBM G;  2EJR A;  4GKK B;  2UUA B;  4JAV A;  3JAW A;  4DXW A;  5L3D A;  4DV7 O;  2YIC A;  4J9Z B;  2UXC O;  3AG4 B;  4O4H B;  4B3T B;  1G6U A;  3CSX A;  4PDM A;  3AK2 A;  2XT9 A;  4UB6 Z;  2CGN A;  1K73 W;  1GN6 A;  5LP6 B;  2WLL A;  2D3O W;  2Y4T A;  5EIB C;  3FB5 C;  5JVD A;  3SPG A;  4XDJ A;  4TUY A;  2ZE8 A;  1JOY A;  2JGD A;  4BIO A;  4NXM B;  4J41 A;  4JTD B;  2AHY A;  4WFF A;  1MSD A;  3ZMT A;  4IHJ B;  2GTA A;  3UQ8 A;  3AG3 C;  2ZIN A;  1PP9 H;  4LF9 B;  1SQG A;  3T4Z A;  2F4V O;  3TGU H;  3CX5 F;  3UM7 A;  2AGA A;  3ZRW B;  1U96 A;  3JAR A;  3OUS A;  4X20 B;  5E79 Z;  4A5U B;  4LFB B;  4X1I A;  1N32 O;  1NJI W;  4NTY A;  2KG7 B;  4K0K O;  5GON A;  2ZXW C;  3IC7 A;  2XOK G;  1XL4 A;  1BSM A;  4ZKI A;  4JAS A;  1R6N A;  3SPC A;  3ZS8 C;  5EIB D;  3H01 A;  4DUZ B;  4FLV A;  2NR5 A;  2XAS A;  1RPO A;  3OGC C;  3JAS B;  4O4L B;  1Z2G A;  4NVP A;  4R50 A;  4I9Q A;  3ZN0 A;  2Q67 A;  4FZ0 A;  1JJ2 U;  1QLE C;  2RJZ A;  2X6C A;  1HW7 A;  3N2K B;  1Q90 D;  4IT5 A;  3A0R A;  2HG5 C;  4JAA A;  2ETN A;  5D5P A;  1M5I A;  4I4T B;  4TWK A;  2N74 A;  3AG4 C;  1BMF G;  4DR5 B;  1K4D C;  5EK0 A;  2OWO A;  4LF5 O;  4IYI A;  1PV0 A;  4W4K A;  4DRX A;  1OCO B;  1VEW A;  5LGT A;  1N33 B;  2Z5U A;  5A2Q N;  4JZ2 A;  3JAL B;  5FNV B;  1U97 A;  5KX5 A;  1AJP A;  3A2F A;  2WWW A;  5KAF Z;  3MAQ A;  5ITZ B;  3E89 A;  3S3W A;  1ZWI C;  1FD9 A;  3L73 H;  3JD3 A;  3ZJZ A;  2QJ1 A;  1NH2 D;  4WFE A;  4X1Y B;  1PL0 A;  1G1X B;  3TXQ A;  1XRE A;  1M4U A;  4HYO A;  1HNX B;  1AI7 A;  2PTM A;  1PKX A;  1RSO B;  1NU1 H;  1KB9 F;  4FMT A;  3OD4 A;  3EXA A;  2IU3 A;  2ZQM A;  4O2B B;  3ZHR A;  1ZL8 B;  1Y4M A;  2IJI A;  5EYP B;  2JEX A;  2QWQ B;  3K9A A;  5LMU B;  5EBW C;  1YXB A;  3IFX A;  3JCZ A;  2ZNI A;  3CYO A;  2DQ0 A;  1DF4 A;  4KFM A;  4UXN A;  1Y6X A;  4X64 O;  1QU7 A;  2QM4 A;  2FKX A;  4UCS A;  4DV6 O;  4FLX A;  4B08 A;  4Q20 A;  1MAB G;  3N27 A;  5C93 A;  2DYR B;  2UU9 O;  1XOU A;  5DN6 G;  3D36 C;  1LNQ A;  2AXT Z;  1XMQ B;  3ICX A;  1AJN