5B7CA

Crystal structure of octopus s-crystallin q108f mutant in complex with glutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
214
structure length
206
Chain Sequence
PSYTLHYFNHRGRAEICRMLFAAAGVQYNDRRIESSEWDSMRNKMPCHMMPMLELDNRTQIPQSMAMARYLAREFGFHGRNNMEMARVDFISDCFYDILDDYMRMYFDGNCRMMFSSEKRMRFQETCRRILPFMERTLEMYSGGSQYFMGDQMTMADMMCYCALENPLMEEPSMLSSYPKLMALRNRVMNHSKMSSYLQRRCRTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-crystallin OctvuS4
publication title Structure of a Highly Active Cephalopod S-crystallin Mutant: New Molecular Evidence for Evolution from an Active Enzyme into Lens-Refractive Protein
doi rcsb
source organism Octopus vulgaris
molecule tags Structural protein
total genus 69
structure length 206
sequence length 214
ec nomenclature
pdb deposition date 2016-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5b7cA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5b7cA01
2DJKA 4BL7B 1BQ7A 4KAEA 1G0TA 3H79A 1Z3EA 4ZILA 1A2MA 1ZMAA 4OFNA 3ERFA 2JSYA 2V41A 4OWYA 5J3RA 1JFUA 2YWNA 2LKUA 1JHBA 2CZ3A 1THOA 3WGEA 1XWKA 14GSA 1A23A 2E2GA 4WETA 1EOHA 2DIYA 3K8NA 3APQA 1SKSB 4PUAA 3W6GA 4HDEA 5B8BA 1EGOA 1OC9B 4MZWA 4MABA 2HYXA 4HU9A 1JLVA 2H73A 1ZCPA 2RLIA 5IPGA 3QFAC 3IBHA 4IP1A 3TKSA 2KP1A 3SBCA 4JE1A 4XTSA 4IQAA 3EU4A 1A0FA 2PWJA 4DSRA 1DSBA 2FWEA 2YJHA 1S3AA 2K18A 3TKSC 5IPHA 4K0GA 3IK7A 2H30A 4ISDA 2VCQA 4LLRA 2KOKA 3LEFA 4TR0A 4BVYB 1TW9A 2PU9C 5AIVA 5AIXA 4I6XA 1GNWA 4XS4A 2GGTA 4NHZA 4PQHA 1M99A 1J0FA 1WWJA 2GLRA 5DBQA 1KEBA 2XC2A 2IFQB 1XIYA 4K9ZA 1K0BA 1XOAA 1A24A 1NHYA 2C4JA 3WGDA 2XPDA 3M8NA 4IJ3A 1K0NA 2GQMA 1SYRA 2Z9SA 2NTOA 1XFLA 4MJBA 2CVDA 3P8WA 3F3QA 5CYYA 2H71A 1EV4A 4O5RA 4XRDA 3GV1A 4L0WA 2RUFA 5LNKe 2LTKA 1ERTA 2GT6A 4K0NA 2AYTA 5ECOB 2EIRA 3DVXA 4QL9A 1XOBA 3VFIA 2GQKA 3DIEA 4MF5A 2V2GA 2VCZA 3HVVA 4RI7A 3IXRA 2DJ1A 4H86A 4FIWA 5IIZA 1R4WA 1J9BA 5IOWA 4CHSA 3GMFA 2B6MA 1V98A 3HZ8A 3EYTA 1QUWA 1I5GA 2C0GA 1XVWA 3O3TA 1QGVA 2F8FA 4I2UA 1U3AA 4I2TA 3FR3A 1AQWA 1GRXA 1T8EB 1EOGA 1BX9A 5KN3A 1Q98A 2VAFA 3QCPA 1FW1A 5KN1A 4KGIA 2L4CA 2KHPA 2LQQA 2B5XA 1W4VA 4N0ZA 2AB6A 4E8HA 4ML6A 3F6FA 1SYXA 2VLTA 3GSSA 2B5YA 5J5NA 2WB9A 3APSA 3EVIA 5IMAA 3LQ7A 3L78A 2KP2A 2HFDA 3E0UA 2QGVA 2K9FA 5DQYA 3FZ9A 2PN8A 2GSSA 3R2QA 1XCCA 3ED3A 1B9XC 1MDJA 1FB6A 4MH2A 1JZRA 2H75A 4K7IA 4N10A 2VUPA 4GQCA 2FWGA 1XBSA 1T4ZA 2IN3A 3ZREA 2IIYA 1USBA 1SU9A 3TOTA 1U87A 5E59A 2ZCTA 3C71A 3PINA 3GX8A 1LJRA 3HJMA 1ERUA 3TKQA 4KDUA 1R7HA 1ZZYA 1T4YA 3H4KA 3UL3A 1WRYA 3CSJA 4MPFA 3DD3A 1DUGA 4O32A 5EPFA 4RQXA 5DAKA 2DJ0A 2B1KA 1M9AA 4TN8A 5ECKB 4WXTA 1SD8A 4KB3A 4XS6A 2ON5A 2X64A 2P0GA 2V6OA 1M0UA 2PMTA 2HXKA 1RW1A 2JACA 4KCAA 2HSHA 3ZTLA 2QKEA 4AJ7A 1XWBA 3VK9A 2OADA 2P5RA 1A0RP 3CMIA 4TR1A 4NV2A 4OO5A 5F06A 1G7OA 1THXA 1EEJA 1EP8A 12GSA 13GSA 2YV7A 2R37A 1FG4A 1TKDB 3A3TA 1SJZA 4K7NA 1W89A 4NPBA 4MLYA 1OAZA 2H6XA 4TXOB 4O92A 3ZMLA 2F51A 3ZYWA 1MDIA 1GTAA 3FY7A 4OFTA 2ES7A 3ERWA 4PX1A 2OE0A 5ABRA 4KW6A 1PQNA 2IL3A 4BPYA 2DC5A 4PUFC 3HY2A 3GSTA 3KP8A 1LU4A 4NXIA 4GSTA 4MJEA 1PGTA 1K3YA 4TXOA 3BJ5A 1OYJA 1AC1A 4ILFA 1ZYQB 4Q5QA 4FYCA 4K2DA 4G10A 2GDRA 4IQ1A 4HZ2A 1F9MA 2MMNA 2HZEA 3O76A 4KNDA 3KTBA 2HSNB 2FA8A 1CQGA 2H0GA 3BCIA 3Q19A 4XRAA 4DSSB 2GZYA 2GQLA 5COHA 3IK9A 4HQZA 1TI1A 2DBCA 1T7PB 2MMOA 2C0FA 3ZLPA 3IE3A 2O89A 2YWOA 3P7XA 4MF7A 1R5PA 1FB0A 1B4PA 1GULA 3KTLA 2GSRA 5EL8A 1HNAA 1GTUA 3APOA 5GZZB 2IMKA 3IC8A 2FY6A 4LL4B 1MDKA 4L8EA 6GSXA 3QAWA 5H5QA 1DE1A 1V2AA 2FHEA 2H66A 3W8SA 3DEXA 5D8IA 2JU5A 3EMPA 1YKAA 2L5OA 4ECBA 3I43A 3G7IA 3HXSA 3GKKA 1VF1A 1S3CA 1Z6NA 5B8AA 1BYEA 2HT9A 1JZOA 2HNLA 4J57E 3KIJA 3LXTA 3GKXA 4WBJA 3TJFA 3TJJA 2H74A 2WULA 2CX4A 2C0EA 2YNXA 4QL7A 2OACA 3IV4A 1GSEA 4CW9A 1A2LA 2NBSA 3UAPA 4V1Ap 5GSTA 1F3AA 2WFCA 4J2FA 1JZWA 4K6XA 3N9JA 4ZBAA 1GWCA 5F07A 2C3NA 2O7KA 3FK8A 4X43A 5B6MA 3ME8A 3QDNA 1R5AA 4FH8A 3QD9A 1FO5A 4JR4A 5J4UA 1G7EA 1XW5A 4MZBA 4MZCA 2J23A 4RUVA 3ZVJA 22GSA 3CRTA 5FHIA 3D4TA 2HRKB 1T00A 1GLQA 3G9BA 2IMEA 18GSA 3BBYA 1EV9A 5D9XA 1Y25A 1GLPA 2GVPA 4TVEA 2YZHA 3F9UA 5HR0A 2HRFA 3KJYA 1TRSA 3DVWA 4EUYA 5D9WA 3GRXA 1UA5A 1O73A 4RQRA 1QMVA 2VCTA 4Q5NA 1GUHA 4EXJA 4YAPA 3L0HA 5ECRB 3FW2A 1GSSA 1PMTA 5IMCA 1XWCA 2JL4A 3BOAA 2LJKA 2M46A 4ECCA 5ECPB 2VD1A 2VO4A 1WE0A 3LG6A 1U6TA 3D6IA 2EIOA 1YEXA 3CXGA 1PL1A 1FOVA 4PGTA 2XPEA 5ELGA 2H72A 3WGXA 1YF0A 1BEDA 1NM3A 2LV3A 4ID0A 4BA7A 4MK3A 5IMFA 3QFBC 3VWXA 3ZRDA 3A5WA 2M72A 3MNGA 1XW6A 3I69A 2K6VA 3E3EA 19GSA 3UOMA 4ZB6A 11GSA 4MMMA 4XS1A 3KZQA 4ZXGA 3US3A 1ML6A 3CSIA 2ZUPA 3MWHA 4ULXA 1X5EA 1OC3A 2PERA 3F4TA 3TJKA 3I6AA 2CT6A 1BG5A 1O6JA 5ECSA 2H6YA 1KNGA 2C8UA 2IPAA 4HOJA 2B5EA 1T3BA 5IM9A 2OE3A 3N5OA 3DRNA 5IMZA 4XS4B 3PGTA 3F4RA 2YP6A 5ENUA 2WCIA 2PPTA 3TUEA 3GTUA 3WT2A 4TOPA 2E0QA 4IJIA 2IMFA 2B7JA 1SL2B 4MA9A 1V57A 4EDYA 3DMLA 1C72A 4IBPA 4HEA2 2PVQA 5J41A 2GT5A 5ELAA 2MZCA 5G30A 5HFGA 3FYGA 2CQ9A 2R4VA 2DIZA 5H5SA 4V2LA 1SJ6A 3D21A 1DE2A 5C00A 4BWQA 2X8GA 4AGSA 2I1UA 4FYUA 4G0LA 4ZB9A 5IQYA 1YDKA 3RBTA 2H1AA 1YEPA 2ALBA 3ZVJD 3TOUA 2HE3A 5DCGA 2H1BA 4EC0A 1K0MA 4KX4A 1GP1A 2BMXA 1TXXA 1TOFA 2LS5A 3TJBA 2I3YA 3ISOA 1I9DA 4USSA 2L5LA 5DALA 5D93A 5B6NA 2F3MA 4LMVA 4WKWA 4KF9A 1M9BA 2H70A 2FD3A 17GSA 5G5EA 4NHWA 1M2DA 2R3XA 1GTIA 2VLUA 4KE3A 3QR6A 2DJ2A 2C0DA 5G1LA 5LCZA 1R26A 2VD0A 4EF0A 3ERGA 1ZGNA 3QAGA 4YQMA 2B7KA 3H8QA 5ECHB 4GQFA 5F8BA 4KSOA 4PQ1A 2C1YA 2L59A 5ECNB 5BMUA 3HVXA 5L71A 1ZL9A 3D5JA 1B9YC 3C1RA 2I4AA 2RIIA 1XPVA 1Z5YE 3FHKA 4ZL9A 4GRFA 2FUG2 3KEBA 1ZYEA 3LJRA 2AJQB 5ID2A 2GZPA 3ZZXA 2A2RA 3ME7A 4JR6A 5KN2A 4K8MA 4CDOA 2CZ2A 1E6BA 3UJ1A 1TI3A 2VCXA 4EL1A 1H4OA 3UIWA 4HU7A 4V2NA 3VWUA 3JCML 5DAKB 3Q18A 2RUEA 1YF1A 2CA8A 3C8EA 3FR6A 2H01A 3TGZA 5JCWA 4Z7XA 3LORA 1EEMA 1QK8A 3Q74A 4MP4A 4ZB8A 3QPMA 1Z7PA 2VOCA 3LYKA 1X5DA 10GSA 3NIVA 5C04A 1FAAA 4EKZA 6GSVA 2IMDA 5IO2A 1A8YA 3IAM2 2AV4A 1GSFA 2PGTA 4TR1B 4GSNA 4BVXA 6GSUA 1V58A 5EY6A 2WRTA 3PPUA 2AHEA 3M9KA 4ZBDA 1QXHA 1TDIA 3TKSE 3TKRA 2C80A 2WDUA 4LA1A 1SL1B 3J7Yb 4NWYA 2KLXA 3BD2A 3UMAA 5DJLA 1CQHA 1YKCA 1T1VA 4MPGA 2GS3A 3F0IA 3U5RE 2CV4A 2OJLA 3WYWA 3LGCA 5HR2A 3ZFBA 1V40A 4G0KA 2QC7A 1QQ2A 3PR8A 3OR5A 4WEYA 3IRAA 2N5FA 4ZIJA 3IA1A 1ERVA 1O81A 2HZEB 5AISA 2FGXA 1MD3A 2N5BA 4HJ2A 4ECJA 4PTSA 1O8WA 4TR3A 1SJIA 1XWAA 1TK8B 4JRRA 1WJKA 3VI5A 1U88A 4F0BA 2L4QA 1PKZA 2B1LA 6GSTA 4JZQA 4F03A 5ECQB 4LL1B 2HRAA 3HDCA 2C3TA 2E2MA 4ML1A 1B8XA 3CRUA 2AUVA 4IELA 3RAZA 4EDZA 3UBLA 3BCKA 2OA7A 1MEKA 3M9JA 2X99A 2VCWA 3KH9A 2JZTA 4POMA 3RDWA 2VIMA 1QFNA 1FVKA 5LD0A 1NHOA 2OBIA 3VI7A 5J9CA 3TRXA 5DVBA 4TXVA 1OE7A 3HJOA 1X5CA 2L57A 3L4NA 3L9UA 4YQVA 2VL3A 3ZIVA 16GSA 5HR3A 5DJMA 3HHVA 4WR4A 3Q6OA 1B4QA 3MDKA 1G6YA 2DJ3A 1EZKA 4WF4A 1AAZA 3E9JB 3UEMA 1Z9HA 4TW5A 1WIKA 4V1Ag 3EURA 4YH2A 5DCHA 5F05A 2GTUA 2MMAA 5G31A 1HQOA 2YZUA 1WOUA 5IO0A 4EE0A 4I5QA 3CBUA 5A4WA 3IR4A 2HQTA 3VPQA 2ZNMA 5F0GA 1GTBA 4X1UA 4Q5FA 1A8LA 2O87A 2LRNA 1VRSD 2V1MA 2PBJA 2FLSA 4JBBA 3UVHA 4MJCA 4XHMA 2TRXA 3VLNA 1AIUA 1HNBA 1TK0B 2G2QA 4GF0A 4F2IA 3EWLA 3DYRA 2BJXA 3FEUA 3GH9A 2R2JA 3GIXA 3TCOA 3KH7A 3GH6A 1TTZA 20GSA 1OKTA 2CAIA 3VWVA 5IMVA 5GAND 4P3YB 1GNEA 1OC8A 5IOXA 4BWSA 5IMDA 4I97A 2BTOT 3HYPA 1GSUA 4WR5A 3GN3A 1E2YA 3EC3A 4DVCA 4AJ8A 4WF5A 3F4SA 2LJAA 4MDCA 3WT1A 1BAYA 3GYKA 4KA0A 2NDOA 2NPBA 2VL2A 2WZ9A 1URMA 2XBQA 5CP1A 2ON7A 4N11A 1ILOA 1VF4A 2GZZA 5GAPD 3CYNA 4D73A 2MMZA 2PVOC 1XZOA 2RM6A 1PN9A 2VL2C 3IAS2 2DJJA 3ZMKA 4KDYA 1UN2A 2H0IA 1PD21 1B48A 3QAVA 3FR9A 2IJYA 4NMUA 2EC4A 2I81A 1AW9A 3LWAA 1G6WA 4G0IA 1JZDA 1M7TA 3VPTA 2H19A 3GX0A 4IHUA 4F0CA 1SKRB 3GNJA 3EINA 3D0ZA 2HSMA 1WPIA 2B3SA 2O8VB 4OO4A 1FHEA 4KDXA 3RPPA 3G7YA 3H93A 4MF6A 4YQUA 3KM6A 1K0DA 1PX6A 2DMMA 4E8EA 3WD6A 5HFIA 4BL7A 2KUCA 3IDVA 3GTUB 2DMLA 3KCMA 2FA4A 4XIHA 1SD9A 1H75A 1K3OA 4DEJA 1SENA 2YPMA 1ACVA 3M3MA 1SK1A 3A2XA 3H1NA 1X0RA 1PSQA 5INYA 1OC9A 2YOIA 4GLTA 3ZFLA 2F9SA 3QMXA 1LBKA 4HS1A 5DDLA 2DLXA 4OMVA 3J7Yk 5A4VA 3O6TA 2L6DA 1KTEA 1DBYA 3VURA 1M2AA 5DALB 4MJAA 5G1KA 3ZITA 2LRTA 3KP9A 5CRHA 3U6VA 4GTUA 4GCIA 1J08A 3F3RA 4ZL7A 1TP9A 1GH2A 3UARA 4ZBBA 5ECMB 4BVYA 3DXBA 4J56E 1HD2A 4NV5A 2JZSA 1RQMA 6GSWA 2V6KA 5D96A 4NAXA 2CAQA 2YJ7A 3C73A 2YCDA 1RK4A 4N0VA 4JEDA 4FQUA 1F37A 1K0CA 2IFQA 4F82A 2M80A 5DQSA 2YWMA 1UVZA 2HI7A 2P31A 3L9VA 3L9SA 4G9HA 3IC4A 2HSYA 3FKFA 2H8LA 1TU7A 5JWOB 4L5LA 2GSTA 2N5AA 2O85A 3MSZA 4KH7A 2C3QA 3IPZA 4IW9A 2H76A 3EMXA 1AQXA 3LFLA 1TRWA 3C1SA 5KN0A 4KUNA 1VGLA 4PXOA 1TRVA 2UZ8A 1X9WB 3KGKA 4GSSA 4ACSA 2K8SA 5ID2B 3TKPA 1O8XA 4KSMA 2JSZA 4QQ7A 3GHAA 2OKAA 5A5KA 1GUKA 2HRNA 2J9HA 5JCGA 1PRXA 3GL5A 1EP7A 1X9SB 4O7HA 1XXUA 3DWVA 1OKDA 1SL0B 2MYGA 1TU8A 1YQ1A 7GSSA 2A2SA 2LEGA 5D9VA 2G0FA 4HZ4A 3EE2A 4IKHA 2WGRA 3RHCA 1IYHA 4IN0A 4HJMA 4FO5A 4EO3A 1PL2A 1XWGA 2JZRA 3HVSA 1GL8A 1YY7A 5AGYA 2LJRA 4OFMA 1SK0A 3HJPA 3A2WA 4WBRD 3GURA 5CREA 3LSZA 3GA4A 5D73A 2CVKA 3I9V2 4HUAA 4KCEA 4BVXB 2RM5A 2TRCP 3D4MA 1FVJA 3P90A 4JU5A 3M1GA 1TK5B 2A4VA 2D2ZA 5ECIB 2IWTA 4YAVA 4HI7A 4TRXA 1MD4A 3S9FA 3M0FA 2QSIA 4GXZA 2LSTA 1ERWA 3HA9A 1ZOFA 2R5GA 5D9TA 1Z7RA 4EVMA 2FCHA 1N8JA 2DSAA 5A4UA 2FNOA 4X0XA 3VWWA 3KD0A 3ZIJA 2OE1A 2XHFA 1KBNA 4F9ZA 1VF3A 5E4WA 2TIRA 5B7CA 4IP6A 3KMOA 3F6DA 2IMIA 1WP0A 2YN1A 3KXOA 8GSSA 1SK2A 5CRWA 5HFKA 3D22A 4DSQA 2MBTA 3TB2A 1NSWA 1K3LA 1PA3A 3F63A 5KEJA 1A2JA 1Y6EA 1S3DA 4L0UA 1EGRA 5JWRB 5HQPA 1U3IA 1V9WA 6GSSA 2FWHA 2LNSA 3TRQA 4G2EA 4HQSA 5H5RA 2VLVA 1Z6MA 4POKA 2CVBA 3GL3A 4ECIA 1GSDA 3AY8A 3DGQA 5ECLB 3KMNA 1F2EA 1F3BA 3TRPA 2WJUA 3RHBA 2XBIA 3LXZA 3GFKA 3A2VA 3GKNA 4MH3A 5CNWA 2YANA 1X9MB 1SKWB 2FWFA 4L5OA 4AF2A 2P5QA 3FRCA 3GKMA 4K1FA 3ZL5A 3GUSA 4V2MA 5JCUA 1O85A 1VF2A 4ZL8A 5J9BA 4PNGA 3TJGA 3LYPA 1PKWA 5FWGA 3FZAA 5CRDA 3W8JA 2R6KA 2X8HA 3MAKA 2K8VA 3EU3A 1GSYA 1JLWA 4LMWA 2L6CA 1YJ6A 1NW2A 4IS0A 3TDGA 4PURA 2E7PA 3V1WA 1Q4JA 1BJXA 3RPNA 3SWLA 1HYUA 4OCEA 2LRCA 3PH9A 4DSSA 2REMA 2GSQA 2OBKA 4K7OA 1UC7A 2H0HA 1AQVA 3HCZA 4POLA 3R3EA 2YWIA 5HR1A 4GWRA 1O7UA 2I9HA 2VM1A 1GSQA 1K0AA 2F8AA 2X8CA 4Q5RA 3HZ4A 4I8BA 1IYIA 2VM2A 3IHQA 1WMJA 4FYBA 1YZXA 1HNCA 1K0OA 9GSSA 3IOSA 4IVFA 4OCFA 2V32A 4OD7A 4RI6A 3HKRA 1ON4A 3DKSA 2VL9A 5JWQB 2PUKC 1ST9A 3UVTA 4IGJA 2MBSA 5EVOA 2LUSA 5CAXA 1ABAA 2WS2A 4XCSA 3NOFA 2LQOA 3FZ5A 4PQIA 3CTGA 1XVQA 4PNFA 4TKYA 5FT3A 4D73B 4N30A 3HD5A 1OVNA 6GSYA 5G5FA 1TRUA 3QOUA 3C7MA 3CSHA 1M2BA 3FZ4A 2JADA 4MCUA 5G2ZA 4G19A 2YV9A 5CO3A 3NZNA 1EWXA 2HLSA 1MTCA 2HZFA 1N2AA 2VCVA 1GUMA 2HRKA 3G7JA 3F8UA 1F6MC 1OE8A 2CX3A 2H6ZA 1PX7A 3CTFA 1AXDA 2AAWA 5AN1A 2HSMB 2NVLA 5CRGA 2H1DA 2H1GA 2EIQA 3P2AA 1TJDA 5GSSA 1AUCA 4POBA 4AJ6A 2LNTA 3UBKA 1XW9A 4TR4A
