5B66Z

Crystal structure analysis of photosystem ii complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b66Z00
5GTIZ 2AXTZ 3A0HZ 4UB8Z 3KZIZ 3WU2Z 5E79Z 3A0BZ 5B5EZ 5TISZ 1S5LZ 4IL6Z 5B66Z 5KAFZ 4PJ0Z 5H2FZ 5KAIZ 5GTHZ 4UB6Z 3JCUZ
chains in the Genus database with same CATH superfamily
5GTIZ 1XI1A 2D2CB 1L1FA 5L3CA 2LGWA 2YS8A 3P32A 4LNUB 4TOIA 2IJIA 4CZZA 1PNLA 4GKKO 1G8MA 3N2GA 1CPYA 1VQ9V 4ZHQA 5IYZB 1DTOA 2Q69A 1N32B 1S5JA 3RYFB 3W7SA 4XDKA 2HHHO 3CPWU 4B3SB 2YIAA 3K58A 4TQDA 1KKDA 2JGDB 1SQPH 2CE4A 5JVDA 3GWOA 4BW5A 1PNKA 3A8TA 3OR6C 4JI1O 4XDLA 3THOA 3TXQA 5EC1C 2OIEA 4JV5B 3JALA 4JZGA 3TJTA 3L71H 2JS5A 2N05A 1RPOA 4UCUA 2N04A 3CE2A 2YXYA 3CRRA 4IYIA 4U7NA 3ASNC 3RYIB 2BE3A 1WA8B 5JJEB 3JSNA 4YHHO 3ZMZA 2QDOA 3T1CA 3G4SV 3SPGA 4LWSA 1QU7A 1L8DA 2ZIOA 2HEPA 4X1KA 3FAVA 2Q8VA 3OW2U 1GM8A 3ABUA 4XBFA 4JZ2A 2ZD9A 4X65B 2R70A 1W0JG 4O2AB 1JOYA 3ABTA 5CA0B 2VWKA 2YI9A 2UXDB 3JALB 1QVFU 3CCEV 5JQGA 2LW7A 5J2TA 1W2BU 2YDEA 4J42A 4OXSA 1TUBA 1RSOB 3P3NA 2H8PC 4DR2B 1EZJA 2VQEO 3D36A 1F4NA 4JI4O 3WG7C 2OIGA 1BGYH 2CUGA 1YF2A 3JSLA 2KKWA 3WFVA 3B40A 4WCEV 4FLZA 2HVJC 2UXCO 2GV9A 1KUQA 4I55B 4FK5C 4K8ZA 5IJ9B 3KG2A 3H1LH 1GK9A 3FAVB 3LDDA 1N0NA 3K5NA 2Y0PA 1YIJV 1CXZB 1FXKC 3C3TA 3E22A 3RW0A 4U3JA 2CAZC 4Q6GA 4TV8B 3RGBA 3OTOB 4GX2A 4QJFB 3H1KH 5BMVB 3IFXA 4J7ZA 2YUAA 2ZM6B 4LF7O 3MAQA 2GUZB 1FFXB 3CCSV 3U11A 1WLEA 4X8AA 4TUYB 3JD3A 5ITZB 1VQKV 3ZHTA 4X65O 1ZWIC 1NVPD 4FM1A 3CCRV 5GONA 4UXNA 3ETEA 4HZ3A 1S77D 3ABMB 4OX9O 4HNAB 5C8YA 1B3QA 1G6UA 4QE9A 3G71V 2WLIB 3ZBHA 4JI2O 4JGSA 5IJ0A 1EZVH 4O4JB 1VEWA 4PI2A 2EZOA 4B3MO 3TK1A 1HNWB 3CRAA 3OE7G 3OUSA 1CP9A 2P67A 1J5EB 2ZNJA 4JTDB 3Q4HA 4X1YA 2UXNA 3AG2C 4UVAA 3AG3B 5EBLC 3CWBH 2ZDIC 1K3EA 3S3WA 3IC9A 3MHHC 4MVSA 1JJOA 3FYEB 3CRQA 1JMKC 1T5EA 3J81N 1XHZA 4MVZA 2DW4A 3T2MA 3CRMA 1M57B 1XNQO 4X66O 2JIZG 5B1BB 1ZUQA 4X1IA 2PUSA 5C8YB 1FJGB 3E8FA 2PYJA 2NNUA 3OMAB 1JQ0A 3MD0A 3NR7A 1BE3H 4GX0A 1HNZO 4FM0A 3CJHA 1NR7A 4R50A 3VOUA 5LGTA 3SJQC 4YY3O 2Q73A 4CH6A 1K34A 3OMIB 2YIBD 2QE7G 2CTRA 1VF5B 2CGNA 3IC7A 4X1IB 3W7UA 3W7XA 3E83A 1K4CC 2ILMA 2QWOB 3HKBB 3APOA 5EZYB 5B1NA 1TAEA 3CEIA 2WLNA 1Q6IA 1XHXA 5CA1B 1LR1A 1EFRG 5LHGA 2M7WA 1NJIW 1VQ7V 5J2TB 1YHQV 4O4IB 3P30A 1BZKA 2BTQB 2V4DA 1AP5A 1YCIA 4E2LA 1QVGU 1COWG 3UKMA 3M7MX 1H2NA 2IU3A 4MTFA 4PELA 4JI5B 5LYJB 3H1IH 5EIBC 4DV7B 4DV3O 3PJSK 4P2ZA 2W0FC 4CS3A 1ZL8A 3EVKA 3UO3A 3FFQA 2NN4A 2M6YA 4B7EA 1VQPV 4YIPA 3L70H 5IE9A 4JAUA 2UU9B 3ZX6A 2FKXA 4XDJA 1SF9A 1VQ6V 3JAKB 2PI5A 1N32O 4U3JB 5CA0A 1DF5A 3CXCU 1KC8W 3ZHRA 1K5SA 5KMGB 1M5IA 5KHHA 2ZDIA 4TSFG 1UPGA 3LNMB 3ICXA 2QTSA 4H44B 2BOCC 3BA8A 5TISZ 5IT9N 4DR1O 4D7TA 4DV2B 3HKCA 2CTQA 4L87A 1QR9A 3JYCA 1N34O 3J80N 5A2QN 4FVMA 5JQGB 2IW5A 1AJNA 1R3LC 5EYPA 2XNDG 1P4RA 5HFMA 5L3EA 3RVYA 4G28B 1PNMA 4DRXB 4UVCA 1Q6UA 3GB7C 5IYZA 1PV0A 4ZBMA 3VQXA 5IJ0B 4KHPO 1SC5B 3OD4A 1VMGA 1VQLV 1FPOA 3HKBA 3DXRA 2WLIA 1X59A 3AEIA 4B3SO 2ZIMA 4X1YB 4MW8A 3TCUA 3LUTB 1B04A 4DUYB 1Q5OA 1FXKB 2DWDC 4LFBO 2A3QA 3KCYA 3RWRD 1M1KW 5H9CA 3BPZA 3SYOA 4E4EA 5FL7G 1AROP 2OWOA 3RT3C 2UXDO 1M56B 2EINB 3E8GA 1N34B 2UUAB 3CC7V 1YZBA 2Y4UA 4DV6O 1NVPB 3ETGA 1SETA 2R72A 3FB7C 4HAMA 1XL4A 1OCOC 4LF9O 4UCVA 2EIMB 2HHHB 1NTMH 4JI4B 2A0LA 4RWUA 3QO8A 4I5SA 5LMUO 2WA3A 4JF3A 2VQFO 4DV5B 4WFBV 2XHBA 2EBOA 1SKVA 2KG7A 4MTOA 3SJAC 2QTOA 1Q81W 3ABMC 2IJHA 4JI2B 1XOUA 4GKJO 5EIBD 1Q43A 5CB4B 1S5HC 2YIBA 1V54C 4RO2A 1KYOF 2K9PA 4KL1A 2F4VB 4O4HB 4KXRA 2F43G 1I08A 3KKYA 2X6CA 2E5LB 1FXVA 1BT8A 2ITDC 1KBHA 3KCXA 1R3KC 1EM1A 2OYQA 2YI8A 4BR6A 2UUBO 3ZN1A 2F23A 3K0GA 4H33A 5LBQA 4PDVA 3QTCA 2ITCC 4WFFA 1UFIA 3EFFK 3F5TA 5CMUA 1AVMA 3OTOO 1N36B 2WLJA 4F6RB 3ZS8C 3TXSA 3I55V 1SQXH 1I0HA 1I5XA 3HKDA 4J7JA 1EN6A 4DR3O 