A;  2D2C B;  3K79 A;  2LGQ A;  1X59 A;  1AIL A;  3P3N A;  5IYC O;  4MTG A;  5IWA O;  1OCR B;  5L3C A;  1WN7 A;  1ZTE A;  2CTP A;  3BFR A;  3L71 H;  3RGB A;  3CCV V;  1M93 A;  3ETE A;  1H2M A;  2YEV B;  1GN4 A;  4LBE C;  1SQF A;  3LSU A;  3WU2 Z;  1I5Y A;  5JH7 A;  4DR1 B;  1I94 O;  5KHG A;  5KMG A;  4KXR A;  4PA7 A;  1UPG A;  1HDJ A;  3CP1 A;  4DV2 O;  2XAH A;  4UCO A;  4DV1 B;  2JEU A;  3SPI A;  4P30 A;  4EFB A;  3S3X A;  2IJH A;  4RUE A;  4CBC A;  4J7K A;  2R9I A;  5EC2 C;  2UXB O;  3W7T A;  4JI5 O;  3APQ A;  3SJA C;  5LOV A;  3G6E V;  4JI4 B;  1BT8 A;  4GKJ O;  3ASN C;  1VQ5 V;  4IL6 Z;  1N36 B;  1B3Q A;  3C3T A;  5K1P A;  4ZBM A;  4G27 B;  4CS3 A;  1YCI A;  3E86 A;  2K1E A;  3VOU A;  3IGA C;  4DR3 B;  1XQ8 A;  2FML A;  4DW0 A;  2QR4 A;  1WB7 A;  3KCY A;  2WLL B;  4D7T A;  4ABM A;  4F6R A;  3CC7 V;  1IBM B;  1YTF B;  3JAT A;  4N23 A;  1Q6H A;  2DJV A;  4TUY B;  4L8J A;  2JGD B;  4PJ0 Z;  5B1B C;  2P22 C;  4DR4 O;  4FLW A;  4W4L A;  3ABL B;  1SQV H;  3CC2 V;  2ODM A;  3HR0 A;  1NVP B;  1Y76 B;  3JAR B;  2EIN C;  4P9O A;  3BCC H;  2X6A A;  2HJF C;  4X1I B;  2HVK C;  4K8X A;  1OJH A;  1AB3 A;  5GON B;  4OX9 O;  3ZBH A;  5LA6 A;  1W0J G;  4OXS A;  1TA8 A;  1BGY H;  3BVO A;  4YHH O;  1GTO A;  1QR8 A;  2DE0 X;  2ZR3 A;  2EIM B;  2PYJ A;  2Y48 A;  4DUY O;  2K9P A;  1N4C A;  3UCS C;  1L8D A;  1G8M A;  1SQB H;  3T1C A;  1QCE A;  3ETD A;  4DV0 O;  3ZHQ A;  5KHH A;  1EZV H;  4LC1 A;  3FD9 A;  4YY3 B;  5KUK A;  1RFY A;  3CME V;  3CB2 A;  3MD0 A;  3ML0 A;  1S5L Z;  2HHH O;  3D36 A;  3FKS G;  3SR2 C;  4LF4 B;  4NYK A;  4MTF A;  3K59 A;  1I7F A;  3OTF A;  2OT5 A;  5EC1 C;  4QPK A;  2QWP B;  2OIE A;  1AR5 A;  5CBF A;  4F6E A;  2YSU B;  2L35 A;  4JI1 O;  2H8P C;  1BHA A;  4DV4 O;  5KX5 B;  5FL7 G;  2DYS C;  1Y74 A;  2BE3 A;  2ZT9 B;  3AG7 A;  1QLN A;  4WCE V;  4K35 A;  3SJC C;  4JI7 B;  4MT8 A;  3ZMU A;  4PDL A;  2BTQ B;  2P5O A;  3HPL C;  1VF6 C;  3JSN A;  3OM3 B;  2ZD9 A;  3SJQ C;  4DV3 O;  2Q69 A;  3ZRV A;  4LFC B;  1BZK A;  5KUM