chains in the Genus database with same CATH superfamily
2DJKA 4BL7B 1BQ7A 4KAEA 1G0TA 3H79A 1Z3EA 4ZILA 1A2MA 1ZMAA 4OFNA 3ERFA 2JSYA 2V41A 4OWYA 5J3RA 1JFUA 2YWNA 2LKUA 4EIPA 1JHBA 2CZ3A 1THOA 3WGEA 1XWKA 14GSA 1A23A 2E2GA 4WETA 1EOHA 2DIYA 3K8NA 3APQA 1SKSB 4PUAA 3W6GA 4HDEA 4YKFA 5B8BA 4AKXB 1EGOA 1OC9B 4MZWA 4MABA 2HYXA 4HU9A 1JLVA 2H73A 1ZCPA 2RLIA 4ZB7A 5IPGA 3QFAC 3IBHA 4IP1A 3TKSA 2KP1A 3SBCA 4JE1A 4XTSA 4IQAA 3EU4A 1A0FA 2PWJA 4DSRA 1DSBA 2FWEA 2YJHA 1S3AA 2K18A 1Y1UA 3TKSC 5IPHA 4K0GA 3IK7A 1S3RA 2H30A 4ISDA 2VCQA 4LLRA 2KOKA 3LEFA 4TR0A 4BVYB 1TW9A 2PU9C 5AIVA 5AIXA 4I6XA 1GNWA 4XS4A 2GGTA 4NHZA 4PQHA 1M99A 1J0FA 1WWJA 2GLRA 5DBQA 1KEBA 2XC2A 2IFQB 1XIYA 4K9ZA 1K0BA 1XOAA 1A24A 1NHYA 2C4JA 3WGDA 2XPDA 3M8NA 4IJ3A 1K0NA 2GQMA 1SYRA 2Z9SA 4Z2TA 2NTOA 1XFLA 4MJBA 2CVDA 3P8WA 3F3QA 3LW9A 5CYYA 2H71A 1EV4A 4O5RA 4XRDA 3GV1A 4L0WA 2RUFA 5LNKe 2LTKA 1ERTA 2GT6A 4K0NA 2AYTA 5ECOB 2EIRA 3DVXA 4QL9A 1XOBA 3VFIA 2GQKA 3DIEA 4MF5A 2V2GA 2VCZA 3HVVA 4RI7A 3IXRA 2DJ1A 4H86A 4FIWA 5IIZA 1R4WA 1J9BA 5IOWA 4CHSA 3GMFA 2B6MA 1V98A 3HZ8A 3EYTA 1QUWA 2O5VA 1I5GA 2C0GA 1XVWA 3O3TA 1QGVA 2F8FA 2VKZG 4I2UA 1U3AA 4I2TA 3FR3A 1AQWA 1GRXA 1T8EB 1EOGA 1BX9A 5KN3A 1Q98A 2VAFA 3QCPA 1FW1A 2WW0A 4KGIA 5KN1A 2L4CA 2KHPA 2LQQA 2B5XA 1W4VA 4N0ZA 2AB6A 4E8HA 4ML6A 3F6FA 1SYXA 1XG8A 2VLTA 3GSSA 2B5YA 5J5NA 2WB9A 3APSA 3EVIA 5IMAA 3LQ7A 3L78A 2KP2A 4AKIA 2HFDA 3E0UA 2QGVA 2K9FA 5DQYA 3FZ9A 2PN8A 2GSSA 3R2QA 1XCCA 3ED3A 1B9XC 1MDJA 1FB6A 4MH2A 1JZRA 2H75A 4K7IA 4N10A 2VUPA 4GQCA 2FWGA 1XBSA 1T4ZA 2IN3A 3ZREA 2IIYA 1USBA 1SU9A 3TOTA 1U87A 4QMKA 5E59A 2ZCTA 3C71A 3PINA 3GX8A 1LJRA 3HJMA 1ERUA 3TKQA 4KDUA 1R7HA 1ZZYA 1T4YA 3H4KA 3UL3A 1WRYA 3CSJA 4MPFA 3DD3A 1DUGA 4O32A 5EPFA 4RQXA 5DAKA 2DJ0A 2B1KA 1M9AA 4TN8A 5ECKB 4WXTA 1SD8A 4KB3A 4XS6A 2ON5A 2X64A 2P0GA 2V6OA 1M0UA 2PMTA 2HXKA 1RW1A 2JACA 4KCAA 2HSHA 3ZTLA 2QKEA 4AJ7A 1XWBA 3VK9A 2OADA 2P5RA 1A0RP 3CMIA 4TR1A 4NV2A 4OO5A 5F06A 1G7OA 1THXA 1EEJA 1EP8A 12GSA 13GSA 2YV7A 2R37A 1FG4A 1TKDB 3A3TA 1SJZA 4K7NA 1W89A 4NPBA 4MLYA 1OAZA 2H6XA 4TXOB 4O92A 3ZMLA 2F51A 3ZYWA 1PFOA 1MDIA 1GTAA 3FY7A 1M3IA 4OFTA 2ES7A 3ERWA 4PX1A 2OE0A 5ABRA 4KW6A 1PQNA 2IL3A 4BPYA 2DC5A 4PUFC 3HY2A 3GSTA 3KP8A 1LU4A 4NXIA 4GSTA 4MJEA 1PGTA 1K3YA 4TXOA 3BJ5A 1OYJA 1AC1A 4ILFA 1ZYQB 4Q5QA 4FYCA 4AKGA 4G10A 4K2DA 2GDRA 4IQ1A 4GDFA 4HZ2A 1F9MA 2MMNA 2HZEA 3O76A 4KNDA 3KTBA 1ZYPA 2HSNB 2FA8A 1CQGA 2H0GA 3BCIA 3Q19A 4XRAA 4DSSB 2GZYA 2GQLA 5COHA 3IK9A 4HQZA 1TI1A 2DBCA 1T7PB 2MMOA 2C0FA 3ZLPA 3IE3A 2O89A 2YWOA 3P7XA 4MF7A 1R5PA 1FB0A 1B4PA 1GULA 3KTLA 2GSRA 5EL8A 1HNAA 3CQFA 1GTUA 3APOA 5GZZB 2IMKA 3IC8A 2FY6A 4LL4B 1MDKA 4L8EA 6GSXA 3QAWA 5H5QA 1DE1A 5J4YA 1V2AA 3A5IA 2FHEA 2H66A 3W8SA 3DEXA 5D8IA 2JU5A 3EMPA 1YKAA 2L5OA 4ECBA 3I43A 3G7IA 3HXSA 3GKKA 1VF1A 1S3CA 1Z6NA 5B8AA 1BYEA 2HT9A 1JZOA 2HNLA 4J57E 3KIJA 3LXTA 3GKXA 4WBJA 3TJFA 3TJJA 2H74A 2WULA 2CX4A 2C0EA 4FXYP 2YNXA 4QL7A 2OACA 3IV4A 1GSEA 4CW9A 1A2LA 5A34A 3UAPA 2NBSA 4V1Ap 5GSTA 2WVXB 1F3AA 2WFCA 1FOHA 4J2FA 1JZWA 4K6XA 2EFEA 3N9JA 4ZBAA 1GWCA 5F07A 2C3NA 2O7KA 3FK8A 4PHZC 4X43A 5B6MA 3ME8A 3QDNA 1R5AA 4FH8A 3QD9A 1FO5A 4JR4A 5J4UA 1G7EA 1XW5A 4MZBA 4MZCA 2J23A 4RUVA 3ZVJA 22GSA 3CRTA 5FHIA 3D4TA 2HRKB 1T00A 1GLQA 3G9BA 2IMEA 18GSA 3BBYA 1EV9A 5D9XA 1Y25A 2X49A 1GLPA 2GVPA 4TVEA 2YZHA 3F9UA 5HR0A 2HRFA 3KJYA 1TRSA 3DVWA 4EUYA 5D9WA 3GRXA 1UA5A 1O73A 4RQRA 1QMVA 2VCTA 4Q5NA 1GUHA 4EXJA 4YAPA 3L0HA 5ECRB 3FW2A 1GSSA 1PMTA 5IMCA 1XWCA 2R0GA 2JL4A 3BOAA 2LJKA 2M46A 4ECCA 5ECPB 2VD1A 2VO4A 1WE0A 4X4JA 3LG6A 1U6TA 3D6IA 2EIOA 1YEXA 3CXGA 1PL1A 1FOVA 4PGTA 2XPEA 5ELGA 2H72A 3WGXA 1YF0A 1BEDA 1NM3A 2LV3A 4ID0A 4BA7A 4MK3A 5IMFA 3HMJG 3QFBC 3VWXA 3ZRDA 3A5WA 2M72A 3MNGA 1XW6A 3I69A 2K6VA 3E3EA 1M3JA 19GSA 3UOMA 4ZB6A 11GSA 4MMMA 4XS1A 3KZQA 4ZXGA 3US3A 1ML6A 3CSIA 2ZUPA 3MWHA 4ULXA 1X5EA 1OC3A 2PERA 3F4TA 3TJKA 3I6AA 2CT6A 1BG5A 1O6JA 4PI2C 5ECSA 2H6YA 1KNGA 2C8UA 2IPAA 4HOJA 2B5EA 1T3BA 5IM9A 2OE3A 3N5OA 3DRNA 5IMZA 4XS4B 3PGTA 3F4RA 2YP6A 5ENUA 2WCIA 2PPTA 3TUEA 3GTUA 4O5QA 3WT2A 4TOPA 2E0QA 4A5PA 4IJIA 2IMFA 2B7JA 1SL2B 4MA9A 1V57A 4EDYA 3DMLA 1C72A 4IBPA 4HEA2 2PVQA 5J41A 2GT5A 5ELAA 2MZCA 5G30A 5HFGA 3FYGA 2CQ9A 1PN0A 2R4VA 2DIZA 5H5SA 4V2LA 1SJ6A 3D21A 1DE2A 5C00A 4BWQA 2X8GA 4AGSA 2I1UA 4FYUA 4G0LA 4ZB9A 5IQYA 1SVLA 1YDKA 3RBTA 2H1AA 1YEPA 2ALBA 3ZVJD 3TOUA 2HE3A 5DCGA 2H1BA 4EC0A 2DKHA 1K0MA 4KX4A 1GP1A 2BMXA 1TXXA 1TOFA 2LS5A 3TJBA 2I3YA 3ISOA 1I9DA 4USSA 2A4HA 4Z2RA 2L5LA 5DALA 5D93A 3TU3B 5B6NA 2F3MA 4LMVA 4WKWA 4KF9A 1YVLA 1M9BA 2H70A 2FD3A 17GSA 5G5EA 4NHWA 1M2DA 2R3XA 1GTIA 2VLUA 4KE3A 3QR6A 2DJ2A 2C0DA 5G1LA 5LCZA 1R26A 2VD0A 4EF0A 3ERGA 4PI0C 1ZGNA 3QAGA 4YQMA 2B7KA 3H8QA 5ECHB 4GQFA 5F8BA 4KSOA 4PQ1A 2C1YA 2L59A 5ECNB 5BMUA 2WVYA 4W66A 3HVXA 5L71A 1ZL9A 3D5JA 1B9YC 3C1RA 2I4AA 2RIIA 1XPVA 1Z5YE 3FHKA 4ZL9A 4GRFA 2FUG2 3KEBA 1ZYEA 3LJRA 2AJQB 5ID2A 2GZPA 1S4BP 3ZZXA 2A2RA 3ME7A 4JR6A 5KN2A 4K8MA 4CDOA 2CZ2A 5BRTA 1E6BA 3UJ1A 1TI3A 2VCXA 4EL1A 1H4OA 3UIWA 4HU7A 4V2NA 3VWUA 3JCML 5DAKB 3Q18A 2RUEA 1YF1A 2CA8A 3C8EA 3FR6A 2H01A 3TGZA 5JCWA 4Z7XA 3LORA 1EEMA 1QK8A 3Q74A 4MP4A 4ZB8A 3QPMA 1Z7PA 2VOCA 3LYKA 1X5DA 10GSA 3NIVA 5C04A 1FAAA 4EKZA 6GSVA 2IMDA 2UV8G 1A8YA 5IO2A 3IAM2 2AV4A 1GSFA 2QA2A 2PGTA 4TR1B 1BF5A 4GSNA 4BVXA 4BIKA 1N25A 6GSUA 1V58A 5EY6A 2WRTA 3PPUA 2AHEA 3M9KA 4ZBDA 1QXHA 1TDIA 3TKSE 3TKRA 2C80A 2WDUA 4LA1A 2EFCA 1SL1B 3J7Yb 4NWYA 2KLXA 3BD2A 3UMAA 5DJLA 1CQHA 1YKCA 1T1VA 4MPGA 2GS3A 3F0IA 3U5RE 2CV4A 2OJLA 3WYWA 3LGCA 5HR2A 3ZFBA 1V40A 4G0KA 2QC7A 1QQ2A 5J47A 3PR8A 3OR5A 4WEYA 3IRAA 2N5FA 4ZIJA 3IA1A 1ERVA 1O81A 2HZEB 5AISA 2FGXA 1MD3A 2N5BA 4HJ2A 4ECJA 4PTSA 1O8WA 2OT3A 4TR3A 4YKGA 1SJIA 1XWAA 1TK8B 4JRRA 1WJKA 3RFRC 3VI5A 1U88A 4F0BA 2L4QA 1PKZA 2B1LA 6GSTA 4JZQA 4F03A 5ECQB 4LL1B 2HRAA 3HDCA 2C3TA 2E2MA 4ML1A 1B8XA 3CRUA 2AUVA 4IELA 3HVNA 4EDZA 3RAZA 3UBLA 3BCKA 2OA7A 1MEKA 3M9JA 2X99A 2VCWA 3KH9A 2JZTA 4POMA 4AI6A 3RDWA 2VIMA 1QFNA 1FVKA 5LD0A 1NHOA 2OBIA 3VI7A 5J9CA 3TRXA 5DVBA 4TXVA 1OE7A 3HJOA 1X5CA 2L57A 3FMWA 3L4NA 3L9UA 4YQVA 2VL3A 3ZIVA 16GSA 5HR3A 2A2PA 4O5UA 5DJMA 5A34B 3HHVA 4WR4A 3Q6OA 1B4QA 3IHGA 3MDKA 1G6YA 2DJ3A 1EZKA 4WF4A 1AAZA 3E9JB 3UEMA 1Z9HA 4TW5A 1WIKA 4V1Ag 4G01A 3EURA 4YH2A 5DCHA 5F05A 2GTUA 2MMAA 5G31A 1HQOA 2YZUA 1WOUA 5IO0A 4EE0A 4I5QA 3CBUA 5A4WA 3IR4A 2HQTA 3VPQA 2ZNMA 5F0GA 1GTBA 4X1UA 4Q5FA 1A8LA 2O87A 2LRNA 1VRSD 2V1MA 2PBJA 2FLSA 4JBBA 3UVHA 4MJCA 4XHMA 4MNNA 2TRXA 3VLNA 1AIUA 1HNBA 1TK0B 2G2QA 4GF0A 4F2IA 3EWLA 3DYRA 2BJXA 4AKHA 4Z2UA 3FEUA 3GH9A 2R2JA 3GIXA 3TCOA 3KH7A 3GH6A 1TTZA 4CY8A 1YEWC 20GSA 1OKTA 2CAIA 3VWVA 5IMVA 5GAND 4P3YB 1GNEA 1OC8A 5A5HA 5IOXA 5KOXA 4BWSA 5IMDA 4I97A 2BTOT 3HYPA 1GSUA 4WR5A 3GN3A 1E2YA 3EC3A 4DVCA 4AJ8A 4WF5A 3F4SA 2LJAA 4MDCA 1BG1A 3WT1A 4E68A 1BAYA 3GYKA 4KA0A 2NDOA 2NPBA 2VL2A 2WZ9A 1URMA 2XBQA 5CP1A 2ON7A 4N11A 1ILOA 1VF4A 2GZZA 5GAPD 3CYNA 2DKIA 4D73A 2MMZA 2PVOC 1XZOA 2RM6A 1PN9A 2VL2C 3IAS2 2DJJA 3ZMKA 4KDYA 1UN2A 2H0IA 1PD21 2X4AA 1B48A 3QAVA 3FR9A 2WW2A 2IJYA 4NMUA 2EC4A 2I81A 1AW9A 3LWAA 1G6WA 4G0IA 1JZDA 1M7TA 3VPTA 2H19A 3GX0A 4IHUA 4F0CA 4K5SA 3GNJA 1SKRB 3EINA 3D0ZA 2HSMA 1WPIA 2B3SA 2O8VB 4OO4A 1FHEA 4KDXA 3RPPA 3G7YA 3H93A 4MF6A 4YQUA 3KM6A 1K0DA 1PX6A 2DMMA 4E8EA 3WD6A 5HFIA 4BL7A 2KUCA 3IDVA 3GTUB 2DMLA 3KCMA 2FA4A 4XIHA 1SD9A 1H75A 1K3OA 4DEJA 1SENA 2YPMA 1ACVA 3M3MA 1TXUA 1SK1A 3A2XA 3H1NA 1X0RA 1PSQA 5INYA 1OC9A 2YOIA 4GLTA 3ZFLA 2F9SA 3QMXA 2WVZA 1LBKA 4HS1A 5DDLA 5KOWA 2DLXA 4OMVA 3J7Yk 5A4VA 3O6TA 2L6DA 1KTEA 1DBYA 3VURA 1M2AA 5DALB 4MJAA 5G1KA 3ZITA 2LRTA 3KP9A 5CRHA 3U6VA 4GTUA 4GCIA 1J08A 3F3RA 4ZL7A 1TP9A 1GH2A 4HSCX 3UARA 4ZBBA 5ECMB 2O36A 4BVYA 2R0CA 3DXBA 4J56E 4N3ZA 1HD2A 4NV5A 2JZSA 1RQMA 6GSWA 2V6KA 5D96A 4NAXA 2CAQA 2YJ7A 3C73A 2YCDA 1RK4A 4N0VA 4JEDA 4FQUA 1F37A 1K0CA 2IFQA 4F82A 2M80A 5DQSA 2YWMA 1UVZA 2HI7A 2P31A 3L9VA 3L9SA 4G9HA 3IC4A 2HSYA 3FKFA 2H8LA 1TU7A 5JWOB 4L5LA 2GSTA 2N5AA 5BMUB 2O85A 3MSZA 4KH7A 2C3QA 3IPZA 4IW9A 2H76A 2R0PA 3EMXA 1AQXA 3LFLA 1TRWA 3C1SA 5KN0A 4KUNA 1VGLA 4PXOA 1TRVA 2UZ8A 1X9WB 3KGKA 4GSSA 4ACSA 2K8SA 5ID2B 3TKPA 4EIQA 1O8XA 4KSMA 2JSZA 4QQ7A 3GHAA 2OKAA 5A5KA 1GUKA 2HRNA 2J9HA 5JCGA 1PRXA 3GL5A 1EP7A 1X9SB 3MYDA 4O7HA 1XXUA 3DWVA 1OKDA 1SL0B 2MYGA 1TU8A 1YQ1A 7GSSA 2A2SA 3CHXC 2LEGA 5D9VA 3MIXA 2G0FA 5J40A 4HZ4A 3EE2A 4IKHA 2WGRA 3RHCA 1IYHA 4HJMA 4IN0A 4FO5A 4EO3A 1PL2A 1XWGA 2JZRA 3HVSA 1GL8A 1YY7A 5AGYA 2LJRA 4OFMA 1SK0A 3HJPA 3A2WA 4WBRD 3GURA 3RGBC 5CREA 3LSZA 3GA4A 5D73A 2CVKA 3I9V2 4HUAA 4KCEA 4BVXB 2RM5A 2TRCP 3D4MA 1FVJA 3P90A 