4DR2O 2DYRB 1SZTA 1YI2V 3K5OA 2W0XA 2Q7HA 4P9OA 3B77A 4CBCA 1H2MA 4YXWG 5CBHA 3ZRWA 2ZE7A 4D6TH 1XEQA 3FYIB 4ABMA 4AILC 3AG7A 1WA8A 4I50B 4J80A 1P7BA 4DK1A 3T1YB 3A0HZ 1M9NA 4HBNA 2P4KA 2JRIA 3ZRWB 2GDSA 3OGIB 2H94A 3O9OA 4JYCA 1FXKA 4PA7A 1Y67A 1FKAO 1LUWA 2DYSC 1VQ4V 3UCSC 4J41A 4FLVA 4LBEC 4B3MB 4DV0B 3SDLA 4TWKA 1LNQA 2Q0AA 4OPHA 4JYAO 2CH7A 4J9YB 1K73W 3FX7A 5B5EZ 2UUBB 2P90A 1IBKO 3ETDA 2B5UA 2Y69C 4JI1B 1FYJA 3U0ZA 4DV4O 1Q8IA 4UV8A 1VF6A 3E89A 1GAXA 1Y6XA 1Y66A 2YC0A 3D3QA 2Y69B 2HVKC 1QCEA 2QWRB 1I5YA 1GMGA 2IH3C 1HW7A 3HKEA 4RQFA 3L74H 4FJCC 3CCJV 3ZRVA 1J5EO 3WB1A 4JI8O 4EKWA 3JARB 3CCLV 5LA6B 3OM3B 1TA8A 4PHZA 1H2SB 3L73H 1M93A 2P7TC 2HJFC 3CMEV 4DR7B 2OTJV 3B09A 4MSWC 5EBMC 3ZHVA 3X2QC 1OJHA 3RBZA 2JK5C 2ZKOA 1VQNV 3ZRSA 1G1XB 1N8RW 3K0DA 4NXMB 1IBLO 1FFTB 5LP6B 1ZX3A 1K5QA 2FL4A 2IM9A 2WLMA 2QWNB 1QLEC 4N23A 3QO5A 5LXTA 3RYCB 3DXRB 3I5DA 4OPAA 4TQFA 2VWJA 1DF4A 4LC1A 3RYCA 2RCVA 1X4TA 3BEHA 4GX5A 2AZ0A 1EN5A 1S0VA 2FTKA 1DGSA 3ZJZA 3KZIZ 1MG1A 1YSCA 4JI3B 4K0KO 5CBGA 3CS5A 1YITV 1Y74A 1DK1A 4GT1A 2Q6AA 4FZ1A 3D3IA 3SPJA 4DUZB 1YJWV 3ASNB 3JARA 2OCCB 5KA6A 5KX5B 5EC2C 2ZCEA 4B3TB 2Y48A 3ZMSA 2GTAA 5LP6A 4WBNB 2IU0A 1PPJH 3CX5F 4CH4A 4DR4O 5KHIA 5CB4A 1YJ9V 5IJ9A 2X6AA 5KHJA 2ETNA 4WFGA 2UUAO 4WFAV 2Q9LA 3CJHB 5B1AC 5JJNB 1XBLA 4TUYA 1IVSA 5LMNB 2A79B 1NKDA 2EJRA 1H2KA 4JYYA 2YIDA 2A06H 4CS4A 4X62B 2EIKB 1WB7A 1BCCH 3I56V 4FLUA 2F95B 4I50A 5HFLA 1HNWO 3QVNA 3UT5B 2K1EA 4CC6A 5B66Z 5L3DA 2R9IA 4PD4F 1YTFD 1ROPA 4IL6Z 1MSDA 5EBWC 1BHBA 1HDJA 5ITZA 1ZL8B 3HKDB 4BIZA 3K9AA 1NH2B 5AG2A 4DR1B 4CC5A 1FFXA 1XUQA 4GKJB 4AQYO 4F6RA 4B7KA 5LYJA 1ORQC 1XNRB 1R6KA 3LSQA 1O9GA 1OCOB 2N74A 4X64O 4LCUC 4JI3O 1FJGO 1Q6HA 1VF6C 3B4SA 4U7OA 2QM8A 4LF9B 4IIJA 4DR6B 1NU1H 3CMAV 3OGCC 1U97A 3M99B 5LP6C 5LMUB 2WSSG 5J2UB 1E1RG 2HFEC 1F23A 4JTAB 3JASA 3H9VA 3CP1A 4I0XA 1BMFG 2A7WA 1H2LA 2DQ0A 1F51A 3JCUZ 3MDSA 4LFAB 2YICA 1J95A 2FMLA 4JI7B 2R9AA 2YXLA 3LDCA 4ZI7B 2L35A 2DYRC 3L72H 3E35A 3JD4A 4FZ0A 1AI7A 4TV8A 1XREA 3K3WA 3OT7A 3BA9A 1KQSU 4YIOA 4DW1A 2YEVB 5BR8O 1OHHG 2UXXA 4MVMA 2ADPA 1N33O 2ZQMA 4PDLA 3AG1C 3CRCA 1OV9A 1CEZA 3VBBA 1WB8A 4MW3A 2EJ7A 4DW0A 4U3FH 3R66A 1B06A 2DOSA 4O4HA 2JJ1G 4GUNA 2DN9A 2E3CA 5A9GA 3SYAA 1K8AW 1JFFB 2EZPA 1XNQB 3HB3B 3JATA 2Y4TA 5J9PC 4PJ0Z 2XAHA 1RPRA 4C7UA 2FB5A 2A9HA 3N27A 2ZNIA 2B1IA 3SYCA 1US6A 3STLC 1U96A 3CC2V 3OR7C 2EIJB 5D5PA 3K5MA 3N2GB 5LGNA 4J10A 2W6JG 2DWEC 1PM9A 2D3OW 4UFZA 1IBKB 1AJQA 4RUEA 2VQFB 2Z0AA 4Z1MG 1Q86W 1QQCA 5KUMA 4H0LB 1P49A 4I4TB 3K79A 2Q7EA 1SZXA 3T1YO 5F2VO 2AHZA 2RNBA 3WG7B 1GM7A 2Q4PA 3RYFA 5LOVA 2QSAA 1YTFB 1XMOO 1WPBA 3OMNB 1AR5A 1S5LZ 3MHSC 5LOVB 3VQVA 2QWQB 5KA5A 3RYIA 4RUFA 1WP8A 2EIKC 2MW2B 2E5LO 2ADQB 4I4TA 1AR4A 2F93B 4QE7A 2HLDG 3G67A 1AI5A 3FB6C 2EINC 2ZE8A 4O4IA 5FPRA 3AK1A 3EXAA 4IHJA 3G6BA 2LJ2A 4DR7O 2NR5A 1GTOA 2Q68A 2WLLB 1I94O 1YVWA 2QWPB 3HR0A 3UT5A 1HNXO 4WBNA 3JD1A 3HPLC 1R3JC 3QO7A 3K5LA 2XOKG 2XAQA 3CXHF 4N21A 4JYBA 4MVUA 2EILC 3AG2B 1IXBA 2LO1A 3B8MA 2LQTA 4YJ3B 1PL4A 1HWYA 1JPXA 1UJWB 2UXBB 4LFBB 4J9ZB 1L0NH 1W59A 4UUJC 4EFBA 5KAFZ 3DTUB 4UB8Z 3Q4HB 3ZMTA 3DGEA 4AHCA 4FMTA 3ZHUA 1D2DA 3RYHA 2ZINA 4DV7O 3SPCA 3OEEG 1Z2GA 4JAAA 1TGOA 3UM7A 4W4LA 3AG3C 2QR4A 3ABLC 3EHBB 1SQQH 1IX9A 4K0KB 3T4ZA 2EILB 5L3FA 1IBMO 4ZI7A 4K3AA 4DRXA 2W6IG 1K92A 3L75H 4X20A 3CCVV 2CK3G 3E86A 1BL8A 3ML0A 3F5WC 4LF4B 1PL0A 5H2FZ 2AGAA 2ZXWB 3C3SA 1S72V 1KP3A 2E76B 5KMGA 4JAVA 4IT5A 1KECA 2PZSA 1M56C 3SJBC 3P3PA 5J2UA 5EK0A 2CH7B 3ABKC 1DLBA 2QKAA 3JD0A 4NXNO 2Q5ZA 4EB6A 2HG5C 4K35A 3VQYA 2CTPA 3JATB 2XAJA 4MVQA 4ICGA 1SQFA 1F7YA 3K03A 1VQOV 1SA0B 2Y0IA 4FFBB 5L3BA 2XAGA 3JASB 3K59A 4LF5B 4DO2A 2UUCO 4RQEA 1AI6A 2R9RB 5JCOA 2YSUB 3DC5A 1XNRO 1N36O 3C90A 2CDYA 