A;  2WA3 A;  2A06 H;  4NTW A;  1S77 D;  3VQW A;  1AP5 A;  2WSS G;  3THO A;  1KMI Z;  3GB7 C;  4JI8 O;  1MSW D;  1N0N A;  2HFE C;  3OFN G;  4YXW G;  3B77 A;  3K0G A;  4ZOL A;  4JI6 O;  4FLY A;  4WFG A;  2EIJ C;  5TIS Z;  4PA6 A;  2QKC A;  1J5E O;  1S5H C;  2P7T C;  1OCC C;  2VS0 A;  1KQS U;  1Q3E A;  3AG1 C;  1CEZ A;  1Q86 W;  4X66 O;  1GRJ A;  5BY1 A;  1F23 A;  2JVD A;  2ZCE A;  1FXH A;  4ASU G;  5BZB A;  1M1K W;  3CHX A;  4B3S O;  2WLJ A;  3ABM C;  1ZUQ A;  1IBL B;  2CGO A;  3L9D A;  2R9A A;  3VQV A;  4PI0 A;  1Q8I A;  3ABK B;  2ZR2 A;  4LFA B;  4LF8 B;  3ZHU A;  3N2G A;  1V54 C;  1DF5 A;  2VWK A;  1JMK C;  4BIU A;  2BSK A;  2P90 A;  5IJ9 A;  2QTO A;  1VIB A;  2CE4 A;  4X65 O;  2HJD A;  2E3C A;  1XMO B;  1KKC A;  3W7W A;  1WP8 A;  3AG3 B;  4RO2 A;  1N34 B;  3OW2 U;  3DSQ A;  5FLX N;  3BA8 A;  4DW1 A;  1GM7 A;  1SQX H;  1ZLZ A;  5JH7 B;  3F7V C;  4IGG A;  5KMG B;  4TOI A;  2DQ3 A;  1MG1 A;  4CH6 A;  2C2A A;  1L0L H;  4X62 B;  2V7Q G;  4LNU A;  2EZP A;  2ZXW B;  1XHZ A;  1FKA O;  3G67 A;  3G71 V;  4B3M O;  4JYA B;  4PA4 A;  2QM8 A;  4GKK O;  2UUA O;  4UVC A;  5LOV B;  5J2U B;  1R6T A;  3JD2 A;  1JJO A;  4HAM A;  4TV9 A;  4B3T O;  4PDR A;  3VQY A;  4I55 A;  5L3F A;  1K9M W;  2ATK C;  1QLE B;  2XND G;  4TQD A;  2CH7 A;  2XUM A;  4DR7 B;  5BR8 O;  2N04 A;  3BHP A;  5B1A C;  3RW0 A;  3J7A U;  2GDS A;  2LW1 A;  1F4M A;  1HP8 A;  3X2Q C;  4F6R B;  5J2T A;  2JS5 A;  2DW4 A;  4NXM O;  3E35 A;  1DGS A;  3JAT B;  1E1Q G;  1GO3 F;  1EBO A;  1FXK C;  4LF6 O;  1Q82 W;  4AIL C;  3BA9 A;  3O9O A;  3CC4 V;  4LF9 O;  3ABK C;  2ZE7 A;  4YIO A;  2LGW A;  3QNE A;  1O9H A;  4NXN B;  2XAQ A;  4GYC B;  1KYO F;  4MVS A;  4LFB O;  4JYC A;  1SQP H;  4DR6 B;  1SS3 A;  1TUB A;  1AJQ A;  3T1Y B;  4I0X A;  3R66 A;  1P49 A;  1VF6 A;  3KKY A;  3MHH C;  5DEC A;  2B1I A;  4QIW F;  4RWU A;  4B7K A;  4FFB A;  2Z3Y A;  2UXC B;  4EEQ A;  1F4N A;  4DUZ O;  3CWB H;  5LA6 B;  1H38 A;  1CP9 A;  4JI2 B;  1W59 A;  4DO2 A;  5KHK A;  1Y67 A;  5H9C A;  1QQC A;  3LNN A;  