4JU5A 3M1GA 1TK5B 2A4VA 2D2ZA 5ECIB 2IWTA 4YAVA 4HI7A 4TRXA 1MD4A 3S9FA 3M0FA 2QSIA 4GXZA 2LSTA 1ERWA 3HA9A 1ZOFA 2R5GA 5A1NB 5D9TA 1Z7RA 4EVMA 2FCHA 1N8JA 2DSAA 5A4UA 2FNOA 4X0XA 3VWWA 3KD0A 3ZIJA 4ICYA 2OE1A 2XHFA 1KBNA 4F9ZA 1VF3A 5E4WA 2TIRA 5B7CA 4IP6A 3KMOA 3F6DA 2IMIA 1WP0A 5A1NA 2YN1A 3KXOA 8GSSA 1SK2A 5CRWA 5HFKA 3D22A 4DSQA 2MBTA 3TB2A 1NSWA 1K3LA 1PA3A 3F63A 5KEJA 1A2JA 1Y6EA 1S3DA 4L0UA 2EFHA 1EGRA 5JWRB 5HQPA 1U3IA 1V9WA 6GSSA 2FWHA 2LNSA 3TRQA 4G2EA 4HQSA 5H5RA 2VLVA 1Z6MA 4POKA 2CVBA 5J4VA 3GL3A 4ECIA 1GSDA 2WZSA 3AY8A 3DGQA 5ECLB 3KMNA 1F2EA 1F3BA 3TRPA 2WW3A 2WJUA 3RHBA 2XBIA 2O3EA 3LXZA 3GFKA 3A2VA 3GKNA 4MH3A 5CNWA 1I1IP 4K5RA 2YANA 1X9MB 1SKWB 2FWFA 4L5OA 4AF2A 2P5QA 3FRCA 3GKMA 4K1FA 3ZL5A 3GUSA 4V2MA 5JCUA 1O85A 1VF2A 4ZL8A 5J9BA 4PNGA 3TJGA 3LYPA 1PKWA 5FWGA 3FZAA 5CRDA 3W8JA 2R6KA 1ZYNA 2X8HA 4CY6A 3MAKA 2K8VA 3EU3A 1GSYA 1JLWA 4LMWA 2L6CA 1YJ6A 1NW2A 4IS0A 3TDGA 4PURA 2E7PA 3V1WA 1Q4JA 1BJXA 2HSNA 3RPNA 2QA1A 3SWLA 1HYUA 4OCEA 2LRCA 3PH9A 4DSSA 2REMA 2H1LA 2GSQA 2OBKA 4K7OA 1UC7A 2H0HA 1AQVA 3HCZA 1SVOA 4POLA 3R3EA 2YWIA 5HR1A 4GWRA 1O7UA 3CWGA 2I9HA 2VM1A 1GSQA 1K0AA 2F8AA 2X8CA 4Q5RA 3HZ4A 4I8BA 1IYIA 2VM2A 3IHQA 1WMJA 4FYBA 1YZXA 1HNCA 1K0OA 9GSSA 3IOSA 4IVFA 5A5HB 4OCFA 2V32A 4OD7A 4RI6A 3HKRA 2WW1A 1ON4A 3DKSA 2VL9A 5JWQB 2PUKC 1ST9A 3UVTA 4IGJA 2MBSA 5EVOA 2LUSA 2WVXA 5CAXA 2EFDA 1ABAA 2WS2A 4XCSA 3NOFA 2LQOA 3FZ5A 4PQIA 3CTGA 1XVQA 4PNFA 4TKYA 5FT3A 4D73B 4N30A 3HD5A 1OVNA 6GSYA 5G5FA 1TRUA 3QOUA 3C7MA 3CSHA 1M2BA 3FZ4A 2JADA 4K2XA 4MCUA 5G2ZA 4G19A 2YV9A 5CO3A 3NZNA 1SVMA 1EWXA 3EPTA 2HLSA 1MTCA 2HZFA 1N2AA 2VCVA 1GUMA 2HRKA 3G7JA 3F8UA 1F6MC 1OE8A 2CX3A 2H6ZA 1PX7A 3CTFA 1AXDA 2AAWA 5AN1A 2HSMB 2NVLA 5CRGA 2H1DA 2H1GA 2EIQA 3P2AA 1TJDA 5GSSA 1AUCA 4POBA 4AJ6A 2LNTA 3UBKA 1XW9A 4TR4A
chains in the Genus database with same CATH topology
2DJKA 4BL7B 1BQ7A 4KAEA 1G0TA 3H79A 1Z3EA 4ZILA 1A2MA 1ZMAA 4OFNA 3ERFA 2JSYA 2V41A 4OWYA 5J3RA 1JFUA 2YWNA 2LKUA 4EIPA 1JHBA 2CZ3A 1THOA 3WGEA 1XWKA 14GSA 1A23A 2E2GA 4WETA 1EOHA 2DIYA 3K8NA 3APQA 1SKSB 4PUAA 3W6GA 4HDEA 4YKFA 5B8BA 4AKXB 1EGOA 1OC9B 4MZWA 4MABA 2HYXA 4HU9A 1JLVA 2H73A 1ZCPA 2RLIA 4ZB7A 5IPGA 3QFAC 3IBHA 4IP1A 3TKSA 2KP1A 3SBCA 4JE1A 4XTSA 4IQAA 3EU4A 1A0FA 2PWJA 4DSRA 1DSBA 2FWEA 2YJHA 1S3AA 2K18A 1Y1UA 3TKSC 5IPHA 4K0GA 3IK7A 2H30A 4ISDA 2VCQA 4LLRA 2KOKA 3LEFA 4TR0A 4BVYB 1TW9A 2PU9C 5AIVA 5AIXA 4I6XA 1GNWA 4XS4A 2GGTA 4NHZA 4PQHA 1M99A 1J0FA 1WWJA 2GLRA 5DBQA 1KEBA 2XC2A 2IFQB 1XIYA 4K9ZA 1K0BA 1XOAA 1A24A 1NHYA 2C4JA 3WGDA 2XPDA 3M8NA 4IJ3A 1K0NA 2GQMA 1SYRA 2Z9SA 4Z2TA 2NTOA 1XFLA 4MJBA 2CVDA 3P8WA 3F3QA 3LW9A 5CYYA 2H71A 1EV4A 4O5RA 4XRDA 3GV1A 4L0WA 2RUFA 5LNKe 2LTKA 1ERTA 2GT6A 4K0NA 2AYTA 5ECOB 2EIRA 3DVXA 4QL9A 1XOBA 3VFIA 2GQKA 3DIEA 4MF5A 2V2GA 2VCZA 3HVVA 4RI7A 3IXRA 2DJ1A 4H86A 4FIWA 5IIZA 1R4WA 1J9BA 5IOWA 4CHSA 3GMFA 2B6MA 1V98A 3HZ8A 3EYTA 1QUWA 2O5VA 1I5GA 2C0GA 1XVWA 3O3TA 1QGVA 2F8FA 2VKZG 4I2UA 1U3AA 4I2TA 3FR3A 1AQWA 1GRXA 1T8EB 1EOGA 1BX9A 5KN3A 1Q98A 2VAFA 3QCPA 1FW1A 5KN1A 4KGIA 2L4CA 2KHPA 2LQQA 2B5XA 1W4VA 4N0ZA 2AB6A 4E8HA 4ML6A 3F6FA 1SYXA 2VLTA 3GSSA 2B5YA 5J5NA 2WB9A 3APSA 3EVIA 5IMAA 3LQ7A 3L78A 2KP2A 4AKIA 2HFDA 3E0UA 2QGVA 2K9FA 5DQYA 3FZ9A 2PN8A 2GSSA 3R2QA 1XCCA 3ED3A 1B9XC 1MDJA 1FB6A 4MH2A 1JZRA 2H75A 4K7IA 4N10A 2VUPA 4GQCA 2FWGA 1XBSA 1T4ZA 2IN3A 3ZREA 2IIYA 1USBA 1SU9A 3TOTA 1U87A 4QMKA 5E59A 2ZCTA 3C71A 3PINA 3GX8A 1LJRA 3HJMA 1ERUA 3TKQA 4KDUA 1R7HA 1ZZYA 1T4YA 3H4KA 3UL3A 1WRYA 3CSJA 4MPFA 3DD3A 1DUGA 4O32A 5EPFA 4RQXA 5DAKA 2DJ0A 2B1KA 1M9AA 4TN8A 5ECKB 4WXTA 1SD8A 4KB3A 4XS6A 2ON5A 2X64A 2P0GA 2V6OA 1M0UA 2PMTA 2HXKA 1RW1A 2JACA 4KCAA 2HSHA 3ZTLA 2QKEA 4AJ7A 1XWBA 3VK9A 2OADA 2P5RA 1A0RP 3CMIA 4TR1A 4NV2A 4OO5A 5F06A 1G7OA 1THXA 1EEJA 1EP8A 12GSA 13GSA 2YV7A 2R37A 1FG4A 1TKDB 3A3TA 1SJZA 4K7NA 1W89A 4NPBA 4MLYA 1OAZA 2H6XA 4TXOB 4O92A 3ZMLA 2F51A 3ZYWA 1MDIA 1GTAA 3FY7A 4OFTA 2ES7A 3ERWA 4PX1A 2OE0A 5ABRA 4KW6A 1PQNA 2IL3A 4BPYA 2DC5A 4PUFC 3HY2A 3GSTA 3KP8A 1LU4A 4NXIA 4GSTA 4MJEA 1PGTA 1K3YA 4TXOA 3BJ5A 1OYJA 1AC1A 4ILFA 1ZYQB 4Q5QA 4FYCA 4AKGA 4G10A 4K2DA 2GDRA 4IQ1A 4GDFA 4HZ2A 1F9MA 2MMNA 2HZEA 3O76A 4KNDA 3KTBA 1ZYPA 2HSNB 2FA8A 1CQGA 2H0GA 3BCIA 3Q19A 4XRAA 4DSSB 2GZYA 2GQLA 5COHA 3IK9A 4HQZA 1TI1A 2DBCA 1T7PB 2MMOA 2C0FA 3ZLPA 3IE3A 2O89A 2YWOA 3P7XA 4MF7A 1R5PA 1FB0A 1B4PA 1GULA 3KTLA 2GSRA 5EL8A 1HNAA 1GTUA 3APOA 5GZZB 2IMKA 3IC8A 2FY6A 4LL4B 1MDKA 4L8EA 6GSXA 3QAWA 5H5QA 1DE1A 5J4YA 1V2AA 3A5IA 2FHEA 2H66A 3W8SA 3DEXA 5D8IA 2JU5A 3EMPA 1YKAA 2L5OA 4ECBA 3I43A 3G7IA 3HXSA 3GKKA 1VF1A 1S3CA 1Z6NA 5B8AA 1BYEA 2HT9A 1JZOA 2HNLA 4J57E 3KIJA 3LXTA 3GKXA 4WBJA 3TJFA 3TJJA 2H74A 2WULA 2CX4A 2C0EA 2YNXA 4QL7A 2OACA 3IV4A 1GSEA 4CW9A 1A2LA 5A34A 3UAPA 2NBSA 4V1Ap 5GSTA 1F3AA 2WFCA 1FOHA 4J2FA 1JZWA 4K6XA 2EFEA 3N9JA 4ZBAA 1GWCA 5F07A 2C3NA 2O7KA 3FK8A 4X43A 5B6MA 3ME8A 3QDNA 1R5AA 4FH8A 3QD9A 1FO5A 4JR4A 5J4UA 1G7EA 1XW5A 4MZBA 4MZCA 2J23A 4RUVA 3ZVJA 22GSA 3CRTA 5FHIA 3D4TA 2HRKB 1T00A 1GLQA 3G9BA 2IMEA 18GSA 3BBYA 1EV9A 5D9XA 1Y25A 2X49A 1GLPA 2GVPA 4TVEA 2YZHA 3F9UA 5HR0A 2HRFA 3KJYA 1TRSA 3DVWA 4EUYA 5D9WA 3GRXA 1UA5A 1O73A 4RQRA 1QMVA 2VCTA 4Q5NA 1GUHA 4EXJA 4YAPA 3L0HA 5ECRB 3FW2A 1GSSA 1PMTA 5IMCA 1XWCA 2R0GA 2JL4A 3BOAA 2LJKA 2M46A 4ECCA 5ECPB 2VD1A 2VO4A 1WE0A 4X4JA 3LG6A 1U6TA 3D6IA 2EIOA 1YEXA 3CXGA 1PL1A 1FOVA 4PGTA 2XPEA 5ELGA 2H72A 3WGXA 1YF0A 1BEDA 1NM3A 2LV3A 4ID0A 4BA7A 4MK3A 5IMFA 3HMJG 3QFBC 3VWXA 3ZRDA 3A5WA 2M72A 3MNGA 1XW6A 3I69A 2K6VA 3E3EA 19GSA 3UOMA 4ZB6A 11GSA 4MMMA 4XS1A 3KZQA 4ZXGA 3US3A 1ML6A 3CSIA 2ZUPA 3MWHA 4ULXA 1X5EA 1OC3A 2PERA 3F4TA 3TJKA 3I6AA 2CT6A 1BG5A 1O6JA 5ECSA 2H6YA 1KNGA 2C8UA 2IPAA 4HOJA 2B5EA 1T3BA 5IM9A 2OE3A 3N5OA 3DRNA 5IMZA 4XS4B 3PGTA 3F4RA 2YP6A 5ENUA 2WCIA 2PPTA 3TUEA 3GTUA 4O5QA 3WT2A 4TOPA 2E0QA 4A5PA 4IJIA 2IMFA 2B7JA 1SL2B 4MA9A 1V57A 4EDYA 3DMLA 1C72A 4IBPA 4HEA2 2PVQA 5J41A 2GT5A 5ELAA 2MZCA 5G30A 5HFGA 3FYGA 2CQ9A 1PN0A 2R4VA 2DIZA 5H5SA 4V2LA 1SJ6A 3D21A 1DE2A 5C00A 4BWQA 2X8GA 4AGSA 2I1UA 4FYUA 4G0LA 4ZB9A 5IQYA 1SVLA 1YDKA 3RBTA 2H1AA 1YEPA 2ALBA 3ZVJD 3TOUA 2HE3A 5DCGA 2H1BA 4EC0A 2DKHA 1K0MA 4KX4A 1GP1A 2BMXA 1TXXA 1TOFA 2LS5A 3TJBA 2I3YA 3ISOA 1I9DA 4USSA 2A4HA 4Z2RA 2L5LA 5DALA 5D93A 3TU3B 5B6NA 2F3MA 4LMVA 4WKWA 4KF9A 1YVLA 1M9BA 2H70A 2FD3A 17GSA 5G5EA 4NHWA 1M2DA 2R3XA 1GTIA 2VLUA 4KE3A 3QR6A 2DJ2A 2C0DA 5G1LA 5LCZA 1R26A 2VD0A 4EF0A 3ERGA 1ZGNA 3QAGA 4YQMA 2B7KA 3H8QA 5ECHB 4GQFA 5F8BA 4KSOA 4PQ1A 2C1YA 2L59A 5ECNB 5BMUA 4W66A 3HVXA 5L71A 1ZL9A 3D5JA 1B9YC 3C1RA 2I4AA 2RIIA 1XPVA 1Z5YE 3FHKA 4ZL9A 4GRFA 2FUG2 3KEBA 1ZYEA 3LJRA 2AJQB 5ID2A 2GZPA 3ZZXA 2A2RA 3ME7A 4JR6A 5KN2A 4K8MA 4CDOA 2CZ2A 5BRTA 1E6BA 3UJ1A 1TI3A 2VCXA 4EL1A 1H4OA 3UIWA 4HU7A 4V2NA 3VWUA 3JCML 5DAKB 3Q18A 2RUEA 1YF1A 2CA8A 3C8EA 3FR6A 2H01A 3TGZA 5JCWA 4Z7XA 3LORA 1EEMA 1QK8A 3Q74A 4MP4A 4ZB8A 3QPMA 1Z7PA 2VOCA 3LYKA 1X5DA 10GSA 3NIVA 5C04A 1FAAA 4EKZA 6GSVA 2IMDA 2UV8G 1A8YA 5IO2A 3IAM2 2AV4A 1GSFA 2QA2A 2PGTA 4TR1B 1BF5A 4GSNA 4BVXA 1N25A 6GSUA 1V58A 5EY6A 2WRTA 3PPUA 2AHEA 3M9KA 4ZBDA 1QXHA 1TDIA 3TKSE 3TKRA 2C80A 2WDUA 4LA1A 2EFCA 1SL1B 3J7Yb 4NWYA 2KLXA 3BD2A 3UMAA 5DJLA 1CQHA 1YKCA 1T1VA 4MPGA 2GS3A 3F0IA 3U5RE 2CV4A 2OJLA 3WYWA 3LGCA 5HR2A 3ZFBA 1V40A 4G0KA 2QC7A 1QQ2A 5J47A 3PR8A 3OR5A 4WEYA 3IRAA 2N5FA 4ZIJA 3IA1A 1ERVA 1O81A 2HZEB 5AISA 2FGXA 1MD3A 2N5BA 4HJ2A 4ECJA 4PTSA 1O8WA 2OT3A 4TR3A 4YKGA 1SJIA 1XWAA 1TK8B 4JRRA 1WJKA 3VI5A 1U88A 4F0BA 2L4QA 1PKZA 2B1LA 6GSTA 4JZQA 4F03A 5ECQB 4LL1B 2HRAA 3HDCA 2C3TA 2E2MA 4ML1A 1B8XA 3CRUA 2AUVA 4IELA 3RAZA 4EDZA 3UBLA 3BCKA 2OA7A 1MEKA 3M9JA 2X99A 2VCWA 3KH9A 2JZTA 4POMA 4AI6A 3RDWA 2VIMA 1QFNA 1FVKA 5LD0A 1NHOA 2OBIA 3VI7A 5J9CA 3TRXA 5DVBA 4TXVA 1OE7A 3HJOA 1X5CA 2L57A 3FMWA 3L4NA 3L9UA 4YQVA 2VL3A 3ZIVA 16GSA 5HR3A 2A2PA 4O5UA 5DJMA 5A34B 3HHVA 4WR4A 3Q6OA 1B4QA 3IHGA 3MDKA 1G6YA 2DJ3A 1EZKA 4WF4A 1AAZA 3E9JB 3UEMA 1Z9HA 4TW5A 1WIKA 4V1Ag 4G01A 3EURA 4YH2A 5DCHA 5F05A 2GTUA 2MMAA 5G31A 1HQOA 2YZUA 1WOUA 5IO0A 4EE0A 4I5QA 3CBUA 5A4WA 3IR4A 2HQTA 3VPQA 2ZNMA 5F0GA 1GTBA 4X1UA 4Q5FA 1A8LA 2O87A 2LRNA 1VRSD 2V1MA 2PBJA 2FLSA 4JBBA 3UVHA 4MJCA 4XHMA 4MNNA 2TRXA 3VLNA 1AIUA 1HNBA 1TK0B 2G2QA 4GF0A 4F2IA 3EWLA 3DYRA 2BJXA 4AKHA 4Z2UA 3FEUA 3GH9A 2R2JA 3GIXA 3TCOA 3KH7A 3GH6A 1TTZA 4CY8A 20GSA 1OKTA 2CAIA 3VWVA 5IMVA 5GAND 4P3YB 1GNEA 1OC8A 5A5HA 5IOXA 5KOXA 4BWSA 5IMDA 4I97A 2BTOT 3HYPA 1GSUA 4WR5A 3GN3A 1E2YA 3EC3A 4DVCA 4AJ8A 4WF5A 3F4SA 2LJAA 4MDCA 1BG1A 3WT1A 4E68A 1BAYA 3GYKA 4KA0A 2NDOA 2NPBA 2VL2A 2WZ9A 1URMA 2XBQA 5CP1A 2ON7A 4N11A 1ILOA 1VF4A 2GZZA 5GAPD 3CYNA 2DKIA 4D73A 2MMZA 2PVOC 1XZOA 2RM6A 1PN9A 2VL2C 3IAS2 2DJJA 3ZMKA 4KDYA 1UN2A 2H0IA 1PD21 2X4AA 1B48A 3QAVA 3FR9A 2IJYA 4NMUA 2EC4A 2I81A 1AW9A 3LWAA 1G6WA 4G0IA 1JZDA 1M7TA 3VPTA 2H19A 3GX0A 4IHUA 4F0CA 4K5SA 3GNJA 1SKRB 3EINA 3D0ZA 2HSMA 1WPIA 2B3SA 2O8VB 4OO4A 1FHEA 4KDXA 3RPPA 3G7YA 3H93A 4MF6A 4YQUA 3KM6A 1K0DA 1PX6A 2DMMA 4E8EA 3WD6A 5HFIA 4BL7A 2KUCA 3IDVA 3GTUB 2DMLA 3KCMA 2FA4A 4XIHA 1SD9A 1H75A 1K3OA 4DEJA 1SENA 2YPMA 1ACVA 3M3MA 1TXUA 1SK1A 3A2XA 3H1NA 1X0RA 1PSQA 5INYA 1OC9A 2YOIA 4GLTA 3ZFLA 2F9SA 3QMXA 1LBKA 4HS1A 5DDLA 5KOWA 2DLXA 4OMVA 3J7Yk 5A4VA 3O6TA 2L6DA 1KTEA 1DBYA 3VURA 1M2AA 5DALB 4MJAA 5G1KA 3ZITA 2LRTA 3KP9A 5CRHA 3U6VA 4GTUA 4GCIA 1J08A 3F3RA 4ZL7A 1TP9A 1GH2A 3UARA 4ZBBA 5ECMB 4BVYA 2R0CA 3DXBA 4J56E 4N3ZA 1HD2A 4NV5A 2JZSA 1RQMA 6GSWA 2V6KA 5D96A 4NAXA 2CAQA 2YJ7A 3C73A 2YCDA 1RK4A 4N0VA 4JEDA 4FQUA 1F37A 1K0CA 2IFQA 4F82A 2M80A 5DQSA 2YWMA 1UVZA 2HI7A 2P31A 3L9VA 