3HKEB 5CA1A 3DC6A 4KFMA 3CSXA 2XUMA 4I7ZB 5IWAB 4DR3B 1IBLB 2F66C 3E8HA 1SS3A 3BCCH 3RFRA 4A5UB 2LFSA 3U10A 5IDJA 4DUYO 1NZ6A 4X88A 1XDCA 1BS3A 5KX5A 1KMIZ 1EN4A 1RSOA 3JAWA 3LSUA 5DM6V 1GO3F 4JV5O 2B1GA 4B08A 3CCMV 4KUMA 1A32A 4UVBA 1VQMV 3ASOB 4FPPA 1OCZC 3N2KA 1JCHA 5EZYA 3CC4V 1KB9F 4NXNB 4TT3G 3A0BZ 3A2FA 2FYUH 4X64B 3FB8C 1H38A 3OTFA 3FD9A 2MK3A 2ZXWC 1SA0A 4IHJB 4LH6A 1P84F 1M57C 1OZ0A 2BTQA 4DR6O 4WFEA 3CYOA 5DN6G 1P7GA 3GVMA 1YEWA 1YDXA 3TETA 2LFRA 2WPDG 5LL6Y 1M90W 4I9QA 1ZTEA 2Q7GA 1EBOA 2WLKA 3M8AA 5IYBO 1XL6A 1JR9A 3ZRXA 5IYCO 1WN7A 3OEHG 4HYOA 4MS2A 3RYHB 4GZRB 1WJZA 1Y76B 2RN9A 4PA9A 3SPIA 5IY5C 2P6JA 2WLLA 3LDEA 1GRJA 5H6RA 2X0LA 4X62O 1OCCB 1SQVH 3E8BA 2VQEB 1VP7A 1SQGA 3H1JH 3G6EV 4NTYA 1VQ5V 2V1DA 1WP7A 4W4KA 1NI8A 2F4VO 3T1HO 2QKCA 5IY5B 4Z2WA 1K7DA 1TVKB 2WA4A 3GWKC 3QG5A 5BR8B 1N33B 3SGIA 1JA8A 1NTKH 4KP4A 4MTXA 2DYSB 4DR5O 3D8CA 2XAFA 4IYHA 4TV9B 3AG4C 1RP3B 1BHAA 4BIOA 1TVKA 5KHGA 2HP8A 1MABG 1HP8A 3ZMUA 3ABKB 1BSMA 2PGGA 1OCRB 1Q82W 4I55A 3ZIAG 4JI0O 2RDCA 3A0RA 4UCSA 2CTWA 3SYQA 3BHPA 1G4YB 4F4LA 2GHYA 2WWWA 2JEUA 3RVZA 1MOFA 5LGUA 4L8JA 4LFCO 5CBFA 1R3IC 5BMVA 1TUEB 2WLHA 4UB6Z 1GN4A 5LHHA 4DV1O 4RAIA 5K1PA 1SQBH 3AK3A 3WB2A 1IZ3A 2Z5UA 1Q3EA 4QIWF 4P30A 4FLTA 4AI8A 1XMOB 1H8HG 1XMQO 1QLEB 2OCHA 4YY3B 4DV0O 2OT5A 4DUZO 5JVDB 3JCZA 3JD2A 4EB6B 1E79G 4JYAB 1V55B 2JS3A 2F1MA 4B3RB 1XILA 2JDIG 1VIBA 3F7VC 2BCCH 1V54B 3TGUH 1XQ8A 4DR4B 1JFFA 4NVPA 4DXWA 4GCZA 3H01A 3E22B 5B3SC 1Z5VA 4P9PA 1NR1A 3ZMVA 2GBOA 3CCQV 2H3OA 1NQTA 4R8CA 5GW7A 4ZKIA 5LMNO 4EEQA 2YEVA 5B3SB 2ZM6O 4LF7B 4NTXA 5H5NA 4O2AA 3W7WA 2P5OA 4CH3A 2WAMA 2IJJA 1N4CA 3CHXA 4WF9V 2E75B 2LGQA 1D5AA 1AP6A 4DV3B 1K4DC 1QBZA 4UCTA 5E1AC 4BAYA 4ZOLA 3O65A 1HNXB 2XTAA 4LR3A 4LFCB 3BABA 5FPOA 1BQ0A 4AQYB 3S3XA 5JJJB 5FNVB 3APQA 4MTGA 2EIMC 3AG1B 1WNSA 4CS2A 4LH7A 5CN0A 2KSDA 1RM1C 1E1QG 2ZR3A 2ODMA 3HKCB 1SERA 2KG7B 4J7KA 1HR0O 4H37A 5KHKA 2PYLA 4B3TO 4B3RO 3ETQA 4FLYA 2ZE5A 2QGNA 4JTCB 2VRZA 1F4MA 1AB3A 1AILA 4O2BB 4H13B 5DEDA 1YXBA 1D5NA 4JPRA 4R7CA 1QR8A 3BVOA 2DMXA 3OAAG 1V9PA 2KB1A 3SJCC 3ZHSA 4JI7O 1GKFA 1JJ2U 5H6QA 3ZEDA 1NBMG 4PA4A 3DSQA 4BW9A 4TV9A 3CD6V 1H8EG 2GSMB 2UXBO 4BIUA 3ASOC 1Y76A 3K57A 1IDSA 2XASA 3K08A 4NTWA 1WPXA 1AI4A 2CGOA 3OFNG 1Z5WA 4CH5A 5CA3A 2HJDA 4LF5O 1K97A 5E79Z 1V55C 5EYPB 3K04A 1I7FA 2GTSA 3AK2A 4HNAA 4QPKA 1O9HA 1R73A 3ZCCA 1B6QA 2LP7A 4YJ3A 3G80A 4QNHB 4D7SA 2IJKA 4FLWA 3F7YC 5DECA 1FD9A 1WAZA 5LHIA 2YXHA 4FLXA 4JI6O 5KUKA 2GUZA 1SRYA 2JVDA 3CCUV 1NT2B 1K9MW 1FXHA 1VARA 2Q67A 4MVOA 4NKGB 4PDRA 4OX9B 2PI4A 1OCCC 3J7AU 2L6LA 4G27B 4NYKA 2RJZA 1S3JA 1OCZB 1JVMA 4KHPB 2UU9O 1R6TA 1IURA 4UCOA 2RMKB 5IYDO 1ZSPA 1MZEA 4I0XB 3STZC 3IAYA 4O4LB 1QHTA 4YHHB 2JGUA 1YJNV 3B2EE 4QPJA 2BOBC 1ENVA 4PA6A 2ZT9B 4NB5A 3ABLB 2QA4V 5LXTB 3LNNA 1RM1B 2UUCB 4JASA 3ZN0A 3JAWB 1Q90D 4K8XA 2AHYA 1W0KG 4DV2O 4GLXA 4GYCB 2ARHA 3VQWA 3BY6A 1N0JA 2HKOA 4FFBA 4FFKA 1Y4MA 4DK0A 2LW1A 4DYLA 3UO2A 5C93A 2B9ZA 4LFAO 2NLJC 3IGAC 3FB5C 2BTOA 3IJ4A 1KP2A 3BFRA 1AR1B 4IIJB 3WB0A 4O2BA 2Z3YA 1LUVA 5B1AB 4JI6B 1VF7A 4IGGA 5LA6A 1OCRC 4BWAA 3UQ8A 3SR2C 1QLNA 1PKXA 2QM4A 2Q0OC 3R65A 3K06A 2UXCB 4ASUG 4I9WA 5JCOC 5D5QA 3B8NA 1KKCA 3L9DA 1NH2D 4DV1B 5JH7A 1QNMA 2ZE6A 1NTZH 3PN1A 4LP8A 5FLXN 4ZIBA 3LSSA 4FM2A 4NR1A 2RQ6A 5BZBA 2AXTZ 3JAKA 2HR3A 2IH1C 4FIPC 1GM9A 1IBMB 1R1BA 2DJVA 4ZOLB 1L0LH 3OUFA 2QM7A 1GN2A 4LF8O 1URFA 1HNZB 2C2AA 5JWPA 4DR5B 2VS0A 1Y74B 5BXZA 5JH7B 3D36C 5FNVA 4PA3A 2E74B 4J11A 1I94B 1JX9A 4PDMA 2AZ2A 4X66B 1MNGA 2EX3A 2DE0X 4X20B 3ZHQA 3BRCA 4UCRA 1MMMA 1KU9A 4DV6B 4F6EA 4X1KB 2QEXV 5B1BC 1KD1W 4MVRA 1GH6A 4JI0B 1TUBB 4O4JA 4LWSB 1ZAUA 2P22C 4PI0A 4LF6B 1GN6A 3JAMN 3T1HB 4DV5O 2PTMA 1PD3A 1AJPA 2PF4E 4Z1VA 3QNEA 4UV9A 4JI5O 