3JAK A;  1PNL A;  5KAI Z;  4ICG A;  2G38 A;  3AG2 C;  1DTO A;  2O57 A;  2YXL A;  4WFA V;  1R3J C;  4UB8 Z;  1ARO P;  3B09 A;  3TK1 A;  2GUZ A;  1TGO A;  2QKS A;  3KZI Z;  1V9P A;  3P30 A;  3D8C A;  1OCZ C;  3FYI B;  4JV5 B;  3ZCC A;  1V55 C;  1ZAU A;  4KP4 A;  1GKF A;  2ZNJ A;  4Z1M G;  3OE7 G;  3AK3 A;  2YIB D;  3CCU V;  2WAM A;  3ETQ A;  4BAY A;  1BQZ A;  5L3G A;  1GN2 A;  2BOB C;  4E2L A;  1VQL V;  2PYL A;  3UO3 A;  1K3E A;  1N33 O;  2F95 B;  1LUV A;  3TCU A;  1YJN V;  3LUT B;  1IBK B;  2YXH A;  2WLM A;  5JJJ B;  4LR3 A;  3CD6 V;  5LXT A;  1Q43 A;  3H1H H;  3H1I H;  5IY5 B;  1SES A;  2P4K A;  3E83 A;  4UCV A;  1Y74 B;  1JFF A;  1S3J A;  2F66 C;  4H44 B;  3W7U A;  2ADQ B;  3A0B Z;  4U7O A;  1ROP A;  4DYL A;  2NLJ C;  4QGP A;  2IJK A;  2Q5Z A;  1NR1 A;  3QO8 A;  1HNX O;  2LW7 A;  2QWO B;  5GTI Z;  3FX7 A;  1HR0 B;  3UKM A;  1AP6 A;  4O4I A;  1OHH G;  5LHG A;  4G2K A;  3B40 A;  2LFS A;  4CC6 A;  2HEP A;  5LMU O;  4ZOL B;  4TSF G;  3IC9 A;  1Z5W A;  3KG2 A;  1BQ0 A;  2IBZ H;  3CMA V;  4MS2 A;  2Y0I A;  4UFZ A;  4NR1 A;  4P2Z A;  1VQ6 V;  1GM8 A;  3QO5 A;  4QE7 A;  4PI2 A;  4X9Q A;  3IJ4 A;  2L6L A;  2Q0A A;  1YHQ V;  4K8Z A;  3ASN B;  5H6R A;  4CH5 A;  3CCM V;  3LDC A;  1NS1 A;  4R8C A;  2QWN B;  4TV8 A;  3SJB C;  5IDJ A;  1XMQ O;  2WPD G;  4JYY A;  5AG2 A;  3L74 H;  4OPH A;  1JX9 A;  4BW5 A;  1EM1 A;  4CS4 A;  3W7X A;  3KCX A;  2YC0 A;  3N2G B;  2R9R B;  4X1K A;  1S76 D;  1JR9 A;  1EN4 A;  5CA3 A;  3OMA B;  1FXK A;  2ZIM A;  5IJ9 B;  5B1B B;  1CPY A;  2KQX A;  1VF7 A;  4H37 A;  2RMK B;  5DM6 V;  3E22 A;  1XBL A;  1QVF U;  3RN4 A;  2CTW A;  1AI5 A;  2E5L B;  4DR1 O;  4FFK A;  1JQ0 A;  4CC5 A;  4I9W A;  5C8Y A;  5LMN B;  4GX0 A;  1HWY A;  3H9V A;  3B8M A;  5IY5 C;  3HKB A;  3E2E A;  2EIN B;  2YIB A;  3QO7 A;  3TJT A;  4DV1 O;  2E75 B;  2KB1 A;  2YID A;  3B4S A;  3ETG A;  1FFT B;  2DMX A;  1SET A;  2IM9 A;  3TET A;  4O2A A;  4MVU A;  2ITC C;  3FB8 C;  4LNU B;  2Q68 A;  3SPJ A;  1BHB A;  1S5J A;  4OGQ B;  4C7U A;  1IX9 A;  