3L9SA 4G9HA 3IC4A 2HSYA 3FKFA 2H8LA 1TU7A 5JWOB 4L5LA 2GSTA 2N5AA 5BMUB 2O85A 3MSZA 4KH7A 2C3QA 3IPZA 4IW9A 2H76A 2R0PA 3EMXA 1AQXA 3LFLA 1TRWA 3C1SA 5KN0A 4KUNA 1VGLA 4PXOA 1TRVA 2UZ8A 1X9WB 3KGKA 4GSSA 4ACSA 2K8SA 5ID2B 3TKPA 4EIQA 1O8XA 4KSMA 2JSZA 4QQ7A 3GHAA 2OKAA 5A5KA 1GUKA 2HRNA 2J9HA 5JCGA 1PRXA 3GL5A 1EP7A 1X9SB 3MYDA 4O7HA 1XXUA 3DWVA 1OKDA 1SL0B 2MYGA 1TU8A 1YQ1A 7GSSA 2A2SA 2LEGA 5D9VA 3MIXA 2G0FA 5J40A 4HZ4A 3EE2A 4IKHA 2WGRA 3RHCA 1IYHA 4HJMA 4IN0A 4FO5A 4EO3A 1PL2A 1XWGA 2JZRA 3HVSA 1GL8A 1YY7A 5AGYA 2LJRA 4OFMA 1SK0A 3HJPA 3A2WA 4WBRD 3GURA 5CREA 3LSZA 3GA4A 5D73A 2CVKA 3I9V2 4HUAA 4KCEA 4BVXB 2RM5A 2TRCP 3D4MA 1FVJA 3P90A 4JU5A 3M1GA 1TK5B 2A4VA 2D2ZA 5ECIB 2IWTA 4YAVA 4HI7A 4TRXA 1MD4A 3S9FA 3M0FA 2QSIA 4GXZA 2LSTA 1ERWA 3HA9A 1ZOFA 2R5GA 5A1NB 5D9TA 1Z7RA 4EVMA 2FCHA 1N8JA 2DSAA 5A4UA 2FNOA 4X0XA 3VWWA 3KD0A 3ZIJA 4ICYA 2OE1A 2XHFA 1KBNA 4F9ZA 1VF3A 5E4WA 2TIRA 5B7CA 4IP6A 3KMOA 3F6DA 2IMIA 1WP0A 5A1NA 2YN1A 3KXOA 8GSSA 1SK2A 5CRWA 5HFKA 3D22A 4DSQA 2MBTA 3TB2A 1NSWA 1K3LA 1PA3A 3F63A 5KEJA 1A2JA 1Y6EA 1S3DA 4L0UA 2EFHA 1EGRA 5JWRB 5HQPA 1U3IA 1V9WA 6GSSA 2FWHA 2LNSA 3TRQA 4G2EA 4HQSA 5H5RA 2VLVA 1Z6MA 4POKA 2CVBA 5J4VA 3GL3A 4ECIA 1GSDA 3AY8A 3DGQA 5ECLB 3KMNA 1F2EA 1F3BA 3TRPA 2WJUA 3RHBA 2XBIA 3LXZA 3GFKA 3A2VA 3GKNA 4MH3A 5CNWA 4K5RA 2YANA 1X9MB 1SKWB 2FWFA 4L5OA 4AF2A 2P5QA 3FRCA 3GKMA 4K1FA 3ZL5A 3GUSA 4V2MA 5JCUA 1O85A 1VF2A 4ZL8A 5J9BA 4PNGA 3TJGA 3LYPA 1PKWA 5FWGA 3FZAA 5CRDA 3W8JA 2R6KA 1ZYNA 2X8HA 4CY6A 3MAKA 2K8VA 3EU3A 1GSYA 1JLWA 4LMWA 2L6CA 1YJ6A 1NW2A 4IS0A 3TDGA 4PURA 2E7PA 3V1WA 1Q4JA 1BJXA 2HSNA 3RPNA 2QA1A 3SWLA 1HYUA 4OCEA 2LRCA 3PH9A 4DSSA 2REMA 2H1LA 2GSQA 2OBKA 4K7OA 1UC7A 2H0HA 1AQVA 3HCZA 1SVOA 4POLA 3R3EA 2YWIA 5HR1A 4GWRA 1O7UA 3CWGA 2I9HA 2VM1A 1GSQA 1K0AA 2F8AA 2X8CA 4Q5RA 3HZ4A 4I8BA 1IYIA 2VM2A 3IHQA 1WMJA 4FYBA 1YZXA 1HNCA 1K0OA 9GSSA 3IOSA 4IVFA 5A5HB 4OCFA 2V32A 4OD7A 4RI6A 3HKRA 1ON4A 3DKSA 2VL9A 5JWQB 2PUKC 1ST9A 3UVTA 4IGJA 2MBSA 5EVOA 2LUSA 5CAXA 2EFDA 1ABAA 2WS2A 4XCSA 3NOFA 2LQOA 3FZ5A 4PQIA 3CTGA 1XVQA 4PNFA 4TKYA 5FT3A 4D73B 4N30A 3HD5A 1OVNA 6GSYA 5G5FA 1TRUA 3QOUA 3C7MA 3CSHA 1M2BA 3FZ4A 2JADA 4K2XA 4MCUA 5G2ZA 4G19A 2YV9A 5CO3A 3NZNA 1SVMA 1EWXA 3EPTA 2HLSA 1MTCA 2HZFA 1N2AA 2VCVA 1GUMA 2HRKA 3G7JA 3F8UA 1F6MC 1OE8A 2CX3A 2H6ZA 1PX7A 3CTFA 1AXDA 2AAWA 5AN1A 2HSMB 2NVLA 5CRGA 2H1DA 2H1GA 2EIQA 3P2AA 1TJDA 5GSSA 1AUCA 4POBA 4AJ6A 2LNTA 3UBKA 1XW9A 4TR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJK A;  4BL7 B;  1BQ7 A;  4KAE A;  1G0T A;  3H79 A;  1Z3E A;  4ZIL A;  1A2M A;  1ZMA A;  4OFN A;  3ERF A;  2JSY A;  2V41 A;  4OWY A;  5J3R A;  1JFU A;  2YWN A;  2LKU A;  1JHB A;  2CZ3 A;  1THO A;  3WGE A;  1XWK A;  14GS A;  1A23 A;  2E2G A;  4WET A;  1EOH A;  2DIY A;  3K8N A;  3APQ A;  1SKS B;  4PUA A;  3W6G A;  4HDE A;  5B8B A;  1EGO A;  1OC9 B;  4MZW A;  4MAB A;  2HYX A;  4HU9 A;  1JLV A;  2H73 A;  1ZCP A;  2RLI A;  5IPG A;  3QFA C;  3IBH A;  4IP1 A;  3TKS A;  2KP1 A;  3SBC A;  4JE1 A;  4XTS A;  4IQA A;  3EU4 A;  1A0F A;  2PWJ A;  4DSR A;  1DSB A;  2FWE A;  2YJH A;  1S3A A;  2K18 A;  3TKS C;  5IPH A;  4K0G A;  3IK7 A;  2H30 A;  4ISD A;  2VCQ A;  4LLR A;  2KOK A;  3LEF A;  4TR0 A;  4BVY B;  1TW9 A;  2PU9 C;  5AIV A;  5AIX A;  4I6X A;  1GNW A;  4XS4 A;  2GGT A;  4NHZ A;  4PQH A;  1M99 A;  1J0F A;  1WWJ A;  2GLR A;  5DBQ A;  1KEB A;  2XC2 A;  2IFQ B;  1XIY A;  4K9Z A;  1K0B A;  1XOA A;  1A24 A;  1NHY A;  2C4J A;  3WGD A;  2XPD A;  3M8N A;  4IJ3 A;  1K0N A;  2GQM A;  1SYR A;  2Z9S A;  2NTO A;  1XFL A;  4MJB A;  2CVD A;  3P8W A;  3F3Q A;  5CYY A;  2H71 A;  1EV4 A;  4O5R A;  4XRD A;  3GV1 A;  4L0W A;  2RUF A;  5LNK e;  2LTK A;  1ERT A;  2GT6 A;  4K0N A;  2AYT A;  5ECO B;  2EIR A;  3DVX A;  4QL9 A;  1XOB A;  3VFI A;  2GQK A;  3DIE A;  4MF5 A;  2V2G A;  2VCZ A;  3HVV A;  4RI7 A;  3IXR A;  2DJ1 A;  4H86 A;  4FIW A;  5IIZ A;  1R4W A;  1J9B A;  5IOW A;  4CHS A;  3GMF A;  2B6M A;  1V98 A;  3HZ8 A;  3EYT A;  1QUW A;  1I5G A;  2C0G A;  1XVW A;  3O3T A;  1QGV A;  2F8F A;  4I2U A;  1U3A A;  4I2T A;  3FR3 A;  1AQW A;  1GRX A;  1T8E B;  1EOG A;  1BX9 A;  5KN3 A;  1Q98 A;  2VAF A;  3QCP A;  1FW1 A;  5KN1 A;  4KGI A;  2L4C A;  2KHP A;  2LQQ A;  2B5X A;  1W4V A;  4N0Z A;  2AB6 A;  4E8H A;  4ML6 A;  3F6F A;  1SYX A;  2VLT A;  3GSS A;  2B5Y A;  5J5N A;  2WB9 A;  3APS A;  3EVI A;  5IMA A;  3LQ7 A;  3L78 A;  2KP2 A;  2HFD A;  3E0U A;  2QGV A;  2K9F A;  5DQY A;  3FZ9 A;  2PN8 A;  2GSS A;  3R2Q A;  1XCC A;  3ED3 A;  1B9X C;  1MDJ A;  1FB6 A;  4MH2 A;  1JZR A;  2H75 A;  4K7I A;  4N10 A;  2VUP A;  4GQC A;  2FWG A;  1XBS A;  1T4Z A;  2IN3 A;  3ZRE A;  2IIY A;  1USB A;  1SU9 A;  3TOT A;  1U87 A;  5E59 A;  2ZCT A;  3C71 A;  3PIN A;  3GX8 A;  1LJR A;  3HJM A;  1ERU A;  3TKQ A;  4KDU A;  1R7H A;  1ZZY A;  1T4Y A;  3H4K A;  3UL3 A;  1WRY A;  3CSJ A;  4MPF A;  3DD3 A;  1DUG A;  4O32 A;  5EPF A;  4RQX A;  5DAK A;  2DJ0 A;  2B1K A;  1M9A A;  4TN8 A;  5ECK B;  4WXT A;  1SD8 A;  4KB3 A;  4XS6 A;  2ON5 A;  2X64 A;  2P0G A;  2V6O A;  1M0U A;  2PMT A;  2HXK A;  1RW1 A;  2JAC A;  4KCA A;  2HSH A;  3ZTL A;  2QKE A;  4AJ7 A;  1XWB A;  3VK9 A;  2OAD A;  2P5R A;  1A0R P;  3CMI A;  4TR1 A;  4NV2 A;  4OO5 A;  5F06 A;  1G7O A;  1THX A;  1EEJ A;  1EP8 A;  12GS A;  13GS A;  2YV7 A;  2R37 A;  1FG4 A;  1TKD B;  3A3T A;  1SJZ A;  4K7N A;  1W89 A;  4NPB A;  4MLY A;  1OAZ A;  2H6X A;  4TXO B;  4O92 A;  3ZML A;  2F51 A;  3ZYW A;  1MDI A;  1GTA A;  3FY7 A;  4OFT A;  2ES7 A;  3ERW A;  4PX1 A;  2OE0 A;  5ABR A;  4KW6 A;  1PQN A;  2IL3 A;  4BPY A;  2DC5 A;  4PUF C;  3HY2 A;  3GST A;  3KP8 A;  1LU4 A;  4NXI A;  4GST A;  4MJE A;  1PGT A;  1K3Y A;  4TXO A;  3BJ5 A;  1OYJ A;  1AC1 A;  4ILF A;  1ZYQ B;  4Q5Q A;  4FYC A;  4K2D A;  4G10 A;  2GDR A;  4IQ1 A;  4HZ2 A;  1F9M A;  2MMN A;  2HZE A;  3O76 A;  4KND A;  3KTB A;  2HSN B;  2FA8 A;  1CQG A;  2H0G A;  3BCI A;  3Q19 A;  4XRA A;  4DSS B;  2GZY A;  2GQL A;  5COH A;  3IK9 A;  4HQZ A;  1TI1 A;  2DBC A;  1T7P B;  2MMO A;  2C0F A;  3ZLP A;  3IE3 A;  2O89 A;  2YWO A;  3P7X A;  4MF7 A;  1R5P A;  1FB0 A;  1B4P A;  1GUL A;  3KTL A;  2GSR A;  5EL8 A;  1HNA A;  1GTU A;  3APO A;  5GZZ B;  2IMK A;  3IC8 A;  2FY6 A;  4LL4 B;  1MDK A;  4L8E A;  6GSX A;  3QAW A;  5H5Q A;  1DE1 A;  1V2A A;  2FHE A;  2H66 A;  3W8S A;  3DEX A;  5D8I A;  2JU5 A;  3EMP A;  1YKA A;  2L5O A;  4ECB A;  3I43 A;  3G7I A;  3HXS A;  3GKK A;  1VF1 A;  1S3C A;  1Z6N A;  5B8A A;  1BYE A;  2HT9 A;  1JZO A;  2HNL A;  4J57 E;  3KIJ A;  3LXT A;  3GKX A;  4WBJ A;  3TJF A;  3TJJ A;  2H74 A;  2WUL A;  2CX4 A;  2C0E A;  2YNX A;  4QL7 A;  2OAC A;  3IV4 A;  1GSE A;  4CW9 A;  1A2L A;  2NBS A;  3UAP A;  4V1A p;  5GST A;  1F3A A;  2WFC A;  4J2F A;  1JZW A;  4K6X A;  3N9J A;  4ZBA A;  1GWC A;  5F07 A;  2C3N A;  2O7K A;  3FK8 A;  4X43 A;  5B6M A;  3ME8 A;  3QDN A;  1R5A A;  4FH8 A;  3QD9 A;  1FO5 A;  4JR4 A;  5J4U A;  1G7E A;  1XW5 A;  4MZB A;  4MZC A;  2J23 A;  4RUV A;  3ZVJ A;  22GS A;  3CRT A;  5FHI A;  3D4T A;  2HRK B;  1T00 A;  1GLQ A;  3G9B A;  2IME A;  18GS A;  3BBY A;  1EV9 A;  5D9X A;  1Y25 A;  1GLP A;  2GVP A;  4TVE A;  2YZH A;  3F9U A;  5HR0 A;  2HRF A;  3KJY A;  1TRS A;  3DVW A;  4EUY A;  5D9W A;  3GRX A;  1UA5 A;  1O73 A;  4RQR A;  1QMV A;  2VCT A;  4Q5N A;  1GUH A;  4EXJ A;  4YAP A;  3L0H A;  5ECR B;  3FW2 A;  1GSS A;  1PMT A;  5IMC A;  1XWC A;  2JL4 A;  3BOA A;  2LJK A;  2M46 A;  4ECC A;  5ECP B;  2VD1 A;  2VO4 A;  1WE0 A;  3LG6 A;  1U6T A;  3D6I A;  2EIO A;  1YEX A;  3CXG A;  1PL1 A;  1FOV A;  4PGT A;  2XPE A;  5ELG A;  2H72 A;  3WGX A;  1YF0 A;  1BED A;  1NM3 A;  2LV3 A;  4ID0 A;  4BA7 A;  4MK3 A;  5IMF A;  3QFB C;  3VWX A;  3ZRD A;  3A5W A;  2M72 A;  3MNG A;  1XW6 A;  3I69 A;  2K6V A;  3E3E A;  19GS A;  3UOM A;  4ZB6 A;  11GS A;  4MMM A;  4XS1 A;  3KZQ A;  4ZXG A;  3US3 A;  1ML6 A;  3CSI A;  2ZUP A;  3MWH A;  4ULX A;  1X5E A;  1OC3 A;  2PER A;  3F4T A;  3TJK A;  3I6A A;  2CT6 A;  1BG5 A;  1O6J A;  5ECS A;  2H6Y A;  1KNG A;  2C8U A;  2IPA A;  4HOJ A;  2B5E A;  1T3B A;  5IM9 A;  2OE3 A;  3N5O A;  3DRN A;  5IMZ A;  4XS4 B;  3PGT A;  3F4R A;  2YP6 A;  5ENU A;  2WCI A;  2PPT A;  3TUE A;  3GTU A;  3WT2 A;  4TOP A;  2E0Q A;  4IJI A;  2IMF A;  2B7J A;  1SL2 B;  4MA9 A;  1V57 A;  4EDY A;  3DML A;  1C72 A;  4IBP A;  4HEA 2;  2PVQ A;  5J41 A;  2GT5 A;  5ELA A;  2MZC A;  5G30 A;  5HFG A;  3FYG A;  2CQ9 A;  2R4V A;  2DIZ A;  5H5S A;  4V2L A;  1SJ6 A;  3D21 A;  1DE2 A;  5C00 A;  4BWQ A;  2X8G A;  4AGS A;  2I1U A;  4FYU A;  4G0L A;  4ZB9 A;  5IQY A;  1YDK A;  3RBT A;  2H1A A;  1YEP A;  2ALB A;  3ZVJ D;  3TOU A;  2HE3 A;  5DCG A;  2H1B A;  4EC0 A;  1K0M A;  4KX4 A;  1GP1 A;  2BMX A;  1TXX A;  1TOF A;  2LS5 A;  3TJB A;  2I3Y A;  3ISO A;  1I9D A;  4USS A;  2L5L A;  5DAL A;  5D93 A;  5B6N A;  2F3M A;  4LMV A;  4WKW A;  4KF9 A;  1M9B A;  2H70 A;  2FD3 A;  17GS A;  5G5E A;  4NHW A;  1M2D A;  2R3X A;  1GTI A;  2VLU A;  4KE3 A;  3QR6 A;  2DJ2 A;  2C0D A;  5G1L A;  5LCZ A;  1R26 A;  2VD0 A;  4EF0 A;  3ERG A;  1ZGN A;  3QAG A;  4YQM A;  2B7K A;  3H8Q A;  5ECH B;  4GQF A;  5F8B A;  4KSO A;  4PQ1 A;  2C1Y A;  2L59 A;  5ECN B;  5BMU A;  3HVX A;  5L71 A;  1ZL9 A;  3D5J A;  1B9Y C;  3C1R A;  2I4A A;  2RII A;  1XPV A;  1Z5Y E;  3FHK A;  4ZL9 A;  4GRF A;  2FUG 2;  3KEB A;  1ZYE A;  3LJR A;  2AJQ B;  5ID2 A;  2GZP A;  3ZZX A;  2A2R A;  3ME7 A;  4JR6 A;  5KN2 A;  4K8M A;  4CDO A;  2CZ2 A;  1E6B A;  3UJ1 A;  1TI3 A;  2VCX A;  4EL1 A;  1H4O A;  3UIW A;  4HU7 A;  4V2N A;  3VWU A;  3JCM L;  5DAK B;  3Q18 A;  