2X7RB 1THZA 4GX1A 5GONB 5GTHZ 1Q7YW 1GN3A 5KLVH 1VQ8V 1K33A 3RN4A 4GKKB 2DQ3A 2JEXA 1PP9H 3AG4B 2P4VA 1H2GA 2G38A 5IWAO 2OTLV 2X6BA 2XT9A 4JI8B 2BSKA 2V7QG 4LF8B 4X89A 5KAIZ 1SESA 5BY1A 3SYPA 3CB2A 3NXSA 1FS0G 2QJ1A 4LF4O 4O4LA 5L3GA 1BQZA 3W7TA 1NS1A 3K9SA 3H1HH 4WFHA 1IXMA 2EULA 1ZLZA 2IBZH 1R6NA 2OCCC 1FAFA 2EIJC 4DV4B 5B1OA 4G2KA 2KQXA 4R6ZA 2JGDA 2P06A 3FKSG 4YJ2A 2JJ2G 4NXMO 2BSKB 2O57A 4Q20A 1MA1A 2AW9A 3BAAA 4PV1B 3SPHA 5K1XA 3N2KB 4ZHQB 1MSWD 1S76D 2PY5A 1M4UA 4LF6O 1XMQB 2QKSA 3E2EA 4EFEA 4LNUA 3WU2Z 3T4DA 3QF7A 1RFYA 2ATKC 4QGPA 2ZR2A 4MT8A 3X2QB 1HR0B 4YJ2B 1MZFA 4X9QA 4OGQB
chains in the Genus database with same CATH topology
5GTIZ 2AXTZ 3A0HZ 4UB8Z 3KZIZ 3WU2Z 5E79Z 3A0BZ 5B5EZ 5TISZ 1S5LZ 4IL6Z 5B66Z 5KAFZ 4PJ0Z 5H2FZ 5KAIZ 5GTHZ 4UB6Z 3JCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI Z;  2AXT Z;  3A0H Z;  4UB8 Z;  3KZI Z;  3WU2 Z;  5E79 Z;  3A0B Z;  5B5E Z;  5TIS Z;  1S5L Z;  4IL6 Z;  5B66 Z;  5KAF Z;  4PJ0 Z;  5H2F Z;  5KAI Z;  5GTH Z;  4UB6 Z;  3JCU Z; 
#chains in the Genus database with same CATH topology
 5GTI Z;  1XI1 A;  2D2C B;  1L1F A;  5L3C A;  2LGW A;  2YS8 A;  3P32 A;  4LNU B;  4TOI A;  2IJI A;  4CZZ A;  1PNL A;  4GKK O;  1G8M A;  3N2G A;  1CPY A;  1VQ9 V;  4ZHQ A;  5IYZ B;  1DTO A;  2Q69 A;  1N32 B;  1S5J A;  3RYF B;  3W7S A;  4XDK A;  2HHH O;  3CPW U;  4B3S B;  2YIA A;  3K58 A;  4TQD A;  1KKD A;  2JGD B;  1SQP H;  2CE4 A;  5JVD A;  3GWO A;  4BW5 A;  1PNK A;  3A8T A;  3OR6 C;  4JI1 O;  4XDL A;  3THO A;  3TXQ A;  5EC1 C;  2OIE A;  4JV5 B;  3JAL A;  4JZG A;  3TJT A;  3L71 H;  2JS5 A;  2N05 A;  1RPO A;  4UCU A;  2N04 A;  3CE2 A;  2YXY A;  3CRR A;  4IYI A;  4U7N A;  3ASN C;  3RYI B;  2BE3 A;  1WA8 B;  5JJE B;  3JSN A;  4YHH O;  3ZMZ A;  2QDO A;  3T1C A;  3G4S V;  3SPG A;  4LWS A;  1QU7 A;  1L8D A;  2ZIO A;  2HEP A;  4X1K A;  3FAV A;  2Q8V A;  3OW2 U;  1GM8 A;  3ABU A;  4XBF A;  4JZ2 A;  2ZD9 A;  4X65 B;  2R70 A;  1W0J G;  4O2A B;  1JOY A;  3ABT A;  5CA0 B;  2VWK A;  2YI9 A;  2UXD B;  3JAL B;  1QVF U;  3CCE V;  5JQG A;  2LW7 A;  5J2T A;  1W2B U;  2YDE A;  4J42 A;  4OXS A;  1TUB A;  1RSO B;  3P3N A;  2H8P C;  4DR2 B;  1EZJ A;  2VQE O;  3D36 A;  1F4N A;  4JI4 O;  3WG7 C;  2OIG A;  1BGY H;  2CUG A;  1YF2 A;  3JSL A;  2KKW A;  3WFV A;  3B40 A;  4WCE V;  4FLZ A;  2HVJ C;  2UXC O;  2GV9 A;  1KUQ A;  4I55 B;  4FK5 C;  4K8Z A;  5IJ9 B;  3KG2 A;  3H1L H;  1GK9 A;  3FAV B;  3LDD A;  1N0N A;  3K5N A;  2Y0P A;  1YIJ V;  1CXZ B;  1FXK C;  3C3T A;  3E22 A;  3RW0 A;  4U3J A;  2CAZ C;  4Q6G A;  4TV8 B;  3RGB A;  3OTO B;  4GX2 A;  4QJF B;  3H1K H;  5BMV B;  3IFX A;  4J7Z A;  2YUA A;  2ZM6 B;  4LF7 O;  3MAQ A;  2GUZ B;  1FFX B;  3CCS V;  3U11 A;  1WLE A;  4X8A A;  4TUY B;  3JD3 A;  5ITZ B;  1VQK V;  3ZHT A;  4X65 O;  1ZWI C;  1NVP D;  4FM1 A;  3CCR V;  5GON A;  4UXN A;  3ETE A;  4HZ3 A;  1S77 D;  3ABM B;  4OX9 O;  4HNA B;  5C8Y A;  1B3Q A;  1G6U A;  4QE9 A;  3G71 V;  2WLI B;  3ZBH A;  4JI2 O;  4JGS A;  5IJ0 A;  1EZV H;  4O4J B;  1VEW A;  4PI2 A;  2EZO A;  4B3M O;  3TK1 A;  1HNW B;  3CRA A;  3OE7 G;  3OUS A;  1CP9 A;  2P67 A;  1J5E B;  2ZNJ A;  4JTD B;  3Q4H A;  4X1Y A;  2UXN A;  3AG2 C;  4UVA A;  3AG3 B;  5EBL C;  3CWB H;  2ZDI C;  1K3E A;  3S3W A;  3IC9 A;  3MHH C;  4MVS A;  1JJO A;  3FYE B;  3CRQ A;  1JMK C;  1T5E A;  3J81 N;  1XHZ A;  4MVZ A;  2DW4 A;  3T2M A;  3CRM A;  1M57 B;  1XNQ O;  4X66 O;  2JIZ G;  5B1B B;  1ZUQ A;  4X1I A;  2PUS A;  5C8Y B;  1FJG B;  3E8F A;  2PYJ A;  2NNU A;  3OMA B;  1JQ0 A;  3MD0 A;  3NR7 A;  1BE3 H;  4GX0 A;  1HNZ O;  4FM0 A;  3CJH A;  1NR7 A;  4R50 A;  3VOU A;  5LGT A;  3SJQ C;  4YY3 O;  2Q73 A;  4CH6 A;  1K34 A;  3OMI B;  2YIB D;  2QE7 G;  2CTR A;  1VF5 B;  2CGN