4QJF B;  4JI4 O;  3K5M A;  3VBB A;  2NNU A;  3SYC A;  1N36 O;  2V4D A;  4TV9 B;  4I55 B;  1NTK H;  2PZS A;  5LL6 Y;  4RUF A;  1RM1 C;  1FAF A;  4DR3 O;  2CH7 B;  2EIL C;  2LP7 A;  4JAU A;  1MZE A;  4N21 A;  1IBM O;  3JAW B;  1YSC A;  1H2L A;  2EX3 A;  3CRQ A;  1JA8 A;  5J2T B;  3FAV A;  1K7D A;  4LWS A;  3E8G A;  4GZR B;  4Z2W A;  3AK1 A;  3UT5 A;  1FYJ A;  3K57 A;  5CB4 A;  2W0F C;  4OPA A;  2FB5 A;  2EZO A;  4JPR A;  4B3R O;  5CA0 A;  3SDL A;  5JVD B;  2JJ1 G;  2DYS B;  3CCE V;  1NTM H;  3DTU B;  4YJ2 A;  4FIP C;  4FVM A;  4JI5 B;  4JGS A;  1TUB B;  4I0X B;  2LFR A;  5IYB O;  3QVN A;  2ITD C;  3CXH F;  4GKJ B;  3JD4 A;  1OV9 A;  3RWR D;  2YUA A;  4FFB B;  5LHH A;  2ARH A;  1QBZ A;  2BTO A;  3MHS C;  4UCT A;  4EKW A;  1KP3 A;  2KSD A;  3K3W A;  4QE9 A;  1VQ9 V;  1GM9 A;  4YJ3 A;  5DED A;  5A9G A;  4GCZ A;  4MVR A;  1KUQ A;  3BPZ A;  3EHB B;  2PGG A;  1KD1 W;  3JAK B;  2A7W A;  3DGE A;  5JCO C;  2EIJ B;  3H1J H;  2GUZ B;  2B1G A;  1G4Y B;  1PNM A;  4YY3 O;  1OCC B;  4CH3 A;  3AG1 B;  4FZ1 A;  1NR7 A;  1B06 A;  4RQF A;  1XI1 A;  4DK0 A;  1VF5 B;  4DV5 O;  2EJ7 A;  3ABM B;  1BS3 A;  3LSS A;  3CCR V;  2E76 B;  4X88 A;  1P7B A;  2HR3 A;  1THZ A;  4I50 A;  4XDK A;  1F51 A;  3ZMZ A;  1V54 B;  2VQE B;  5KA6 A;  1M56 C;  5LXT B;  3NR7 A;  2OTL V;  3EVK A;  4JI7 O;  5IE9 A;  4QNH B;  2JDI G;  1JFF B;  2MK3 A;  5B3S B;  4LF7 B;  4KHP B;  1WJZ A;  3WG7 C;  4P9P A;  1WPB A;  5CBH A;  4DRX B;  3OMN B;  3FYE B;  3JAS A;  1EZJ A;  4CS2 A;  3CS5 A;  3RYF A;  3K5L A;  3SYP A;  4LFC O;  1F7Y A;  3OMI B;  2AW9 A;  3OTO B;  1HNW B;  3ZX6 A;  4O4I B;  3HKC A;  2OCC C;  1FJG B;  2Q7H A;  2A79 B;  1E1R G;  4MVM A;  1M57 C;  1IZ3 A;  1XNR O;  2JRI A;  2OIG A;  4FK5 C;  3F7Y C;  2JS3 A;  1VQO V;  3ASO C;  4FLU A;  1S0V A;  4GLX A;  4ZHQ A;  3A8T A;  1IXM A;  2QTS A;  3U11 A;  2ZE5 A;  2VQF B;  2XAG A;  2AZ0 A;  3K5N A;  2XAJ A;  2M7W A;  1IBL O;  4TV8 B;  3K08 A;  1J95 A;  2F93 B;  2CDY A;  1LR1 A;  4AQY B;  5B1A B;  4LFA O;  3DC5 A;  4LF8 O;  