2RUE A;  1YF1 A;  2CA8 A;  3C8E A;  3FR6 A;  2H01 A;  3TGZ A;  5JCW A;  4Z7X A;  3LOR A;  1EEM A;  1QK8 A;  3Q74 A;  4MP4 A;  4ZB8 A;  3QPM A;  1Z7P A;  2VOC A;  3LYK A;  1X5D A;  10GS A;  3NIV A;  5C04 A;  1FAA A;  4EKZ A;  6GSV A;  2IMD A;  5IO2 A;  1A8Y A;  3IAM 2;  2AV4 A;  1GSF A;  2PGT A;  4TR1 B;  4GSN A;  4BVX A;  6GSU A;  1V58 A;  5EY6 A;  2WRT A;  3PPU A;  2AHE A;  3M9K A;  4ZBD A;  1QXH A;  1TDI A;  3TKS E;  3TKR A;  2C80 A;  2WDU A;  4LA1 A;  1SL1 B;  3J7Y b;  4NWY A;  2KLX A;  3BD2 A;  3UMA A;  5DJL A;  1CQH A;  1YKC A;  1T1V A;  4MPG A;  2GS3 A;  3F0I A;  3U5R E;  2CV4 A;  2OJL A;  3WYW A;  3LGC A;  5HR2 A;  3ZFB A;  1V40 A;  4G0K A;  2QC7 A;  1QQ2 A;  3PR8 A;  3OR5 A;  4WEY A;  3IRA A;  2N5F A;  4ZIJ A;  3IA1 A;  1ERV A;  1O81 A;  2HZE B;  5AIS A;  2FGX A;  1MD3 A;  2N5B A;  4HJ2 A;  4ECJ A;  4PTS A;  1O8W A;  4TR3 A;  1SJI A;  1XWA A;  1TK8 B;  4JRR A;  1WJK A;  3VI5 A;  1U88 A;  4F0B A;  2L4Q A;  1PKZ A;  2B1L A;  6GST A;  4JZQ A;  4F03 A;  5ECQ B;  4LL1 B;  2HRA A;  3HDC A;  2C3T A;  2E2M A;  4ML1 A;  1B8X A;  3CRU A;  2AUV A;  4IEL A;  3RAZ A;  4EDZ A;  3UBL A;  3BCK A;  2OA7 A;  1MEK A;  3M9J A;  2X99 A;  2VCW A;  3KH9 A;  2JZT A;  4POM A;  3RDW A;  2VIM A;  1QFN A;  1FVK A;  5LD0 A;  1NHO A;  2OBI A;  3VI7 A;  5J9C A;  3TRX A;  5DVB A;  4TXV A;  1OE7 A;  3HJO A;  1X5C A;  2L57 A;  3L4N A;  3L9U A;  4YQV A;  2VL3 A;  3ZIV A;  16GS A;  5HR3 A;  5DJM A;  3HHV A;  4WR4 A;  3Q6O A;  1B4Q A;  3MDK A;  1G6Y A;  2DJ3 A;  1EZK A;  4WF4 A;  1AAZ A;  3E9J B;  3UEM A;  1Z9H A;  4TW5 A;  1WIK A;  4V1A g;  3EUR A;  4YH2 A;  5DCH A;  5F05 A;  2GTU A;  2MMA A;  5G31 A;  1HQO A;  2YZU A;  1WOU A;  5IO0 A;  4EE0 A;  4I5Q A;  3CBU A;  5A4W A;  3IR4 A;  2HQT A;  3VPQ A;  2ZNM A;  5F0G A;  1GTB A;  4X1U A;  4Q5F A;  1A8L A;  2O87 A;  2LRN A;  1VRS D;  2V1M A;  2PBJ A;  2FLS A;  4JBB A;  3UVH A;  4MJC A;  4XHM A;  2TRX A;  3VLN A;  1AIU A;  1HNB A;  1TK0 B;  2G2Q A;  4GF0 A;  4F2I A;  3EWL A;  3DYR A;  2BJX A;  3FEU A;  3GH9 A;  2R2J A;  3GIX A;  3TCO A;  3KH7 A;  3GH6 A;  1TTZ A;  20GS A;  1OKT A;  2CAI A;  3VWV A;  5IMV A;  5GAN D;  4P3Y B;  1GNE A;  1OC8 A;  5IOX A;  4BWS A;  5IMD A;  4I97 A;  2BTO T;  3HYP A;  1GSU A;  4WR5 A;  3GN3 A;  1E2Y A;  3EC3 A;  4DVC A;  4AJ8 A;  4WF5 A;  3F4S A;  2LJA A;  4MDC A;  3WT1 A;  1BAY A;  3GYK A;  4KA0 A;  2NDO A;  2NPB A;  2VL2 A;  2WZ9 A;  1URM A;  2XBQ A;  5CP1 A;  2ON7 A;  4N11 A;  1ILO A;  1VF4 A;  2GZZ A;  5GAP D;  3CYN A;  4D73 A;  2MMZ A;  2PVO C;  1XZO A;  2RM6 A;  1PN9 A;  2VL2 C;  3IAS 2;  2DJJ A;  3ZMK A;  4KDY A;  1UN2 A;  2H0I A;  1PD2 1;  1B48 A;  3QAV A;  3FR9 A;  2IJY A;  4NMU A;  2EC4 A;  2I81 A;  1AW9 A;  3LWA A;  1G6W A;  4G0I A;  1JZD A;  1M7T A;  3VPT A;  2H19 A;  3GX0 A;  4IHU A;  4F0C A;  1SKR B;  3GNJ A;  3EIN A;  3D0Z A;  2HSM A;  1WPI A;  2B3S A;  2O8V B;  4OO4 A;  1FHE A;  4KDX A;  3RPP A;  3G7Y A;  3H93 A;  4MF6 A;  4YQU A;  3KM6 A;  1K0D A;  1PX6 A;  2DMM A;  4E8E A;  3WD6 A;  5HFI A;  4BL7 A;  2KUC A;  3IDV A;  3GTU B;  2DML A;  3KCM A;  2FA4 A;  4XIH A;  1SD9 A;  1H75 A;  1K3O A;  4DEJ A;  1SEN A;  2YPM A;  1ACV A;  3M3M A;  1SK1 A;  3A2X A;  3H1N A;  1X0R A;  1PSQ A;  5INY A;  1OC9 A;  2YOI A;  4GLT A;  3ZFL A;  2F9S A;  3QMX A;  1LBK A;  4HS1 A;  5DDL A;  2DLX A;  4OMV A;  3J7Y k;  5A4V A;  3O6T A;  2L6D A;  1KTE A;  1DBY A;  3VUR A;  1M2A A;  5DAL B;  4MJA A;  5G1K A;  3ZIT A;  2LRT A;  3KP9 A;  5CRH A;  3U6V A;  4GTU A;  4GCI A;  1J08 A;  3F3R A;  4ZL7 A;  1TP9 A;  1GH2 A;  3UAR A;  4ZBB A;  5ECM B;  4BVY A;  3DXB A;  4J56 E;  1HD2 A;  4NV5 A;  2JZS A;  1RQM A;  6GSW A;  2V6K A;  5D96 A;  4NAX A;  2CAQ A;  2YJ7 A;  3C73 A;  2YCD A;  1RK4 A;  4N0V A;  4JED A;  4FQU A;  1F37 A;  1K0C A;  2IFQ A;  4F82 A;  2M80 A;  5DQS A;  2YWM A;  1UVZ A;  2HI7 A;  2P31 A;  3L9V A;  3L9S A;  4G9H A;  3IC4 A;  2HSY A;  3FKF A;  2H8L A;  1TU7 A;  5JWO B;  4L5L A;  2GST A;  2N5A A;  2O85 A;  3MSZ A;  4KH7 A;  2C3Q A;  3IPZ A;  4IW9 A;  2H76 A;  3EMX A;  1AQX A;  3LFL A;  1TRW A;  3C1S A;  5KN0 A;  4KUN A;  1VGL A;  4PXO A;  1TRV A;  2UZ8 A;  1X9W B;  3KGK A;  4GSS A;  4ACS A;  2K8S A;  5ID2 B;  3TKP A;  1O8X A;  4KSM A;  2JSZ A;  4QQ7 A;  3GHA A;  2OKA A;  5A5K A;  1GUK A;  2HRN A;  2J9H A;  5JCG A;  1PRX A;  3GL5 A;  1EP7 A;  1X9S B;  4O7H A;  1XXU A;  3DWV A;  1OKD A;  1SL0 B;  2MYG A;  1TU8 A;  1YQ1 A;  7GSS A;  2A2S A;  2LEG A;  5D9V A;  2G0F A;  4HZ4 A;  3EE2 A;  4IKH A;  2WGR A;  3RHC A;  1IYH A;  4IN0 A;  4HJM A;  4FO5 A;  4EO3 A;  1PL2 A;  1XWG A;  2JZR A;  3HVS A;  1GL8 A;  1YY7 A;  5AGY A;  2LJR A;  4OFM A;  1SK0 A;  3HJP A;  3A2W A;  4WBR D;  3GUR A;  5CRE A;  3LSZ A;  3GA4 A;  5D73 A;  2CVK A;  3I9V 2;  4HUA A;  4KCE A;  4BVX B;  2RM5 A;  2TRC P;  3D4M A;  1FVJ A;  3P90 A;  4JU5 A;  3M1G A;  1TK5 B;  2A4V A;  2D2Z A;  5ECI B;  2IWT A;  4YAV A;  4HI7 A;  4TRX A;  1MD4 A;  3S9F A;  3M0F A;  2QSI A;  4GXZ A;  2LST A;  1ERW A;  3HA9 A;  1ZOF A;  2R5G A;  5D9T A;  1Z7R A;  4EVM A;  2FCH A;  1N8J A;  2DSA A;  5A4U A;  2FNO A;  4X0X A;  3VWW A;  3KD0 A;  3ZIJ A;  2OE1 A;  2XHF A;  1KBN A;  4F9Z A;  1VF3 A;  5E4W A;  2TIR A;  5B7C A;  4IP6 A;  3KMO A;  3F6D A;  2IMI A;  1WP0 A;  2YN1 A;  3KXO A;  8GSS A;  1SK2 A;  5CRW A;  5HFK A;  3D22 A;  4DSQ A;  2MBT A;  3TB2 A;  1NSW A;  1K3L A;  1PA3 A;  3F63 A;  5KEJ A;  1A2J A;  1Y6E A;  1S3D A;  4L0U A;  1EGR A;  5JWR B;  5HQP A;  1U3I A;  1V9W A;  6GSS A;  2FWH A;  2LNS A;  3TRQ A;  4G2E A;  4HQS A;  5H5R A;  2VLV A;  1Z6M A;  4POK A;  2CVB A;  3GL3 A;  4ECI A;  1GSD A;  3AY8 A;  3DGQ A;  5ECL B;  3KMN A;  1F2E A;  1F3B A;  3TRP A;  2WJU A;  3RHB A;  2XBI A;  3LXZ A;  3GFK A;  3A2V A;  3GKN A;  4MH3 A;  5CNW A;  2YAN A;  1X9M B;  1SKW B;  2FWF A;  4L5O A;  4AF2 A;  2P5Q A;  3FRC A;  3GKM A;  4K1F A;  3ZL5 A;  3GUS A;  4V2M A;  5JCU A;  1O85 A;  1VF2 A;  4ZL8 A;  5J9B A;  4PNG A;  3TJG A;  3LYP A;  1PKW A;  5FWG A;  3FZA A;  5CRD A;  3W8J A;  2R6K A;  2X8H A;  3MAK A;  2K8V A;  3EU3 A;  1GSY A;  1JLW A;  4LMW A;  2L6C A;  1YJ6 A;  1NW2 A;  4IS0 A;  3TDG A;  4PUR A;  2E7P A;  3V1W A;  1Q4J A;  1BJX A;  3RPN A;  3SWL A;  1HYU A;  4OCE A;  2LRC A;  3PH9 A;  4DSS A;  2REM A;  2GSQ A;  2OBK A;  4K7O A;  1UC7 A;  2H0H A;  1AQV A;  3HCZ A;  4POL A;  3R3E A;  2YWI A;  5HR1 A;  4GWR A;  1O7U A;  2I9H A;  2VM1 A;  1GSQ A;  1K0A A;  2F8A A;  2X8C A;  4Q5R A;  3HZ4 A;  4I8B A;  1IYI A;  2VM2 A;  3IHQ A;  1WMJ A;  4FYB A;  1YZX A;  1HNC A;  1K0O A;  9GSS A;  3IOS A;  4IVF A;  4OCF A;  2V32 A;  4OD7 A;  4RI6 A;  3HKR A;  1ON4 A;  3DKS A;  2VL9 A;  5JWQ B;  2PUK C;  1ST9 A;  3UVT A;  4IGJ A;  2MBS A;  5EVO A;  2LUS A;  5CAX A;  1ABA A;  2WS2 A;  4XCS A;  3NOF A;  2LQO A;  3FZ5 A;  4PQI A;  3CTG A;  1XVQ A;  4PNF A;  4TKY A;  5FT3 A;  4D73 B;  4N30 A;  3HD5 A;  1OVN A;  6GSY A;  5G5F A;  1TRU A;  3QOU A;  3C7M A;  3CSH A;  1M2B A;  3FZ4 A;  2JAD A;  4MCU A;  5G2Z A;  4G19 A;  2YV9 A;  5CO3 A;  3NZN A;  1EWX A;  2HLS A;  1MTC A;  2HZF A;  1N2A A;  2VCV A;  1GUM A;  2HRK A;  3G7J A;  3F8U A;  1F6M C;  1OE8 A;  2CX3 A;  2H6Z A;  1PX7 A;  3CTF A;  1AXD A;  2AAW A;  5AN1 A;  2HSM B;  2NVL A;  5CRG A;  2H1D A;  2H1G A;  2EIQ A;  3P2A A;  1TJD A;  5GSS A;  1AUC A;  4POB A;  4AJ6 A;  2LNT A;  3UBK A;  1XW9 A;  4TR4 A; 
#chains in the Genus database with same CATH topology
 2DJK A;  4BL7 B;  1BQ7 A;  4KAE A;  1G0T A;  3H79 A;  1Z3E A;  4ZIL A;  1A2M A;  1ZMA A;  4OFN A;  3ERF A;  2JSY A;  2V41 A;  4OWY A;  5J3R A;  1JFU A;  2YWN A;  2LKU A;  4EIP A;  1JHB A;  2CZ3 A;  1THO A;  3WGE A;  1XWK A;  14GS A;  1A23 A;  2E2G A;  4WET A;  1EOH A;  2DIY A;  3K8N A;  3APQ A;  1SKS B;  4PUA A;  3W6G A;  4HDE A;  4YKF A;  5B8B A;  4AKX B;  1EGO A;  1OC9 B;  4MZW A;  4MAB A;  2HYX A;  4HU9 A;  1JLV A;  2H73 A;  1ZCP A;  2RLI A;  4ZB7 A;  5IPG A;  3QFA C;  3IBH A;  4IP1 A;  3TKS A;  2KP1 A;  3SBC A;  4JE1 A;  4XTS A;  4IQA A;  3EU4 A;  1A0F A;  2PWJ A;  4DSR A;  1DSB A;  2FWE A;  2YJH A;  1S3A A;  2K18 A;  1Y1U A;  3TKS C;  5IPH A;  4K0G A;  3IK7 A;  1S3R A;  2H30 A;  4ISD A;  2VCQ A;  4LLR A;  2KOK A;  3LEF A;  4TR0 A;  4BVY B;  1TW9 A;  2PU9 C;  5AIV A;  5AIX A;  4I6X A;  1GNW A;  4XS4 A;  2GGT A;  4NHZ A;  4PQH A;  1M99 A;  1J0F A;  1WWJ A;  2GLR A;  5DBQ A;  1KEB A;  2XC2 A;  2IFQ B;  1XIY A;  4K9Z A;  1K0B A;  1XOA A;  1A24 A;  1NHY A;  2C4J A;  3WGD A;  2XPD A;  3M8N A;  4IJ3 A;  1K0N A;  2GQM A;  1SYR A;  2Z9S A;  4Z2T A;  2NTO A;  1XFL A;  4MJB A;  2CVD A;  3P8W A;  3F3Q A;  3LW9 A;  5CYY A;  2H71 A;  1EV4 A;  4O5R A;  4XRD A;  3GV1 A;  4L0W A;  2RUF A;  5LNK e;  2LTK A;  1ERT A;  2GT6 A;  4K0N A;  2AYT A;  5ECO B;  2EIR A;  3DVX A;  4QL9 A;  1XOB A;  3VFI A;  2GQK A;  3DIE A;  4MF5 A;  2V2G A;  2VCZ A;  3HVV A;  4RI7 A;  3IXR A;  2DJ1 A;  4H86 A;  4FIW A;  5IIZ A;  1R4W A;  1J9B A;  5IOW A;  4CHS A;  3GMF A;  2B6M A;  1V98 A;  3HZ8 A;  3EYT A;  1QUW A;  2O5V A;  1I5G A;  2C0G A;  1XVW A;  3O3T A;  1QGV A;  2F8F A;  2VKZ G;  4I2U A;  1U3A A;  4I2T A;  3FR3 A;  1AQW A;  1GRX A;  1T8E B;  1EOG A;  1BX9 A;  5KN3 A;  1Q98 A;  2VAF A;  3QCP A;  1FW1 A;  2WW0 A;  4KGI A;  5KN1 A;  2L4C A;  2KHP A;  2LQQ A;  2B5X A;  1W4V A;  4N0Z A;  2AB6 A;  4E8H A;  4ML6 A;  3F6F A;  1SYX A;  1XG8 A;  2VLT A;  3GSS A;  2B5Y A;  5J5N A;  2WB9 A;  3APS A;  3EVI A;  5IMA A;  3LQ7 A;  3L78 A;  2KP2 A;  4AKI A;  2HFD A;  3E0U A;  2QGV A;  2K9F A;  5DQY A;  3FZ9 A;  2PN8 A;  2GSS A;  3R2Q A;  1XCC A;  3ED3 A;  1B9X C;  1MDJ A;  