A;  3IC7 A;  4X1I B;  3W7U A;  3W7X A;  3E83 A;  1K4C C;  2ILM A;  2QWO B;  3HKB B;  3APO A;  5EZY B;  5B1N A;  1TAE A;  3CEI A;  2WLN A;  1Q6I A;  1XHX A;  5CA1 B;  1LR1 A;  1EFR G;  5LHG A;  2M7W A;  1NJI W;  1VQ7 V;  5J2T B;  1YHQ V;  4O4I B;  3P30 A;  1BZK A;  2BTQ B;  2V4D A;  1AP5 A;  1YCI A;  4E2L A;  1QVG U;  1COW G;  3UKM A;  3M7M X;  1H2N A;  2IU3 A;  4MTF A;  4PEL A;  4JI5 B;  5LYJ B;  3H1I H;  5EIB C;  4DV7 B;  4DV3 O;  3PJS K;  4P2Z A;  2W0F C;  4CS3 A;  1ZL8 A;  3EVK A;  3UO3 A;  3FFQ A;  2NN4 A;  2M6Y A;  4B7E A;  1VQP V;  4YIP A;  3L70 H;  5IE9 A;  4JAU A;  2UU9 B;  3ZX6 A;  2FKX A;  4XDJ A;  1SF9 A;  1VQ6 V;  3JAK B;  2PI5 A;  1N32 O;  4U3J B;  5CA0 A;  1DF5 A;  3CXC U;  1KC8 W;  3ZHR A;  1K5S A;  5KMG B;  1M5I A;  5KHH A;  2ZDI A;  4TSF G;  1UPG A;  3LNM B;  3ICX A;  2QTS A;  4H44 B;  2BOC C;  3BA8 A;  5TIS Z;  5IT9 N;  4DR1 O;  4D7T A;  4DV2 B;  3HKC A;  2CTQ A;  4L87 A;  1QR9 A;  3JYC A;  1N34 O;  3J80 N;  5A2Q N;  4FVM A;  5JQG B;  2IW5 A;  1AJN A;  1R3L C;  5EYP A;  2XND G;  1P4R A;  5HFM A;  5L3E A;  3RVY A;  4G28 B;  1PNM A;  4DRX B;  4UVC A;  1Q6U A;  3GB7 C;  5IYZ A;  1PV0 A;  4ZBM A;  3VQX A;  5IJ0 B;  4KHP O;  1SC5 B;  3OD4 A;  1VMG A;  1VQL V;  1FPO A;  3HKB A;  3DXR A;  2WLI A;  1X59 A;  3AEI A;  4B3S O;  2ZIM A;  4X1Y B;  4MW8 A;  3TCU A;  3LUT B;  1B04 A;  4DUY B;  1Q5O A;  1FXK B;  2DWD C;  4LFB O;  2A3Q A;  3KCY A;  3RWR D;  1M1K W;  5H9C A;  3BPZ A;  3SYO A;  4E4E A;  5FL7 G;  1ARO P;  2OWO A;  3RT3 C;  2UXD O;  1M56 B;  2EIN B;  3E8G A;  1N34 B;  2UUA B;  3CC7 V;  1YZB A;  2Y4U A;  4DV6 O;  1NVP B;  3ETG A;  1SET A;  2R72 A;  3FB7 C;  4HAM A;  1XL4 A;  1OCO C;  4LF9 O;  4UCV A;  2EIM B;  2HHH B;  1NTM H;  4JI4 B;  2A0L A;  4RWU A;  3QO8 A;  4I5S A;  5LMU O;  2WA3 A;  4JF3 A;  2VQF O;  4DV5 B;  4WFB V;  2XHB A;  2EBO A;  1SKV A;  2KG7 A;  4MTO A;  3SJA C;  2QTO A;  1Q81 W;  3ABM C;  2IJH A;  4JI2 B;  1XOU A;  4GKJ O;  5EIB D;  1Q43 A;  5CB4 B;  1S5H C;  2YIB A;  1V54 C;  4RO2 A;  1KYO F;  2K9P A;  4KL1 A;  2F4V B;  4O4H B;  4KXR A;  2F43 G;  1I08 A;  3KKY A;  2X6C A;  2E5L B;  1FXV A;  1BT8 A;  2ITD C;  1KBH A;  3KCX A;  1R3K C;  1EM1 A;  2OYQ A;  2YI8 A;  4BR6 A;  2UUB O;  3ZN1 A;  2F23 A;  3K0G A;  4H33 A;  5LBQ A;  4PDV A;  3QTC A;  2ITC C;  4WFF A;  1UFI A;  3EFF K;  3F5T A;  5CMU A;  1AVM A;  3OTO O;  1N36 B;  2WLJ A;  4F6R B;  3ZS8 C;  3TXS A;  3I55 V;  1SQX H;  1I0H A;  1I5X A;  3HKD A;  4J7J A;  1EN6 A;  4DR3 O;  4DR2 O;  2DYR B;  1SZT A;  1YI2 V;  3K5O A;  2W0X A;  2Q7H A;  4P9O A;  3B77 A;  4CBC A;  1H2M A;  4YXW G;  5CBH A;  3ZRW A;  2ZE7 A;  4D6T H;  1XEQ A;  3FYI B;  4ABM A;  4AIL C;  3AG7 A;  1WA8 A;  4I50 B;  4J80 A;  1P7B A;  4DK1 A;  3T1Y B;  3A0H Z;  1M9N A;  4HBN A;  2P4K A;  2JRI A;  3ZRW B;  2GDS A;  3OGI B;  2H94 A;  3O9O A;  4JYC A;  1FXK A;  4PA7 A;  1Y67 A;  1FKA O;  1LUW A;  2DYS C;  1VQ4 V;  3UCS C;  4J41 A;  4FLV A;  4LBE C;  4B3M B;  4DV0 B;  3SDL A;  4TWK A;  1LNQ A;  2Q0A A;  4OPH A;  4JYA O;  2CH7 A;  4J9Y B;  1K73 W;  3FX7 A;  5B5E Z;  2UUB B;  2P90 A;  1IBK O;  3ETD A;  2B5U A;  2Y69 C;  4JI1 B;  1FYJ A;  3U0Z A;  4DV4 O;  1Q8I A;  4UV8 A;  1VF6 A;  3E89 A;  1GAX A;  1Y6X A;  1Y66 A;  2YC0 A;  3D3Q A;  2Y69 B;  2HVK C;  1QCE A;  2QWR B;  1I5Y A;  1GMG A;  2IH3 C;  1HW7 A;  3HKE A;  4RQF A;  3L74 H;  4FJC C;  3CCJ V;  3ZRV A;  1J5E O;  3WB1 A;  4JI8 O;  4EKW A;  3JAR B;  3CCL V;  5LA6 B;  3OM3 B;  1TA8 A;  4PHZ A;  1H2S B;  3L73 H;  1M93 A;  2P7T C;  2HJF C;  3CME V;  4DR7 B;  2OTJ V;  3B09 A;  4MSW C;  5EBM C;  3ZHV A;  3X2Q C;  1OJH A;  3RBZ A;  2JK5 C;  2ZKO A;  1VQN V;  3ZRS A;  1G1X B;  1N8R W;  3K0D A;  4NXM B;  1IBL O;  1FFT B;  5LP6 B;  