2UXX A;  1VQ7 V;  1GAX A;  1K8A W;  5IJ0 A;  1K5S A;  3X2Q B;  2Q73 A;  3CRR A;  1PNK A;  1XL6 A;  3I56 V;  1XNQ B;  1RPR A;  4X1K B;  2EUL A;  1FXK B;  2CTR A;  4MVZ A;  1XMO O;  4MW3 A;  3CCL V;  2WLN A;  5LGU A;  1KBH A;  1N34 O;  5B5E Z;  4WFB V;  3E22 B;  2RN9 A;  2MW2 B;  3M7M X;  1MZF A;  1T5E A;  5IT9 N;  3PN1 A;  5C8Y B;  2QKA A;  1CXZ B;  2BCC H;  3RYI A;  3RFR A;  1R6K A;  3HKB B;  5B3S C;  4X62 O;  4HNA A;  1US6 A;  4WBN A;  1YDX A;  4J9Y B;  1EN6 A;  1WAZ A;  1NKD A;  4ZIB A;  3A0H Z;  1VQN V;  3QF7 A;  2N05 A;  4LH7 A;  3FB6 C;  4WFH A;  1HNZ B;  4JYA O;  4X66 B;  2W0X A;  1MOF A;  2ZM6 B;  2PI4 A;  3T1H B;  3WB2 A;  2A0L A;  1L0N H;  2R70 A;  3FFQ A;  1AI6 A;  4UVA A;  3T2M A;  4JF3 A;  1YJ9 V;  2JIZ G;  3AG2 B;  5JCO A;  4DR7 O;  2ILM A;  3RYH A;  1B04 A;  3D3Q A;  3WFV A;  2PI5 A;  2QE7 G;  3FB7 C;  3NXS A;  3E8F A;  1OCZ B;  1K33 A;  2RCV A;  1V55 B;  1ORQ C;  1TVK A;  4BW9 A;  1A32 A;  1ZX3 A;  3K58 A;  2UUB B;  5CN0 A;  2RQ6 A;  4WF9 V;  2Q0O C;  3FAV B;  4ZI7 A;  3U0Z A;  1JCH A;  4FM1 A;  4LWS B;  4JTC B;  2PY5 A;  3UT5 B;  5CB4 B;  3B8N A;  5BMV A;  4NXN O;  1NTZ H;  3CJH A;  4AI8 A;  4J10 A;  4X89 A;  5CA0 B;  2CTQ A;  2P06 A;  3GVM A;  2UUC B;  4JI3 B;  4DR6 O;  3DXR A;  3CXC U;  2Y69 C;  3T1Y O;  3M8A A;  4I5S A;  4YJ2 B;  1VAR A;  2LO1 A;  2YIA A;  2AZ2 A;  3JSL A;  4D6T H;  5L3E A;  2YS8 A;  2JK5 C;  2W6I G;  2DWE C;  1W0K G;  1MMM A;  4PEL A;  5IYZ A;  4JI0 B;  4DR2 B;  2GBO A;  3LDE A;  1K4C C;  2M6Y A;  1B6Q A;  1EN5 A;  2QM7 A;  1SQQ H;  1YIJ V;  4JI2 O;  2LQT A;  2UXD B;  5BR8 B;  4YJ3 B;  4DK1 A;  2X0L A;  4DV7 B;  1D5N A;  1Q81 W;  1R3I C;  1JVM A;  4TT3 G;  2IW5 A;  2Q7G A;  4JV5 O;  5KA5 A;  1YVW A;  2QA4 V;  1LUW A;  4LF6 B;  3K5O A;  3I55 V;  1ENV A;  2QEX V;  1Z5V A;  1R73 A;  1Y76 A;  3JAM N;  3M99 B;  1IBK O;  1XUQ A;  3WB1 A;  3K06 A;  3ZRX A;  4DR5 O;  5LYJ A;  2OYQ A;  4I50 B;  2EBO A;  1WLE A;  1NZ6 A;  3SYO A;  4NB5 A;  1DK1 A;  2F4V B;  4R7C A;  5H6Q A;  2ZE6 A;  1VQK V;  1AR4 