1FB6 A;  4MH2 A;  1JZR A;  2H75 A;  4K7I A;  4N10 A;  2VUP A;  4GQC A;  2FWG A;  1XBS A;  1T4Z A;  2IN3 A;  3ZRE A;  2IIY A;  1USB A;  1SU9 A;  3TOT A;  1U87 A;  4QMK A;  5E59 A;  2ZCT A;  3C71 A;  3PIN A;  3GX8 A;  1LJR A;  3HJM A;  1ERU A;  3TKQ A;  4KDU A;  1R7H A;  1ZZY A;  1T4Y A;  3H4K A;  3UL3 A;  1WRY A;  3CSJ A;  4MPF A;  3DD3 A;  1DUG A;  4O32 A;  5EPF A;  4RQX A;  5DAK A;  2DJ0 A;  2B1K A;  1M9A A;  4TN8 A;  5ECK B;  4WXT A;  1SD8 A;  4KB3 A;  4XS6 A;  2ON5 A;  2X64 A;  2P0G A;  2V6O A;  1M0U A;  2PMT A;  2HXK A;  1RW1 A;  2JAC A;  4KCA A;  2HSH A;  3ZTL A;  2QKE A;  4AJ7 A;  1XWB A;  3VK9 A;  2OAD A;  2P5R A;  1A0R P;  3CMI A;  4TR1 A;  4NV2 A;  4OO5 A;  5F06 A;  1G7O A;  1THX A;  1EEJ A;  1EP8 A;  12GS A;  13GS A;  2YV7 A;  2R37 A;  1FG4 A;  1TKD B;  3A3T A;  1SJZ A;  4K7N A;  1W89 A;  4NPB A;  4MLY A;  1OAZ A;  2H6X A;  4TXO B;  4O92 A;  3ZML A;  2F51 A;  3ZYW A;  1PFO A;  1MDI A;  1GTA A;  3FY7 A;  1M3I A;  4OFT A;  2ES7 A;  3ERW A;  4PX1 A;  2OE0 A;  5ABR A;  4KW6 A;  1PQN A;  2IL3 A;  4BPY A;  2DC5 A;  4PUF C;  3HY2 A;  3GST A;  3KP8 A;  1LU4 A;  4NXI A;  4GST A;  4MJE A;  1PGT A;  1K3Y A;  4TXO A;  3BJ5 A;  1OYJ A;  1AC1 A;  4ILF A;  1ZYQ B;  4Q5Q A;  4FYC A;  4AKG A;  4G10 A;  4K2D A;  2GDR A;  4IQ1 A;  4GDF A;  4HZ2 A;  1F9M A;  2MMN A;  2HZE A;  3O76 A;  4KND A;  3KTB A;  1ZYP A;  2HSN B;  2FA8 A;  1CQG A;  2H0G A;  3BCI A;  3Q19 A;  4XRA A;  4DSS B;  2GZY A;  2GQL A;  5COH A;  3IK9 A;  4HQZ A;  1TI1 A;  2DBC A;  1T7P B;  2MMO A;  2C0F A;  3ZLP A;  3IE3 A;  2O89 A;  2YWO A;  3P7X A;  4MF7 A;  1R5P A;  1FB0 A;  1B4P A;  1GUL A;  3KTL A;  2GSR A;  5EL8 A;  1HNA A;  3CQF A;  1GTU A;  3APO A;  5GZZ B;  2IMK A;  3IC8 A;  2FY6 A;  4LL4 B;  1MDK A;  4L8E A;  6GSX A;  3QAW A;  5H5Q A;  1DE1 A;  5J4Y A;  1V2A A;  3A5I A;  2FHE A;  2H66 A;  3W8S A;  3DEX A;  5D8I A;  2JU5 A;  3EMP A;  1YKA A;  2L5O A;  4ECB A;  3I43 A;  3G7I A;  3HXS A;  3GKK A;  1VF1 A;  1S3C A;  1Z6N A;  5B8A A;  1BYE A;  2HT9 A;  1JZO A;  2HNL A;  4J57 E;  3KIJ A;  3LXT A;  3GKX A;  4WBJ A;  3TJF A;  3TJJ A;  2H74 A;  2WUL A;  2CX4 A;  2C0E A;  4FXY P;  2YNX A;  4QL7 A;  2OAC A;  3IV4 A;  1GSE A;  4CW9 A;  1A2L A;  5A34 A;  3UAP A;  2NBS A;  4V1A p;  5GST A;  2WVX B;  1F3A A;  2WFC A;  1FOH A;  4J2F A;  1JZW A;  4K6X A;  2EFE A;  3N9J A;  4ZBA A;  1GWC A;  5F07 A;  2C3N A;  2O7K A;  3FK8 A;  4PHZ C;  4X43 A;  5B6M A;  3ME8 A;  3QDN A;  1R5A A;  4FH8 A;  3QD9 A;  1FO5 A;  4JR4 A;  5J4U A;  1G7E A;  1XW5 A;  4MZB A;  4MZC A;  2J23 A;  4RUV A;  3ZVJ A;  22GS A;  3CRT A;  5FHI A;  3D4T A;  2HRK B;  1T00 A;  1GLQ A;  3G9B A;  2IME A;  18GS A;  3BBY A;  1EV9 A;  5D9X A;  1Y25 A;  2X49 A;  1GLP A;  2GVP A;  4TVE A;  2YZH A;  3F9U A;  5HR0 A;  2HRF A;  3KJY A;  1TRS A;  3DVW A;  4EUY A;  5D9W A;  3GRX A;  1UA5 A;  1O73 A;  4RQR A;  1QMV A;  2VCT A;  4Q5N A;  1GUH A;  4EXJ A;  4YAP A;  3L0H A;  5ECR B;  3FW2 A;  1GSS A;  1PMT A;  5IMC A;  1XWC A;  2R0G A;  2JL4 A;  3BOA A;  2LJK A;  2M46 A;  4ECC A;  5ECP B;  2VD1 A;  2VO4 A;  1WE0 A;  4X4J A;  3LG6 A;  1U6T A;  3D6I A;  2EIO A;  1YEX A;  3CXG A;  1PL1 A;  1FOV A;  4PGT A;  2XPE A;  5ELG A;  2H72 A;  3WGX A;  1YF0 A;  1BED A;  1NM3 A;  2LV3 A;  4ID0 A;  4BA7 A;  4MK3 A;  5IMF A;  3HMJ G;  3QFB C;  3VWX A;  3ZRD A;  3A5W A;  2M72 A;  3MNG A;  1XW6 A;  3I69 A;  2K6V A;  3E3E A;  1M3J A;  19GS A;  3UOM A;  4ZB6 A;  11GS A;  4MMM A;  4XS1 A;  3KZQ A;  4ZXG A;  3US3 A;  1ML6 A;  3CSI A;  2ZUP A;  3MWH A;  4ULX A;  1X5E A;  1OC3 A;  2PER A;  3F4T A;  3TJK A;  3I6A A;  2CT6 A;  1BG5 A;  1O6J A;  4PI2 C;  5ECS A;  2H6Y A;  1KNG A;  2C8U A;  2IPA A;  4HOJ A;  2B5E A;  1T3B A;  5IM9 A;  2OE3 A;  3N5O A;  3DRN A;  5IMZ A;  4XS4 B;  3PGT A;  3F4R A;  2YP6 A;  5ENU A;  2WCI A;  2PPT A;  3TUE A;  3GTU A;  4O5Q A;  3WT2 A;  4TOP A;  2E0Q A;  4A5P A;  4IJI A;  2IMF A;  2B7J A;  1SL2 B;  4MA9 A;  1V57 A;  4EDY A;  3DML A;  1C72 A;  4IBP A;  4HEA 2;  2PVQ A;  5J41 A;  2GT5 A;  5ELA A;  2MZC A;  5G30 A;  5HFG A;  3FYG A;  2CQ9 A;  1PN0 A;  2R4V A;  2DIZ A;  5H5S A;  4V2L A;  1SJ6 A;  3D21 A;  1DE2 A;  5C00 A;  4BWQ A;  2X8G A;  4AGS A;  2I1U A;  4FYU A;  4G0L A;  4ZB9 A;  5IQY A;  1SVL A;  1YDK A;  3RBT A;  2H1A A;  1YEP A;  2ALB A;  3ZVJ D;  3TOU A;  2HE3 A;  5DCG A;  2H1B A;  4EC0 A;  2DKH A;  1K0M A;  4KX4 A;  1GP1 A;  2BMX A;  1TXX A;  1TOF A;  2LS5 A;  3TJB A;  2I3Y A;  3ISO A;  1I9D A;  4USS A;  2A4H A;  4Z2R A;  2L5L A;  5DAL A;  5D93 A;  3TU3 B;  5B6N A;  2F3M A;  4LMV A;  4WKW A;  4KF9 A;  1YVL A;  1M9B A;  2H70 A;  2FD3 A;  17GS A;  5G5E A;  4NHW A;  1M2D A;  2R3X A;  1GTI A;  2VLU A;  4KE3 A;  3QR6 A;  2DJ2 A;  2C0D A;  5G1L A;  5LCZ A;  1R26 A;  2VD0 A;  4EF0 A;  3ERG A;  4PI0 C;  1ZGN A;  3QAG A;  4YQM A;  2B7K A;  3H8Q A;  5ECH B;  4GQF A;  5F8B A;  4KSO A;  4PQ1 A;  2C1Y A;  2L59 A;  5ECN B;  5BMU A;  2WVY A;  4W66 A;  3HVX A;  5L71 A;  1ZL9 A;  3D5J A;  1B9Y C;  3C1R A;  2I4A A;  2RII A;  1XPV A;  1Z5Y E;  3FHK A;  4ZL9 A;  4GRF A;  2FUG 2;  3KEB A;  1ZYE A;  3LJR A;  2AJQ B;  5ID2 A;  2GZP A;  1S4B P;  3ZZX A;  2A2R A;  3ME7 A;  4JR6 A;  5KN2 A;  4K8M A;  4CDO A;  2CZ2 A;  5BRT A;  1E6B A;  3UJ1 A;  1TI3 A;  2VCX A;  4EL1 A;  1H4O A;  3UIW A;  4HU7 A;  4V2N A;  3VWU A;  3JCM L;  5DAK B;  3Q18 A;  2RUE A;  1YF1 A;  2CA8 A;  3C8E A;  3FR6 A;  2H01 A;  3TGZ A;  5JCW A;  4Z7X A;  3LOR A;  1EEM A;  1QK8 A;  3Q74 A;  4MP4 A;  4ZB8 A;  3QPM A;  1Z7P A;  2VOC A;  3LYK A;  1X5D A;  10GS A;  3NIV A;  5C04 A;  1FAA A;  4EKZ A;  6GSV A;  2IMD A;  2UV8 G;  1A8Y A;  5IO2 A;  3IAM 2;  2AV4 A;  1GSF A;  2QA2 A;  2PGT A;  4TR1 B;  1BF5 A;  4GSN A;  4BVX A;  4BIK A;  1N25 A;  6GSU A;  1V58 A;  5EY6 A;  2WRT A;  3PPU A;  2AHE A;  3M9K A;  4ZBD A;  1QXH A;  1TDI A;  3TKS E;  3TKR A;  2C80 A;  2WDU A;  4LA1 A;  2EFC A;  1SL1 B;  3J7Y b;  4NWY A;  2KLX A;  3BD2 A;  3UMA A;  5DJL A;  1CQH A;  1YKC A;  1T1V A;  4MPG A;  2GS3 A;  3F0I A;  3U5R E;  2CV4 A;  2OJL A;  3WYW A;  3LGC A;  5HR2 A;  3ZFB A;  1V40 A;  4G0K A;  2QC7 A;  1QQ2 A;  5J47 A;  3PR8 A;  3OR5 A;  4WEY A;  3IRA A;  2N5F A;  4ZIJ A;  3IA1 A;  1ERV A;  1O81 A;  2HZE B;  5AIS A;  2FGX A;  1MD3 A;  2N5B A;  4HJ2 A;  4ECJ A;  4PTS A;  1O8W A;  2OT3 A;  4TR3 A;  4YKG A;  1SJI A;  1XWA A;  1TK8 B;  4JRR A;  1WJK A;  3RFR C;  3VI5 A;  1U88 A;  4F0B A;  2L4Q A;  1PKZ A;  2B1L A;  6GST A;  4JZQ A;  4F03 A;  5ECQ B;  4LL1 B;  2HRA A;  3HDC A;  2C3T A;  2E2M A;  4ML1 A;  1B8X A;  3CRU A;  2AUV A;  4IEL A;  3HVN A;  4EDZ A;  3RAZ A;  3UBL A;  3BCK A;  2OA7 A;  1MEK A;  3M9J A;  2X99 A;  2VCW A;  3KH9 A;  2JZT A;  4POM A;  4AI6 A;  3RDW A;  2VIM A;  1QFN A;  1FVK A;  5LD0 A;  1NHO A;  2OBI A;  3VI7 A;  5J9C A;  3TRX A;  5DVB A;  4TXV A;  1OE7 A;  3HJO A;  1X5C A;  2L57 A;  3FMW A;  3L4N A;  3L9U A;  4YQV A;  2VL3 A;  3ZIV A;  16GS A;  5HR3 A;  2A2P A;  4O5U A;  5DJM A;  5A34 B;  3HHV A;  4WR4 A;  3Q6O A;  1B4Q A;  3IHG A;  3MDK A;  1G6Y A;  2DJ3 A;  1EZK A;  4WF4 A;  1AAZ A;  3E9J B;  3UEM A;  1Z9H A;  4TW5 A;  1WIK A;  4V1A g;  4G01 A;  3EUR A;  4YH2 A;  5DCH A;  5F05 A;  2GTU A;  2MMA A;  5G31 A;  1HQO A;  2YZU A;  1WOU A;  5IO0 A;  4EE0 A;  4I5Q A;  3CBU A;  5A4W A;  3IR4 A;  2HQT A;  3VPQ A;  2ZNM A;  5F0G A;  1GTB A;  4X1U A;  4Q5F A;  1A8L A;  2O87 A;  2LRN A;  1VRS D;  2V1M A;  2PBJ A;  2FLS A;  4JBB A;  3UVH A;  4MJC A;  4XHM A;  4MNN A;  2TRX A;  3VLN A;  1AIU A;  1HNB A;  1TK0 B;  2G2Q A;  4GF0 A;  4F2I A;  3EWL A;  3DYR A;  2BJX A;  4AKH A;  4Z2U A;  3FEU A;  3GH9 A;  2R2J A;  3GIX A;  3TCO A;  3KH7 A;  3GH6 A;  1TTZ A;  4CY8 A;  1YEW C;  20GS A;  1OKT A;  2CAI A;  3VWV A;  5IMV A;  5GAN D;  4P3Y B;  1GNE A;  1OC8 A;  5A5H A;  5IOX A;  5KOX A;  4BWS A;  5IMD A;  4I97 A;  2BTO T;  3HYP A;  1GSU A;  4WR5 A;  3GN3 A;  1E2Y A;  3EC3 A;  4DVC A;  4AJ8 A;  4WF5 A;  3F4S A;  2LJA A;  4MDC A;  1BG1 A;  3WT1 A;  4E68 A;  1BAY A;  3GYK A;  4KA0 A;  2NDO A;  2NPB A;  2VL2 A;  2WZ9 A;  1URM A;  2XBQ A;  5CP1 A;  2ON7 A;  4N11 A;  1ILO A;  1VF4 A;  2GZZ A;  5GAP D;  3CYN A;  2DKI A;  4D73 A;  2MMZ A;  2PVO C;  1XZO A;  2RM6 A;  1PN9 A;  2VL2 C;  3IAS 2;  2DJJ A;  3ZMK A;  4KDY A;  1UN2 A;  2H0I A;  1PD2 1;  2X4A A;  1B48 A;  3QAV A;  3FR9 A;  2WW2 A;  2IJY A;  4NMU A;  2EC4 A;  2I81 A;  1AW9 A;  3LWA A;  1G6W A;  4G0I A;  1JZD A;  1M7T A;  3VPT A;  2H19 A;  3GX0 A;  4IHU A;  4F0C A;  4K5S A;  3GNJ A;  1SKR B;  3EIN A;  3D0Z A;  2HSM A;  1WPI A;  2B3S A;  2O8V B;  4OO4 A;  1FHE A;  4KDX A;  3RPP A;  3G7Y A;  3H93 A;  4MF6 A;  4YQU A;  3KM6 A;  1K0D A;  1PX6 A;  2DMM A;  4E8E A;  3WD6 A;  5HFI A;  4BL7 A;  2KUC A;  3IDV A;  3GTU B;  2DML A;  3KCM A;  2FA4 A;  4XIH A;  1SD9 A;  1H75 A;  1K3O A;  4DEJ A;  1SEN A;  2YPM A;  1ACV A;  3M3M A;  1TXU A;  1SK1 A;  3A2X A;  3H1N A;  1X0R A;  1PSQ A;  5INY A;  1OC9 A;  2YOI A;  4GLT A;  3ZFL A;  2F9S A;  3QMX A;  2WVZ A;  1LBK A;  4HS1 A;  5DDL A;  5KOW A;  2DLX A;  4OMV A;  3J7Y k;  5A4V A;  3O6T A;  2L6D A;  1KTE A;  1DBY A;  3VUR A;  1M2A A;  5DAL B;  4MJA A;  5G1K A;  3ZIT A;  2LRT A;  3KP9 A;  5CRH A;  3U6V A;  4GTU A;  4GCI A;  1J08 A;  3F3R A;  4ZL7 A;  1TP9 A;  1GH2 A;  4HSC X;  3UAR A;  4ZBB A;  5ECM B;  2O36 A;  4BVY A;  2R0C A;  3DXB A;  4J56 E;  4N3Z A;  1HD2 A;  4NV5 A;  2JZS A;  1RQM A;  6GSW A;  2V6K A;  5D96 A;  4NAX A;  2CAQ A;  2YJ7 A;  3C73 A;  2YCD A;  1RK4 A;  4N0V A;  4JED A;  4FQU A;  1F37 A;  1K0C A;  2IFQ A;  4F82 A;  2M80 A;  5DQS A;  2YWM A;  1UVZ A;  2HI7 A;  