1ZX3 A;  1K5Q A;  2FL4 A;  2IM9 A;  2WLM A;  2QWN B;  1QLE C;  4N23 A;  3QO5 A;  5LXT A;  3RYC B;  3DXR B;  3I5D A;  4OPA A;  4TQF A;  2VWJ A;  1DF4 A;  4LC1 A;  3RYC A;  2RCV A;  1X4T A;  3BEH A;  4GX5 A;  2AZ0 A;  1EN5 A;  1S0V A;  2FTK A;  1DGS A;  3ZJZ A;  3KZI Z;  1MG1 A;  1YSC A;  4JI3 B;  4K0K O;  5CBG A;  3CS5 A;  1YIT V;  1Y74 A;  1DK1 A;  4GT1 A;  2Q6A A;  4FZ1 A;  3D3I A;  3SPJ A;  4DUZ B;  1YJW V;  3ASN B;  3JAR A;  2OCC B;  5KA6 A;  5KX5 B;  5EC2 C;  2ZCE A;  4B3T B;  2Y48 A;  3ZMS A;  2GTA A;  5LP6 A;  4WBN B;  2IU0 A;  1PPJ H;  3CX5 F;  4CH4 A;  4DR4 O;  5KHI A;  5CB4 A;  1YJ9 V;  5IJ9 A;  2X6A A;  5KHJ A;  2ETN A;  4WFG A;  2UUA O;  4WFA V;  2Q9L A;  3CJH B;  5B1A C;  5JJN B;  1XBL A;  4TUY A;  1IVS A;  5LMN B;  2A79 B;  1NKD A;  2EJR A;  1H2K A;  4JYY A;  2YID A;  2A06 H;  4CS4 A;  4X62 B;  2EIK B;  1WB7 A;  1BCC H;  3I56 V;  4FLU A;  2F95 B;  4I50 A;  5HFL A;  1HNW O;  3QVN A;  3UT5 B;  2K1E A;  4CC6 A;  5B66 Z;  5L3D A;  2R9I A;  4PD4 F;  1YTF D;  1ROP A;  4IL6 Z;  1MSD A;  5EBW C;  1BHB A;  1HDJ A;  5ITZ A;  1ZL8 B;  3HKD B;  4BIZ A;  3K9A A;  1NH2 B;  5AG2 A;  4DR1 B;  4CC5 A;  1FFX A;  1XUQ A;  4GKJ B;  4AQY O;  4F6R A;  4B7K A;  5LYJ A;  1ORQ C;  1XNR B;  1R6K A;  3LSQ A;  1O9G A;  1OCO B;  2N74 A;  4X64 O;  4LCU C;  4JI3 O;  1FJG O;  1Q6H A;  1VF6 C;  3B4S A;  4U7O A;  2QM8 A;  4LF9 B;  4IIJ A;  4DR6 B;  1NU1 H;  3CMA V;  3OGC C;  1U97 A;  3M99 B;  5LP6 C;  5LMU B;  2WSS G;  5J2U B;  1E1R G;  2HFE C;  1F23 A;  4JTA B;  3JAS A;  3H9V A;  3CP1 A;  4I0X A;  1BMF G;  2A7W A;  1H2L A;  2DQ0 A;  1F51 A;  3JCU Z;  3MDS A;  4LFA B;  2YIC A;  1J95 A;  2FML A;  4JI7 B;  2R9A A;  2YXL A;  3LDC A;  4ZI7 B;  2L35 A;  2DYR C;  3L72 H;  3E35 A;  3JD4 A;  4FZ0 A;  1AI7 A;  4TV8 A;  1XRE A;  3K3W A;  3OT7 A;  3BA9 A;  1KQS U;  4YIO A;  4DW1 A;  2YEV B;  5BR8 O;  1OHH G;  2UXX A;  4MVM A;  2ADP A;  1N33 O;  2ZQM A;  4PDL A;  3AG1 C;  3CRC A;  1OV9 A;  1CEZ A;  3VBB A;  1WB8 A;  4MW3 A;  2EJ7 A;  4DW0 A;  4U3F H;  3R66 A;  1B06 A;  2DOS A;  4O4H A;  2JJ1 G;  4GUN A;  2DN9 A;  2E3C A;  5A9G A;  3SYA A;  1K8A W;  1JFF B;  2EZP A;  1XNQ B;  3HB3 B;  3JAT A;  2Y4T A;  5J9P C;  4PJ0 Z;  2XAH A;  1RPR A;  4C7U A;  2FB5 A;  2A9H A;  3N27 A;  2ZNI A;  2B1I A;  3SYC A;  1US6 A;  3STL C;  1U96 A;  3CC2 V;  3OR7 C;  2EIJ B;  5D5P A;  3K5M A;  3N2G B;  5LGN A;  4J10 A;  2W6J G;  2DWE C;  1PM9 A;  2D3O W;  4UFZ A;  1IBK B;  1AJQ A;  4RUE A;  2VQF B;  2Z0A A;  4Z1M G;  1Q86 W;  1QQC A;  5KUM A;  4H0L B;  1P49 A;  4I4T B;  3K79 A;  2Q7E A;  1SZX A;  3T1Y O;  5F2V O;  2AHZ A;  2RNB A;  3WG7 B;  1GM7 A;  2Q4P A;  3RYF A;  5LOV A;  2QSA A;  1YTF B;  1XMO O;  1WPB A;  3OMN B;  1AR5 A;  1S5L Z;  3MHS C;  5LOV B;  3VQV A;  2QWQ B;  5KA5 A;  3RYI A;  4RUF A;  1WP8 A;  2EIK C;  2MW2 B;  2E5L O;  2ADQ B;  4I4T A;  1AR4 A;  2F93 B;  4QE7 A;  2HLD G;  3G67 A;  1AI5 A;  3FB6 C;  2EIN C;  2ZE8 A;  4O4I A;  5FPR A;  3AK1 A;  3EXA A;  4IHJ A;  3G6B A;  2LJ2 A;  4DR7 O;  2NR5 A;  1GTO A;  2Q68 A;  2WLL B;  1I94 O;  1YVW A;  2QWP B;  3HR0 A;  3UT5 A;  1HNX O;  4WBN A;  3JD1 A;  3HPL C;  1R3J C;  3QO7 A;  3K5L A;  2XOK G;  2XAQ A;  3CXH F;  4N21 A;  4JYB A;  4MVU A;  2EIL C;  3AG2 B;  1IXB A;  2LO1 A;  3B8M A;  2LQT A;  4YJ3 B;  1PL4 A;  1HWY A;  1JPX A;  1UJW B;  2UXB B;  4LFB B;  4J9Z B;  1L0N H;  1W59 A;  4UUJ C;  4EFB A;  5KAF Z;  3DTU B;  4UB8 Z;  3Q4H B;  3ZMT A;  3DGE A;  4AHC A;  4FMT A;  3ZHU A;  1D2D A;  3RYH A;  2ZIN A;  4DV7 O;  3SPC A;  3OEE G;  1Z2G A;  4JAA A;  1TGO A;  3UM7 A;  4W4L A;  3AG3 C;  2QR4 A;  3ABL C;  3EHB B;  1SQQ H;  1IX9 A;  4K0K B;  3T4Z A;  2EIL B;  5L3F A;  1IBM O;  4ZI7 A;  4K3A A;  4DRX A;  2W6I G;  