A;  3HKE A;  1WPX A;  4H33 A;  1R3L C;  1N32 B;  3RYF B;  1IDS A;  4J42 A;  4K0K B;  3CEI A;  3SYA A;  3OGI B;  1HR0 O;  5IYD O;  1SZX A;  4AHC A;  2ZDI A;  4YIP A;  4K3A A;  4J11 A;  1SRY A;  4MW8 A;  3ZN1 A;  2XTA A;  2VWJ A;  3HKC B;  3QG5 A;  5LGN A;  1R1B A;  2KKW A;  2FL4 A;  3RYC A;  3LNM B;  2F1M A;  2Q7E A;  4XDL A;  5KLV H;  5LBQ A;  5LP6 C;  4G28 B;  1PD3 A;  4ZHQ B;  2CAZ C;  3OR6 C;  1WP7 A;  4IIJ A;  1XIL A;  1GN3 A;  3CRC A;  1WA8 A;  5EBL C;  1KP2 A;  5EZY A;  1RM1 B;  4FPP A;  2EIL B;  1VMG A;  3OR7 C;  1AVM A;  1QHT A;  3CCQ V;  4D7S A;  3STZ C;  2BTQ A;  4LF5 B;  1QNM A;  1H2S B;  2P6J A;  4B7E A;  5FPO A;  5IJ0 B;  3CCJ V;  3K03 A;  1M90 W;  4O4J A;  1H2G A;  4LCU C;  4JTA B;  3P3P A;  3U10 A;  2EIK B;  4KL1 A;  1DLB A;  1FXV A;  4J80 A;  4MTX A;  4X8A A;  2E5L O;  3RBZ A;  1SA0 A;  5F2V O;  3I5D A;  4H13 B;  5LMN O;  1FFX A;  2A3Q A;  3G6B A;  3OUF A;  3Q4H A;  1KEC A;  2BSK B;  3J81 N;  3RYI B;  1I0H A;  1H2K A;  1H8H G;  5JQG A;  4HNA B;  4WBN B;  3O65 A;  2X7R B;  3L70 H;  3HKD A;  2XHB A;  3P32 A;  1SZT A;  2ADP A;  4CH4 A;  4PHZ A;  1YZB A;  1VQM V;  3IAY A;  5FPR A;  1H8E G;  4Z1V A;  3APO A;  3H1K H;  2IH1 C;  2W6J G;  4MVO A;  1K5Q A;  3H1L H;  3RVY A;  4U3J A;  1SKV A;  3SGI A;  4HBN A;  1XDC A;  4X64 B;  2DWD C;  3OAA G;  4PA3 A;  4DV6 B;  1NI8 A;  4J7J A;  3PJS K;  4EB6 A;  2CK3 G;  4GUN A;  3D3I A;  3RYH B;  5JWP A;  2H94 A;  1TUE B;  1K34 A;  3G4S V;  2UU9 B;  2OCH A;  1AI4 A;  2HKO A;  2NN4 A;  1M9N A;  3AEI A;  1VQP V;  1OCO C;  1D2D A;  3LDD A;  4KUM A;  2Z0A A;  1TVK B;  1BE3 H;  2FYU H;  2HLD G;  5IWA B;  3ZMV A;  2YXY A;  2CUG A;  3K0D A;  1KKD A;  4ZI7 B;  1YIT V;  5KHJ A;  1FPO A;  4JYB A;  4FM0 A; 
#chains in the Genus database with same CATH homology
 5GTH Z;  1S5L Z;  4UB6 Z;  4PJ0 Z;  5KAI Z;  2AXT Z;  3A0B Z;  3JCU Z;  3WU2 Z;  5TIS Z;  4UB8 Z;  3A0H Z;  3KZI Z;  5B5E Z;  5E79 Z;  5GTI Z;  5B66 Z;  5KAF Z;  5H2F Z;  4IL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...