2P31 A;  3L9V A;  3L9S A;  4G9H A;  3IC4 A;  2HSY A;  3FKF A;  2H8L A;  1TU7 A;  5JWO B;  4L5L A;  2GST A;  2N5A A;  5BMU B;  2O85 A;  3MSZ A;  4KH7 A;  2C3Q A;  3IPZ A;  4IW9 A;  2H76 A;  2R0P A;  3EMX A;  1AQX A;  3LFL A;  1TRW A;  3C1S A;  5KN0 A;  4KUN A;  1VGL A;  4PXO A;  1TRV A;  2UZ8 A;  1X9W B;  3KGK A;  4GSS A;  4ACS A;  2K8S A;  5ID2 B;  3TKP A;  4EIQ A;  1O8X A;  4KSM A;  2JSZ A;  4QQ7 A;  3GHA A;  2OKA A;  5A5K A;  1GUK A;  2HRN A;  2J9H A;  5JCG A;  1PRX A;  3GL5 A;  1EP7 A;  1X9S B;  3MYD A;  4O7H A;  1XXU A;  3DWV A;  1OKD A;  1SL0 B;  2MYG A;  1TU8 A;  1YQ1 A;  7GSS A;  2A2S A;  3CHX C;  2LEG A;  5D9V A;  3MIX A;  2G0F A;  5J40 A;  4HZ4 A;  3EE2 A;  4IKH A;  2WGR A;  3RHC A;  1IYH A;  4HJM A;  4IN0 A;  4FO5 A;  4EO3 A;  1PL2 A;  1XWG A;  2JZR A;  3HVS A;  1GL8 A;  1YY7 A;  5AGY A;  2LJR A;  4OFM A;  1SK0 A;  3HJP A;  3A2W A;  4WBR D;  3GUR A;  3RGB C;  5CRE A;  3LSZ A;  3GA4 A;  5D73 A;  2CVK A;  3I9V 2;  4HUA A;  4KCE A;  4BVX B;  2RM5 A;  2TRC P;  3D4M A;  1FVJ A;  3P90 A;  4JU5 A;  3M1G A;  1TK5 B;  2A4V A;  2D2Z A;  5ECI B;  2IWT A;  4YAV A;  4HI7 A;  4TRX A;  1MD4 A;  3S9F A;  3M0F A;  2QSI A;  4GXZ A;  2LST A;  1ERW A;  3HA9 A;  1ZOF A;  2R5G A;  5A1N B;  5D9T A;  1Z7R A;  4EVM A;  2FCH A;  1N8J A;  2DSA A;  5A4U A;  2FNO A;  4X0X A;  3VWW A;  3KD0 A;  3ZIJ A;  4ICY A;  2OE1 A;  2XHF A;  1KBN A;  4F9Z A;  1VF3 A;  5E4W A;  2TIR A;  5B7C A;  4IP6 A;  3KMO A;  3F6D A;  2IMI A;  1WP0 A;  5A1N A;  2YN1 A;  3KXO A;  8GSS A;  1SK2 A;  5CRW A;  5HFK A;  3D22 A;  4DSQ A;  2MBT A;  3TB2 A;  1NSW A;  1K3L A;  1PA3 A;  3F63 A;  5KEJ A;  1A2J A;  1Y6E A;  1S3D A;  4L0U A;  2EFH A;  1EGR A;  5JWR B;  5HQP A;  1U3I A;  1V9W A;  6GSS A;  2FWH A;  2LNS A;  3TRQ A;  4G2E A;  4HQS A;  5H5R A;  2VLV A;  1Z6M A;  4POK A;  2CVB A;  5J4V A;  3GL3 A;  4ECI A;  1GSD A;  2WZS A;  3AY8 A;  3DGQ A;  5ECL B;  3KMN A;  1F2E A;  1F3B A;  3TRP A;  2WW3 A;  2WJU A;  3RHB A;  2XBI A;  2O3E A;  3LXZ A;  3GFK A;  3A2V A;  3GKN A;  4MH3 A;  5CNW A;  1I1I P;  4K5R A;  2YAN A;  1X9M B;  1SKW B;  2FWF A;  4L5O A;  4AF2 A;  2P5Q A;  3FRC A;  3GKM A;  4K1F A;  3ZL5 A;  3GUS A;  4V2M A;  5JCU A;  1O85 A;  1VF2 A;  4ZL8 A;  5J9B A;  4PNG A;  3TJG A;  3LYP A;  1PKW A;  5FWG A;  3FZA A;  5CRD A;  3W8J A;  2R6K A;  1ZYN A;  2X8H A;  4CY6 A;  3MAK A;  2K8V A;  3EU3 A;  1GSY A;  1JLW A;  4LMW A;  2L6C A;  1YJ6 A;  1NW2 A;  4IS0 A;  3TDG A;  4PUR A;  2E7P A;  3V1W A;  1Q4J A;  1BJX A;  2HSN A;  3RPN A;  2QA1 A;  3SWL A;  1HYU A;  4OCE A;  2LRC A;  3PH9 A;  4DSS A;  2REM A;  2H1L A;  2GSQ A;  2OBK A;  4K7O A;  1UC7 A;  2H0H A;  1AQV A;  3HCZ A;  1SVO A;  4POL A;  3R3E A;  2YWI A;  5HR1 A;  4GWR A;  1O7U A;  3CWG A;  2I9H A;  2VM1 A;  1GSQ A;  1K0A A;  2F8A A;  2X8C A;  4Q5R A;  3HZ4 A;  4I8B A;  1IYI A;  2VM2 A;  3IHQ A;  1WMJ A;  4FYB A;  1YZX A;  1HNC A;  1K0O A;  9GSS A;  3IOS A;  4IVF A;  5A5H B;  4OCF A;  2V32 A;  4OD7 A;  4RI6 A;  3HKR A;  2WW1 A;  1ON4 A;  3DKS A;  2VL9 A;  5JWQ B;  2PUK C;  1ST9 A;  3UVT A;  4IGJ A;  2MBS A;  5EVO A;  2LUS A;  2WVX A;  5CAX A;  2EFD A;  1ABA A;  2WS2 A;  4XCS A;  3NOF A;  2LQO A;  3FZ5 A;  4PQI A;  3CTG A;  1XVQ A;  4PNF A;  4TKY A;  5FT3 A;  4D73 B;  4N30 A;  3HD5 A;  1OVN A;  6GSY A;  5G5F A;  1TRU A;  3QOU A;  3C7M A;  3CSH A;  1M2B A;  3FZ4 A;  2JAD A;  4K2X A;  4MCU A;  5G2Z A;  4G19 A;  2YV9 A;  5CO3 A;  3NZN A;  1SVM A;  1EWX A;  3EPT A;  2HLS A;  1MTC A;  2HZF A;  1N2A A;  2VCV A;  1GUM A;  2HRK A;  3G7J A;  3F8U A;  1F6M C;  1OE8 A;  2CX3 A;  2H6Z A;  1PX7 A;  3CTF A;  1AXD A;  2AAW A;  5AN1 A;  2HSM B;  2NVL A;  5CRG A;  2H1D A;  2H1G A;  2EIQ A;  3P2A A;  1TJD A;  5GSS A;  1AUC A;  4POB A;  4AJ6 A;  2LNT A;  3UBK A;  1XW9 A;  4TR4 A; 
#chains in the Genus database with same CATH homology
 2DJK A;  4BL7 B;  1BQ7 A;  4KAE A;  1G0T A;  3H79 A;  1Z3E A;  4ZIL A;  1A2M A;  1ZMA A;  4OFN A;  3ERF A;  2JSY A;  2V41 A;  4OWY A;  5J3R A;  1JFU A;  2YWN A;  2LKU A;  4EIP A;  1JHB A;  2CZ3 A;  1THO A;  3WGE A;  1XWK A;  14GS A;  1A23 A;  2E2G A;  4WET A;  1EOH A;  2DIY A;  3K8N A;  3APQ A;  1SKS B;  4PUA A;  3W6G A;  4HDE A;  4YKF A;  5B8B A;  4AKX B;  1EGO A;  1OC9 B;  4MZW A;  4MAB A;  2HYX A;  4HU9 A;  1JLV A;  2H73 A;  1ZCP A;  2RLI A;  4ZB7 A;  5IPG A;  3QFA C;  3IBH A;  4IP1 A;  3TKS A;  2KP1 A;  3SBC A;  4JE1 A;  4XTS A;  4IQA A;  3EU4 A;  1A0F A;  2PWJ A;  4DSR A;  1DSB A;  2FWE A;  2YJH A;  1S3A A;  2K18 A;  1Y1U A;  3TKS C;  5IPH A;  4K0G A;  3IK7 A;  2H30 A;  4ISD A;  2VCQ A;  4LLR A;  2KOK A;  3LEF A;  4TR0 A;  4BVY B;  1TW9 A;  2PU9 C;  5AIV A;  5AIX A;  4I6X A;  1GNW A;  4XS4 A;  2GGT A;  4NHZ A;  4PQH A;  1M99 A;  1J0F A;  1WWJ A;  2GLR A;  5DBQ A;  1KEB A;  2XC2 A;  2IFQ B;  1XIY A;  4K9Z A;  1K0B A;  1XOA A;  1A24 A;  1NHY A;  2C4J A;  3WGD A;  2XPD A;  3M8N A;  4IJ3 A;  1K0N A;  2GQM A;  1SYR A;  2Z9S A;  4Z2T A;  2NTO A;  1XFL A;  4MJB A;  2CVD A;  3P8W A;  3F3Q A;  3LW9 A;  5CYY A;  2H71 A;  1EV4 A;  4O5R A;  4XRD A;  3GV1 A;  4L0W A;  2RUF A;  5LNK e;  2LTK A;  1ERT A;  2GT6 A;  4K0N A;  2AYT A;  5ECO B;  2EIR A;  3DVX A;  4QL9 A;  1XOB A;  3VFI A;  2GQK A;  3DIE A;  4MF5 A;  2V2G A;  2VCZ A;  3HVV A;  4RI7 A;  3IXR A;  2DJ1 A;  4H86 A;  4FIW A;  5IIZ A;  1R4W A;  1J9B A;  5IOW A;  4CHS A;  3GMF A;  2B6M A;  1V98 A;  3HZ8 A;  3EYT A;  1QUW A;  2O5V A;  1I5G A;  2C0G A;  1XVW A;  3O3T A;  1QGV A;  2F8F A;  2VKZ G;  4I2U A;  1U3A A;  4I2T A;  3FR3 A;  1AQW A;  1GRX A;  1T8E B;  1EOG A;  1BX9 A;  5KN3 A;  1Q98 A;  2VAF A;  3QCP A;  1FW1 A;  5KN1 A;  4KGI A;  2L4C A;  2KHP A;  2LQQ A;  2B5X A;  1W4V A;  4N0Z A;  2AB6 A;  4E8H A;  4ML6 A;  3F6F A;  1SYX A;  2VLT A;  3GSS A;  2B5Y A;  5J5N A;  2WB9 A;  3APS A;  3EVI A;  5IMA A;  3LQ7 A;  3L78 A;  2KP2 A;  4AKI A;  2HFD A;  3E0U A;  2QGV A;  2K9F A;  5DQY A;  3FZ9 A;  2PN8 A;  2GSS A;  3R2Q A;  1XCC A;  3ED3 A;  1B9X C;  1MDJ A;  1FB6 A;  4MH2 A;  1JZR A;  2H75 A;  4K7I A;  4N10 A;  2VUP A;  4GQC A;  2FWG A;  1XBS A;  1T4Z A;  2IN3 A;  3ZRE A;  2IIY A;  1USB A;  1SU9 A;  3TOT A;  1U87 A;  4QMK A;  5E59 A;  2ZCT A;  3C71 A;  3PIN A;  3GX8 A;  1LJR A;  3HJM A;  1ERU A;  3TKQ A;  4KDU A;  1R7H A;  1ZZY A;  1T4Y A;  3H4K A;  3UL3 A;  1WRY A;  3CSJ A;  4MPF A;  3DD3 A;  1DUG A;  4O32 A;  5EPF A;  4RQX A;  5DAK A;  2DJ0 A;  2B1K A;  1M9A A;  4TN8 A;  5ECK B;  4WXT A;  1SD8 A;  4KB3 A;  4XS6 A;  2ON5 A;  2X64 A;  2P0G A;  2V6O A;  1M0U A;  2PMT A;  2HXK A;  1RW1 A;  2JAC A;  4KCA A;  2HSH A;  3ZTL A;  2QKE A;  4AJ7 A;  1XWB A;  3VK9 A;  2OAD A;  2P5R A;  1A0R P;  3CMI A;  4TR1 A;  4NV2 A;  4OO5 A;  5F06 A;  1G7O A;  1THX A;  1EEJ A;  1EP8 A;  12GS A;  13GS A;  2YV7 A;  2R37 A;  1FG4 A;  1TKD B;  3A3T A;  1SJZ A;  4K7N A;  1W89 A;  4NPB A;  4MLY A;  1OAZ A;  2H6X A;  4TXO B;  4O92 A;  3ZML A;  2F51 A;  3ZYW A;  1MDI A;  1GTA A;  3FY7 A;  4OFT A;  2ES7 A;  3ERW A;  4PX1 A;  2OE0 A;  5ABR A;  4KW6 A;  1PQN A;  2IL3 A;  4BPY A;  2DC5 A;  4PUF C;  3HY2 A;  3GST A;  3KP8 A;  1LU4 A;  4NXI A;  4GST A;  4MJE A;  1PGT A;  1K3Y A;  4TXO A;  3BJ5 A;  1OYJ A;  1AC1 A;  4ILF A;  1ZYQ B;  4Q5Q A;  4FYC A;  4AKG A;  4G10 A;  4K2D A;  2GDR A;  4IQ1 A;  4GDF A;  4HZ2 A;  1F9M A;  2MMN A;  2HZE A;  3O76 A;  4KND A;  3KTB A;  1ZYP A;  2HSN B;  2FA8 A;  1CQG A;  2H0G A;  3BCI A;  3Q19 A;  4XRA A;  4DSS B;  2GZY A;  2GQL A;  5COH A;  3IK9 A;  4HQZ A;  1TI1 A;  2DBC A;  1T7P B;  2MMO A;  2C0F A;  3ZLP A;  3IE3 A;  2O89 A;  2YWO A;  3P7X A;  4MF7 A;  1R5P A;  1FB0 A;  1B4P A;  1GUL A;  3KTL A;  2GSR A;  5EL8 A;  1HNA A;  1GTU A;  3APO A;  5GZZ B;  2IMK A;  3IC8 A;  2FY6 A;  4LL4 B;  1MDK A;  4L8E A;  6GSX A;  3QAW A;  5H5Q A;  1DE1 A;  5J4Y A;  1V2A A;  3A5I A;  2FHE A;  2H66 A;  3W8S A;  3DEX A;  5D8I A;  2JU5 A;  3EMP A;  1YKA A;  2L5O A;  4ECB A;  3I43 A;  3G7I A;  3HXS A;  3GKK A;  1VF1 A;  1S3C A;  1Z6N A;  5B8A A;  1BYE A;  2HT9 A;  1JZO A;  2HNL A;  4J57 E;  3KIJ A;  3LXT A;  3GKX A;  4WBJ A;  3TJF A;  3TJJ A;  2H74 A;  2WUL A;  2CX4 A;  2C0E A;  2YNX A;  4QL7 A;  2OAC A;  3IV4 A;  1GSE A;  4CW9 A;  1A2L A;  5A34 A;  3UAP A;  2NBS A;  4V1A p;  5GST A;  1F3A A;  2WFC A;  1FOH A;  4J2F A;  1JZW A;  4K6X A;  2EFE A;  3N9J A;  4ZBA A;  1GWC A;  5F07 A;  2C3N A;  2O7K A;  3FK8 A;  4X43 A;  5B6M A;  3ME8 A;  3QDN A;  1R5A A;  4FH8 A;  3QD9 A;  1FO5 A;  4JR4 A;  5J4U A;  1G7E A;  1XW5 A;  4MZB A;  4MZC A;  2J23 A;  4RUV A;  3ZVJ A;  22GS A;  3CRT A;  5FHI A;  3D4T A;  2HRK B;  1T00 A;  1GLQ A;  3G9B A;  2IME A;  18GS A;  3BBY A;  1EV9 A;  5D9X A;  1Y25 A;  2X49 A;  1GLP A;  2GVP A;  4TVE A;  2YZH A;  3F9U A;  5HR0 A;  2HRF A;  3KJY A;  1TRS A;  3DVW A;  4EUY A;  5D9W A;  3GRX A;  1UA5 A;  1O73 A;  4RQR A;  1QMV A;  2VCT A;  4Q5N A;  1GUH A;  4EXJ A;  4YAP A;  3L0H A;  5ECR B;  3FW2 A;  1GSS A;  1PMT A;  5IMC A;  1XWC A;  2R0G A;  2JL4 A;  3BOA A;  2LJK A;  2M46 A;  4ECC A;  5ECP B;  2VD1 A;  2VO4 A;  1WE0 A;  4X4J A;  3LG6 A;  1U6T A;  3D6I A;  2EIO A;  1YEX A;  3CXG A;  1PL1 A;  1FOV A;  4PGT A;  2XPE A;  5ELG A;  2H72 A;  3WGX A;  1YF0 A;  1BED A;  1NM3 A;  2LV3 A;  4ID0 A;  4BA7 A;  4MK3 A;  5IMF A;  3HMJ G;  3QFB C;  3VWX A;  3ZRD A;  3A5W A;  2M72 A;  3MNG A;  1XW6 A;  3I69 A;  2K6V A;  3E3E A;  19GS A;  3UOM A;  4ZB6 A;  11GS A;  4MMM A;  4XS1 A;  3KZQ A;  4ZXG A;  3US3 A;  1ML6 A;  3CSI A;  2ZUP A;  3MWH A;  4ULX A;  1X5E A;  1OC3 A;  2PER A;  3F4T A;  3TJK A;  3I6A A;  2CT6 A;  1BG5 A;  1O6J A;  5ECS A;  2H6Y A;  1KNG