1K92 A;  3L75 H;  4X20 A;  3CCV V;  2CK3 G;  3E86 A;  1BL8 A;  3ML0 A;  3F5W C;  4LF4 B;  1PL0 A;  5H2F Z;  2AGA A;  2ZXW B;  3C3S A;  1S72 V;  1KP3 A;  2E76 B;  5KMG A;  4JAV A;  4IT5 A;  1KEC A;  2PZS A;  1M56 C;  3SJB C;  3P3P A;  5J2U A;  5EK0 A;  2CH7 B;  3ABK C;  1DLB A;  2QKA A;  3JD0 A;  4NXN O;  2Q5Z A;  4EB6 A;  2HG5 C;  4K35 A;  3VQY A;  2CTP A;  3JAT B;  2XAJ A;  4MVQ A;  4ICG A;  1SQF A;  1F7Y A;  3K03 A;  1VQO V;  1SA0 B;  2Y0I A;  4FFB B;  5L3B A;  2XAG A;  3JAS B;  3K59 A;  4LF5 B;  4DO2 A;  2UUC O;  4RQE A;  1AI6 A;  2R9R B;  5JCO A;  2YSU B;  3DC5 A;  1XNR O;  1N36 O;  3C90 A;  2CDY A;  3HKE B;  5CA1 A;  3DC6 A;  4KFM A;  3CSX A;  2XUM A;  4I7Z B;  5IWA B;  4DR3 B;  1IBL B;  2F66 C;  3E8H A;  1SS3 A;  3BCC H;  3RFR A;  4A5U B;  2LFS A;  3U10 A;  5IDJ A;  4DUY O;  1NZ6 A;  4X88 A;  1XDC A;  1BS3 A;  5KX5 A;  1KMI Z;  1EN4 A;  1RSO A;  3JAW A;  3LSU A;  5DM6 V;  1GO3 F;  4JV5 O;  2B1G A;  4B08 A;  3CCM V;  4KUM A;  1A32 A;  4UVB A;  1VQM V;  3ASO B;  4FPP A;  1OCZ C;  3N2K A;  1JCH A;  5EZY A;  3CC4 V;  1KB9 F;  4NXN B;  4TT3 G;  3A0B Z;  3A2F A;  2FYU H;  4X64 B;  3FB8 C;  1H38 A;  3OTF A;  3FD9 A;  2MK3 A;  2ZXW C;  1SA0 A;  4IHJ B;  4LH6 A;  1P84 F;  1M57 C;  1OZ0 A;  2BTQ A;  4DR6 O;  4WFE A;  3CYO A;  5DN6 G;  1P7G A;  3GVM A;  1YEW A;  1YDX A;  3TET A;  2LFR A;  2WPD G;  5LL6 Y;  1M90 W;  4I9Q A;  1ZTE A;  2Q7G A;  1EBO A;  2WLK A;  3M8A A;  5IYB O;  1XL6 A;  1JR9 A;  3ZRX A;  5IYC O;  1WN7 A;  3OEH G;  4HYO A;  4MS2 A;  3RYH B;  4GZR B;  1WJZ A;  1Y76 B;  2RN9 A;  4PA9 A;  3SPI A;  5IY5 C;  2P6J A;  2WLL A;  3LDE A;  1GRJ A;  5H6R A;  2X0L A;  4X62 O;  1OCC B;  1SQV H;  3E8B A;  2VQE B;  1VP7 A;  1SQG A;  3H1J H;  3G6E V;  4NTY A;  1VQ5 V;  2V1D A;  1WP7 A;  4W4K A;  1NI8 A;  2F4V O;  3T1H O;  2QKC A;  5IY5 B;  4Z2W A;  1K7D A;  1TVK B;  2WA4 A;  3GWK C;  3QG5 A;  5BR8 B;  1N33 B;  3SGI A;  1JA8 A;  1NTK H;  4KP4 A;  4MTX A;  2DYS B;  4DR5 O;  3D8C A;  2XAF A;  4IYH A;  4TV9 B;  3AG4 C;  1RP3 B;  1BHA A;  4BIO A;  1TVK A;  5KHG A;  2HP8 A;  1MAB G;  1HP8 A;  3ZMU A;  3ABK B;  1BSM A;  2PGG A;  1OCR B;  1Q82 W;  4I55 A;  3ZIA G;  4JI0 O;  2RDC A;  3A0R A;  4UCS A;  2CTW A;  3SYQ A;  3BHP A;  1G4Y B;  4F4L A;  2GHY A;  2WWW A;  2JEU A;  3RVZ A;  1MOF A;  5LGU A;  4L8J A;  4LFC O;  5CBF A;  1R3I C;  5BMV A;  1TUE B;  2WLH A;  4UB6 Z;  1GN4 A;  5LHH A;  4DV1 O;  4RAI A;  5K1P A;  1SQB H;  3AK3 A;  3WB2 A;  1IZ3 A;  2Z5U A;  1Q3E A;  4QIW F;  4P30 A;  4FLT A;  4AI8 A;  1XMO B;  1H8H G;  1XMQ O;  1QLE B;  2OCH A;  4YY3 B;  4DV0 O;  2OT5 A;  4DUZ O;  5JVD B;  3JCZ A;  3JD2 A;  4EB6 B;  1E79 G;  4JYA B;  1V55 B;  2JS3 A;  2F1M A;  4B3R B;  1XIL A;  2JDI G;  1VIB A;  3F7V C;  2BCC H;  1V54 B;  3TGU H;  1XQ8 A;  4DR4 B;  1JFF A;  4NVP A;  4DXW A;  4GCZ A;  3H01 A;  3E22 B;  5B3S C;  1Z5V A;  4P9P A;  1NR1 A;  3ZMV A;  2GBO A;  3CCQ V;  2H3O A;  1NQT A;  4R8C A;  5GW7 A;  4ZKI A;  5LMN O;  4EEQ A;  2YEV A;  5B3S B;  2ZM6 O;  4LF7 B;  4NTX A;  5H5N A;  4O2A A;  3W7W A;  2P5O A;  4CH3 A;  2WAM A;  2IJJ A;  1N4C A;  3CHX A;  4WF9 V;  2E75 B;  2LGQ A;  1D5A A;  1AP6 A;  4DV3 B;  1K4D C;  1QBZ A;  4UCT A;  5E1A C;  4BAY A;  4ZOL A;  3O65 A;  1HNX B;  2XTA A;  4LR3 A;  4LFC B;  3BAB A;  5FPO A;  1BQ0 A;  4AQY B;  3S3X A;  5JJJ B;  5FNV B;  3APQ A;  4MTG A;  2EIM C;  3AG1 B;  1WNS A;  4CS2 A;  4LH7 A;  5CN0 A;  2KSD A;  1RM1 C;  1E1Q G;  2ZR3 A;  2ODM A;  3HKC B;  1SER A;  2KG7 B;  4J7K A;  1HR0 O;  4H37 A;  5KHK A;  2PYL A;  4B3T O;  4B3R O;  3ETQ A;  4FLY A;  2ZE5 A;  2QGN A;  4JTC B;  2VRZ A;  1F4M A;  1AB3 A;  1AIL A;  4O2B B;  4H13 B;  5DED A;  1YXB A;  1D5N A;  4JPR A;  4R7C A;  1QR8 A;  3BVO A;  2DMX A;  3OAA G;  1V9P A;  2KB1 A;  3SJC C;  3ZHS A;  4JI7 O;  1GKF A;  1JJ2 U;  5H6Q A;  3ZED A;  1NBM G;  4PA4 A;  3DSQ A;  4BW9 A;  4TV9 A;  3CD6 V;  1H8E G;  2GSM B;  2UXB O;  4BIU A;  3ASO C;  1Y76 A;  3K57 A;  1IDS A;  2XAS A;  3K08 A;  4NTW A;  1WPX A;  1AI4 A;  2CGO A;  3OFN G;  1Z5W A;  4CH5 A;  5CA3 A;  2HJD A;  4LF5 O;  1K97 A;  5E79 Z;  1V55 C;  5EYP B;  3K04 A;  1I7F A;  2GTS A;  3AK2 A;  4HNA A;  4QPK A;  1O9H A;  1R73 A;  3ZCC A;  1B6Q A;  2LP7 A;  4YJ3 A;  3G80 A;  4QNH B;  4D7S A;  2IJK A;  4FLW A;  3F7Y C;  5DEC A;  1FD9 A;  1WAZ A;  5LHI A;  2YXH A;  4FLX A;  4JI6 O;  5KUK A;  2GUZ A;  1SRY A;  2JVD A;  3CCU V;  1NT2 B;  1K9M W;  1FXH A;  1VAR A;  2Q67 A;  4MVO A;  4NKG B;  4PDR A;  4OX9 B;  2PI4 A;  1OCC C;  3J7A U;  2L6L A;  4G27 B;  4NYK A;  2RJZ A;  1S3J A;  1OCZ B;  1JVM A;  4KHP B;  2UU9 O;  1R6T A;  1IUR A;  4UCO A;  2RMK B;  5IYD O;  1ZSP A;  1MZE A;  4I0X B;  3STZ C;  3IAY A;  4O4L B;  1QHT A;  4YHH B;  2JGU A;  1YJN V;  3B2E E;  4QPJ A;  2BOB C;  1ENV A;  4PA6 A;  2ZT9 B;  4NB5 A;  3ABL B;  2QA4 V;  5LXT B;  3LNN A;  1RM1 B;  2UUC B;  4JAS A;  3ZN0 A;  3JAW B;  1Q90 D;  4K8X A;  2AHY A;  1W0K G;  4DV2 O;  4GLX A;  4GYC B;  2ARH A;  3VQW A;  3BY6 A;  1N0J A;  2HKO A;  4FFB A;  4FFK A;  1Y4M A;  4DK0 A;  2LW1 A;  4DYL A;  3UO2 A;  5C93 A;  2B9Z A;  4LFA O;  2NLJ C;  3IGA C;  3FB5 C;  2BTO A;  3IJ4 A;  1KP2 A;  3BFR A;  1AR1 B;  4IIJ B;  3WB0 A;  4O2B A;  2Z3Y A;  1LUV A;  5B1A B;  4JI6 B;  1VF7 A;  4IGG A;  5LA6 A;  1OCR C;  4BWA A;  3UQ8 A;  3SR2 C;  1QLN A;  1PKX A;  2QM4 A;  2Q0O C;  3R65 A;  3K06 A;  2UXC B;  4ASU G;  4I9W A;  5JCO C;  5D5Q A;  3B8N A;  1KKC A;  3L9D A;  1NH2 D;  4DV1 B;  5JH7 A;  1QNM A;  2ZE6 A;  1NTZ H;  3PN1 A;  4LP8 A;  5FLX N;  4ZIB A;  3LSS A;  4FM2 A;  4NR1 A;  2RQ6 A;  5BZB A;  2AXT Z;  3JAK A;  2HR3 A;  2IH1 C;  4FIP C;  1GM9 A;  1IBM B;  1R1B A;  2DJV A;  4ZOL B;  1L0L H;  3OUF A;  2QM7 A;  1GN2 A;  4LF8 O;  1URF A;  1HNZ B;  2C2A A;  5JWP A;  4DR5 B;  2VS0 A;  1Y74 B;  5BXZ A;  5JH7 B;  3D36 C;  5FNV A;  4PA3 A;  2E74 B;  4J11 A;  1I94 B;  1JX9 A;  4PDM A;  2AZ2 A;  4X66 B;  1MNG A;  2EX3 A;  2DE0 X;  4X20 B;  3ZHQ A;  3BRC A;  4UCR A;  1MMM A;  1KU9 A;  4DV6 B;  4F6E A;  4X1K B;  2QEX V;  5B1B C;  1KD1 W;  4MVR A;  1GH6 A;  4JI0 B;  1TUB B;  4O4J A;  4LWS B;  1ZAU A;  2P22 C;  4PI0 A;  4LF6 B;  1GN6 A;  3JAM N;  3T1H B;  4DV5 O;  2PTM A;  1PD3 A;  1AJP A;  2PF4 E;  4Z1V A;  3QNE A;  4UV9 A;  4JI5 O;  2X7R B;  1THZ A;  4GX1 A;  5GON B;  5GTH Z;  1Q7Y W;  1GN3 A;  5KLV H;  1VQ8 V;  1K33 A;  3RN4 A;  4GKK B;  2DQ3 A;  2JEX A;  1PP9 H;  3AG4 B;  2P4V A;  1H2G A;  2G38 A;  5IWA O;  2OTL V;  2X6B A;  2XT9 A;  4JI8 B;  2BSK A;  2V7Q G;  4LF8 B;  4X89 A;  5KAI Z;  1SES A;  5BY1 A;  3SYP A;  3CB2 A;  3NXS A;  1FS0 G;  2QJ1 A;  4LF4 O;  4O4L A;  5L3G A;  1BQZ A;  3W7T A;  1NS1 A;  3K9S A;  3H1H H;  4WFH A;  1IXM A;  2EUL A;  1ZLZ A;  2IBZ H;  1R6N A;  2OCC C;  1FAF A;  2EIJ C;  4DV4 B;  5B1O A;  4G2K A;  2KQX A;  4R6Z A;  2JGD A;  2P06 A;  3FKS G;  4YJ2 A;  2JJ2 G;  4NXM O;  2BSK B;  2O57 A;  4Q20 A;  1MA1 A;  2AW9 A;  3BAA A;  4PV1 B;  3SPH A;  5K1X A;  3N2K B;  4ZHQ B;  1MSW D;  1S76 D;  2PY5 A;  1M4U A;  4LF6 O;  1XMQ B;  2QKS A;  3E2E A;  4EFE A;  4LNU A;  3WU2 Z;  3T4D A;  3QF7 A;  1RFY A;  2ATK C;  4QGP A;  2ZR2 A;  4MT8 A;  3X2Q B;  1HR0 B;  4YJ2 B;  1MZF A;  4X9Q A;  4OGQ B; 
#chains in the Genus database with same CATH homology
 5GTI Z;  2AXT Z;  3A0H Z;  4UB8 Z;  3KZI Z;  3WU2 Z;  5E79 Z;  3A0B Z;  5B5E Z;  5TIS Z;  1S5L Z;  4IL6 Z;  5B66 Z;  5KAF Z;  4PJ0 Z;  5H2F Z;  5KAI Z;  5GTH Z;  4UB6 Z;  3JCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...