A;  2C8U A;  2IPA A;  4HOJ A;  2B5E A;  1T3B A;  5IM9 A;  2OE3 A;  3N5O A;  3DRN A;  5IMZ A;  4XS4 B;  3PGT A;  3F4R A;  2YP6 A;  5ENU A;  2WCI A;  2PPT A;  3TUE A;  3GTU A;  4O5Q A;  3WT2 A;  4TOP A;  2E0Q A;  4A5P A;  4IJI A;  2IMF A;  2B7J A;  1SL2 B;  4MA9 A;  1V57 A;  4EDY A;  3DML A;  1C72 A;  4IBP A;  4HEA 2;  2PVQ A;  5J41 A;  2GT5 A;  5ELA A;  2MZC A;  5G30 A;  5HFG A;  3FYG A;  2CQ9 A;  1PN0 A;  2R4V A;  2DIZ A;  5H5S A;  4V2L A;  1SJ6 A;  3D21 A;  1DE2 A;  5C00 A;  4BWQ A;  2X8G A;  4AGS A;  2I1U A;  4FYU A;  4G0L A;  4ZB9 A;  5IQY A;  1SVL A;  1YDK A;  3RBT A;  2H1A A;  1YEP A;  2ALB A;  3ZVJ D;  3TOU A;  2HE3 A;  5DCG A;  2H1B A;  4EC0 A;  2DKH A;  1K0M A;  4KX4 A;  1GP1 A;  2BMX A;  1TXX A;  1TOF A;  2LS5 A;  3TJB A;  2I3Y A;  3ISO A;  1I9D A;  4USS A;  2A4H A;  4Z2R A;  2L5L A;  5DAL A;  5D93 A;  3TU3 B;  5B6N A;  2F3M A;  4LMV A;  4WKW A;  4KF9 A;  1YVL A;  1M9B A;  2H70 A;  2FD3 A;  17GS A;  5G5E A;  4NHW A;  1M2D A;  2R3X A;  1GTI A;  2VLU A;  4KE3 A;  3QR6 A;  2DJ2 A;  2C0D A;  5G1L A;  5LCZ A;  1R26 A;  2VD0 A;  4EF0 A;  3ERG A;  1ZGN A;  3QAG A;  4YQM A;  2B7K A;  3H8Q A;  5ECH B;  4GQF A;  5F8B A;  4KSO A;  4PQ1 A;  2C1Y A;  2L59 A;  5ECN B;  5BMU A;  4W66 A;  3HVX A;  5L71 A;  1ZL9 A;  3D5J A;  1B9Y C;  3C1R A;  2I4A A;  2RII A;  1XPV A;  1Z5Y E;  3FHK A;  4ZL9 A;  4GRF A;  2FUG 2;  3KEB A;  1ZYE A;  3LJR A;  2AJQ B;  5ID2 A;  2GZP A;  3ZZX A;  2A2R A;  3ME7 A;  4JR6 A;  5KN2 A;  4K8M A;  4CDO A;  2CZ2 A;  5BRT A;  1E6B A;  3UJ1 A;  1TI3 A;  2VCX A;  4EL1 A;  1H4O A;  3UIW A;  4HU7 A;  4V2N A;  3VWU A;  3JCM L;  5DAK B;  3Q18 A;  2RUE A;  1YF1 A;  2CA8 A;  3C8E A;  3FR6 A;  2H01 A;  3TGZ A;  5JCW A;  4Z7X A;  3LOR A;  1EEM A;  1QK8 A;  3Q74 A;  4MP4 A;  4ZB8 A;  3QPM A;  1Z7P A;  2VOC A;  3LYK A;  1X5D A;  10GS A;  3NIV A;  5C04 A;  1FAA A;  4EKZ A;  6GSV A;  2IMD A;  2UV8 G;  1A8Y A;  5IO2 A;  3IAM 2;  2AV4 A;  1GSF A;  2QA2 A;  2PGT A;  4TR1 B;  1BF5 A;  4GSN A;  4BVX A;  1N25 A;  6GSU A;  1V58 A;  5EY6 A;  2WRT A;  3PPU A;  2AHE A;  3M9K A;  4ZBD A;  1QXH A;  1TDI A;  3TKS E;  3TKR A;  2C80 A;  2WDU A;  4LA1 A;  2EFC A;  1SL1 B;  3J7Y b;  4NWY A;  2KLX A;  3BD2 A;  3UMA A;  5DJL A;  1CQH A;  1YKC A;  1T1V A;  4MPG A;  2GS3 A;  3F0I A;  3U5R E;  2CV4 A;  2OJL A;  3WYW A;  3LGC A;  5HR2 A;  3ZFB A;  1V40 A;  4G0K A;  2QC7 A;  1QQ2 A;  5J47 A;  3PR8 A;  3OR5 A;  4WEY A;  3IRA A;  2N5F A;  4ZIJ A;  3IA1 A;  1ERV A;  1O81 A;  2HZE B;  5AIS A;  2FGX A;  1MD3 A;  2N5B A;  4HJ2 A;  4ECJ A;  4PTS A;  1O8W A;  2OT3 A;  4TR3 A;  4YKG A;  1SJI A;  1XWA A;  1TK8 B;  4JRR A;  1WJK A;  3VI5 A;  1U88 A;  4F0B A;  2L4Q A;  1PKZ A;  2B1L A;  6GST A;  4JZQ A;  4F03 A;  5ECQ B;  4LL1 B;  2HRA A;  3HDC A;  2C3T A;  2E2M A;  4ML1 A;  1B8X A;  3CRU A;  2AUV A;  4IEL A;  3RAZ A;  4EDZ A;  3UBL A;  3BCK A;  2OA7 A;  1MEK A;  3M9J A;  2X99 A;  2VCW A;  3KH9 A;  2JZT A;  4POM A;  4AI6 A;  3RDW A;  2VIM A;  1QFN A;  1FVK A;  5LD0 A;  1NHO A;  2OBI A;  3VI7 A;  5J9C A;  3TRX A;  5DVB A;  4TXV A;  1OE7 A;  3HJO A;  1X5C A;  2L57 A;  3FMW A;  3L4N A;  3L9U A;  4YQV A;  2VL3 A;  3ZIV A;  16GS A;  5HR3 A;  2A2P A;  4O5U A;  5DJM A;  5A34 B;  3HHV A;  4WR4 A;  3Q6O A;  1B4Q A;  3IHG A;  3MDK A;  1G6Y A;  2DJ3 A;  1EZK A;  4WF4 A;  1AAZ A;  3E9J B;  3UEM A;  1Z9H A;  4TW5 A;  1WIK A;  4V1A g;  4G01 A;  3EUR A;  4YH2 A;  5DCH A;  5F05 A;  2GTU A;  2MMA A;  5G31 A;  1HQO A;  2YZU A;  1WOU A;  5IO0 A;  4EE0 A;  4I5Q A;  3CBU A;  5A4W A;  3IR4 A;  2HQT A;  3VPQ A;  2ZNM A;  5F0G A;  1GTB A;  4X1U A;  4Q5F A;  1A8L A;  2O87 A;  2LRN A;  1VRS D;  2V1M A;  2PBJ A;  2FLS A;  4JBB A;  3UVH A;  4MJC A;  4XHM A;  4MNN A;  2TRX A;  3VLN A;  1AIU A;  1HNB A;  1TK0 B;  2G2Q A;  4GF0 A;  4F2I A;  3EWL A;  3DYR A;  2BJX A;  4AKH A;  4Z2U A;  3FEU A;  3GH9 A;  2R2J A;  3GIX A;  3TCO A;  3KH7 A;  3GH6 A;  1TTZ A;  4CY8 A;  20GS A;  1OKT A;  2CAI A;  3VWV A;  5IMV A;  5GAN D;  4P3Y B;  1GNE A;  1OC8 A;  5A5H A;  5IOX A;  5KOX A;  4BWS A;  5IMD A;  4I97 A;  2BTO T;  3HYP A;  1GSU A;  4WR5 A;  3GN3 A;  1E2Y A;  3EC3 A;  4DVC A;  4AJ8 A;  4WF5 A;  3F4S A;  2LJA A;  4MDC A;  1BG1 A;  3WT1 A;  4E68 A;  1BAY A;  3GYK A;  4KA0 A;  2NDO A;  2NPB A;  2VL2 A;  2WZ9 A;  1URM A;  2XBQ A;  5CP1 A;  2ON7 A;  4N11 A;  1ILO A;  1VF4 A;  2GZZ A;  5GAP D;  3CYN A;  2DKI A;  4D73 A;  2MMZ A;  2PVO C;  1XZO A;  2RM6 A;  1PN9 A;  2VL2 C;  3IAS 2;  2DJJ A;  3ZMK A;  4KDY A;  1UN2 A;  2H0I A;  1PD2 1;  2X4A A;  1B48 A;  3QAV A;  3FR9 A;  2IJY A;  4NMU A;  2EC4 A;  2I81 A;  1AW9 A;  3LWA A;  1G6W A;  4G0I A;  1JZD A;  1M7T A;  3VPT A;  2H19 A;  3GX0 A;  4IHU A;  4F0C A;  4K5S A;  3GNJ A;  1SKR B;  3EIN A;  3D0Z A;  2HSM A;  1WPI A;  2B3S A;  2O8V B;  4OO4 A;  1FHE A;  4KDX A;  3RPP A;  3G7Y A;  3H93 A;  4MF6 A;  4YQU A;  3KM6 A;  1K0D A;  1PX6 A;  2DMM A;  4E8E A;  3WD6 A;  5HFI A;  4BL7 A;  2KUC A;  3IDV A;  3GTU B;  2DML A;  3KCM A;  2FA4 A;  4XIH A;  1SD9 A;  1H75 A;  1K3O A;  4DEJ A;  1SEN A;  2YPM A;  1ACV A;  3M3M A;  1TXU A;  1SK1 A;  3A2X A;  3H1N A;  1X0R A;  1PSQ A;  5INY A;  1OC9 A;  2YOI A;  4GLT A;  3ZFL A;  2F9S A;  3QMX A;  1LBK A;  4HS1 A;  5DDL A;  5KOW A;  2DLX A;  4OMV A;  3J7Y k;  5A4V A;  3O6T A;  2L6D A;  1KTE A;  1DBY A;  3VUR A;  1M2A A;  5DAL B;  4MJA A;  5G1K A;  3ZIT A;  2LRT A;  3KP9 A;  5CRH A;  3U6V A;  4GTU A;  4GCI A;  1J08 A;  3F3R A;  4ZL7 A;  1TP9 A;  1GH2 A;  3UAR A;  4ZBB A;  5ECM B;  4BVY A;  2R0C A;  3DXB A;  4J56 E;  4N3Z A;  1HD2 A;  4NV5 A;  2JZS A;  1RQM A;  6GSW A;  2V6K A;  5D96 A;  4NAX A;  2CAQ A;  2YJ7 A;  3C73 A;  2YCD A;  1RK4 A;  4N0V A;  4JED A;  4FQU A;  1F37 A;  1K0C A;  2IFQ A;  4F82 A;  2M80 A;  5DQS A;  2YWM A;  1UVZ A;  2HI7 A;  2P31 A;  3L9V A;  3L9S A;  4G9H A;  3IC4 A;  2HSY A;  3FKF A;  2H8L A;  1TU7 A;  5JWO B;  4L5L A;  2GST A;  2N5A A;  5BMU B;  2O85 A;  3MSZ A;  4KH7 A;  2C3Q A;  3IPZ A;  4IW9 A;  2H76 A;  2R0P A;  3EMX A;  1AQX A;  3LFL A;  1TRW A;  3C1S A;  5KN0 A;  4KUN A;  1VGL A;  4PXO A;  1TRV A;  2UZ8 A;  1X9W B;  3KGK A;  4GSS A;  4ACS A;  2K8S A;  5ID2 B;  3TKP A;  4EIQ A;  1O8X A;  4KSM A;  2JSZ A;  4QQ7 A;  3GHA A;  2OKA A;  5A5K A;  1GUK A;  2HRN A;  2J9H A;  5JCG A;  1PRX A;  3GL5 A;  1EP7 A;  1X9S B;  3MYD A;  4O7H A;  1XXU A;  3DWV A;  1OKD A;  1SL0 B;  2MYG A;  1TU8 A;  1YQ1 A;  7GSS A;  2A2S A;  2LEG A;  5D9V A;  3MIX A;  2G0F A;  5J40 A;  4HZ4 A;  3EE2 A;  4IKH A;  2WGR A;  3RHC A;  1IYH A;  4HJM A;  4IN0 A;  4FO5 A;  4EO3 A;  1PL2 A;  1XWG A;  2JZR A;  3HVS A;  1GL8 A;  1YY7 A;  5AGY A;  2LJR A;  4OFM A;  1SK0 A;  3HJP A;  3A2W A;  4WBR D;  3GUR A;  5CRE A;  3LSZ A;  3GA4 A;  5D73 A;  2CVK A;  3I9V 2;  4HUA A;  4KCE A;  4BVX B;  2RM5 A;  2TRC P;  3D4M A;  1FVJ A;  3P90 A;  4JU5 A;  3M1G A;  1TK5 B;  2A4V A;  2D2Z A;  5ECI B;  2IWT A;  4YAV A;  4HI7 A;  4TRX A;  1MD4 A;  3S9F A;  3M0F A;  2QSI A;  4GXZ A;  2LST A;  1ERW A;  3HA9 A;  1ZOF A;  2R5G A;  5A1N B;  5D9T A;  1Z7R A;  4EVM A;  2FCH A;  1N8J A;  2DSA A;  5A4U A;  2FNO A;  4X0X A;  3VWW A;  3KD0 A;  3ZIJ A;  4ICY A;  2OE1 A;  2XHF A;  1KBN A;  4F9Z A;  1VF3 A;  5E4W A;  2TIR A;  5B7C A;  4IP6 A;  3KMO A;  3F6D A;  2IMI A;  1WP0 A;  5A1N A;  2YN1 A;  3KXO A;  8GSS A;  1SK2 A;  5CRW A;  5HFK A;  3D22 A;  4DSQ A;  2MBT A;  3TB2 A;  1NSW A;  1K3L A;  1PA3 A;  3F63 A;  5KEJ A;  1A2J A;  1Y6E A;  1S3D A;  4L0U A;  2EFH A;  1EGR A;  5JWR B;  5HQP A;  1U3I A;  1V9W A;  6GSS A;  2FWH A;  2LNS A;  3TRQ A;  4G2E A;  4HQS A;  5H5R A;  2VLV A;  1Z6M A;  4POK A;  2CVB A;  5J4V A;  3GL3 A;  4ECI A;  1GSD A;  3AY8 A;  3DGQ A;  5ECL B;  3KMN A;  1F2E A;  1F3B A;  3TRP A;  2WJU A;  3RHB A;  2XBI A;  3LXZ A;  3GFK A;  3A2V A;  3GKN A;  4MH3 A;  5CNW A;  4K5R A;  2YAN A;  1X9M B;  1SKW B;  2FWF A;  4L5O A;  4AF2 A;  2P5Q A;  3FRC A;  3GKM A;  4K1F A;  3ZL5 A;  3GUS A;  4V2M A;  5JCU A;  1O85 A;  1VF2 A;  4ZL8 A;  5J9B A;  4PNG A;  3TJG A;  3LYP A;  1PKW A;  5FWG A;  3FZA A;  5CRD A;  3W8J A;  2R6K A;  1ZYN A;  2X8H A;  4CY6 A;  3MAK A;  2K8V A;  3EU3 A;  1GSY A;  1JLW A;  4LMW A;  2L6C A;  1YJ6 A;  1NW2 A;  4IS0 A;  3TDG A;  4PUR A;  2E7P A;  3V1W A;  1Q4J A;  1BJX A;  2HSN A;  3RPN A;  2QA1 A;  3SWL A;  1HYU A;  4OCE A;  2LRC A;  3PH9 A;  4DSS A;  2REM A;  2H1L A;  2GSQ A;  2OBK A;  4K7O A;  1UC7 A;  2H0H A;  1AQV A;  3HCZ A;  1SVO A;  4POL A;  3R3E A;  2YWI A;  5HR1 A;  4GWR A;  1O7U A;  3CWG A;  2I9H A;  2VM1 A;  1GSQ A;  1K0A A;  2F8A A;  2X8C A;  4Q5R A;  3HZ4 A;  4I8B A;  1IYI A;  2VM2 A;  3IHQ A;  1WMJ A;  4FYB A;  1YZX A;  1HNC A;  1K0O A;  9GSS A;  3IOS A;  4IVF A;  5A5H B;  4OCF A;  2V32 A;  4OD7 A;  4RI6 A;  3HKR A;  1ON4 A;  3DKS A;  2VL9 A;  5JWQ B;  2PUK C;  1ST9 A;  3UVT A;  4IGJ A;  2MBS A;  5EVO A;  2LUS A;  5CAX A;  2EFD A;  1ABA A;  2WS2 A;  4XCS A;  3NOF A;  2LQO A;  3FZ5 A;  4PQI A;  3CTG A;  1XVQ A;  4PNF A;  4TKY A;  5FT3 A;  4D73 B;  4N30 A;  3HD5 A;  1OVN A;  6GSY A;  5G5F A;  1TRU A;  3QOU A;  3C7M A;  3CSH A;  1M2B A;  3FZ4 A;  2JAD A;  4K2X A;  4MCU A;  5G2Z A;  4G19 A;  2YV9 A;  5CO3 A;  3NZN A;  1SVM A;  1EWX A;  3EPT A;  2HLS A;  1MTC A;  2HZF A;  1N2A A;  2VCV A;  1GUM A;  2HRK A;  3G7J A;  3F8U A;  1F6M C;  1OE8 A;  2CX3 A;  2H6Z A;  1PX7 A;  3CTF A;  1AXD A;  2AAW A;  5AN1 A;  2HSM B;  2NVL A;  5CRG A;  2H1D A;  2H1G A;  2EIQ A;  3P2A A;  1TJD A;  5GSS A;  1AUC A;  4POB A;  4AJ6 A;  2LNT A;  3UBK A;  1XW9 A;  4TR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...