5B7CA

Crystal structure of octopus s-crystallin q108f mutant in complex with glutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
214
structure length
206
Chain Sequence
PSYTLHYFNHRGRAEICRMLFAAAGVQYNDRRIESSEWDSMRNKMPCHMMPMLELDNRTQIPQSMAMARYLAREFGFHGRNNMEMARVDFISDCFYDILDDYMRMYFDGNCRMMFSSEKRMRFQETCRRILPFMERTLEMYSGGSQYFMGDQMTMADMMCYCALENPLMEEPSMLSSYPKLMALRNRVMNHSKMSSYLQRRCRTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-crystallin OctvuS4
publication title Structure of a Highly Active Cephalopod S-crystallin Mutant: New Molecular Evidence for Evolution from an Active Enzyme into Lens-Refractive Protein
doi rcsb
source organism Octopus vulgaris
molecule tags Structural protein
total genus 69
structure length 206
sequence length 214
ec nomenclature
pdb deposition date 2016-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5b7cA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5b7cA01
2VCTA 2C1YA 3CYNA 2HRNA 3JCML 5H5SA 1WMJA 3LXZA 4IN0A 5H5RA 2YOIA 4J56E 2CVKA 5IMZA 2L5OA 4XS4B 5INYA 4ECCA 4JBBA 4WBJA 4O7HA 3QD9A 5IO2A 4AJ7A 4JEDA 3CTGA 1Z7RA 5D9TA 2TIRA 1EV4A 2DMLA 4KA0A 3ME7A 1XW5A 3F6DA 1AIUA 3IAM2 3S9FA 4FQUA 3F3RA 2WGRA 3VK9A 1K0BA 4K0GA 2B5EA 2DJ0A 3A3TA 2QKEA 2WRTA 5H5QA 5E59A 4JRRA 2I9HA 5HQPA 1JLVA 5G31A 2L59A 4ZILA 4G19A 4MMMA 1FOVA 1K0OA 1G7EA 1HQOA 4BVXB 2IIYA 3PGTA 4PTSA 2L4CA 2IMIA 2AV4A 2VM2A 1TK8B 4GXZA 2FLSA 3DMLA 4F9ZA 4F0CA 1G6WA 2REMA 2B5XA 4BA7A 2GZZA 4N0ZA 1XPVA 3I43A 2VLTA 3TCOA 4BVYA 5AIXA 4WBRD 1JZOA 3EC3A 1F37A 4V2NA 2I3YA 4ZB9A 3D6IA 3GSTA 2DBCA 3GX8A 2V41A 1FVJA 5CAXA 2GQMA 1LU4A 3TJKA 4PNGA 2HSMA 4NAXA 4GQCA 1TU7A 1A8YA 1KEBA 2H1AA 4RI7A 5JWQB 1WP0A 4V1Ap 2XC2A 2P5RA 2L5LA 6GSWA 1XWCA 3EINA 2EIRA 1GNEA 1N2AA 1OC8A 4PXOA 2X8HA 5F8BA 4IJIA 1Z3EA 3IXRA 4HDEA 2B1KA 2GSSA 4XS6A 2VL2C 1X9MB 1B4PA 1J9BA 1XFLA 4HS1A 3E0UA 4Z7XA 1FHEA 5ECNB 2V6KA 2AUVA 2RLIA 3FEUA 3ERWA 1THOA 4CW9A 4TVEA 4JZQA 1IYHA 3KMNA 1PKWA 3BCKA 3F4TA 1THXA 1Z9HA 1X5DA 2V1MA 2PBJA 2RM5A 4ZL7A 1M2AA 3NOFA 1YEXA 2YPMA 5ECLB 4ULXA 3GYKA 12GSA 3F4SA 4PQ1A 4KSOA 2VCXA 1Y25A 2ON7A 5J9CA 1SJ6A 1SK2A 4IQ1A 4IJ3A 5KEJA 4OWYA 3L0HA 2YZHA 2KP2A 5B8AA 4NXIA 2C0EA 2OBKA 1N8JA 2R3XA 2CVBA 3GHAA 2VUPA 2IN3A 5EPFA 2AAWA 3GN3A 4IP6A 2RUEA 2DJ2A 3UEMA 1O81A 2O8VB 5IMVA 1FVKA 2QSIA 1AUCA 10GSA 1K3YA 3J7Yb 3M1GA 1J08A 4DSSB 3LSZA 5AGYA 3GIXA 2WZ9A 3H8QA 1BG5A 1TTZA 3EU3A 3TJBA 2GTUA 4DEJA 1EWXA 3GV1A 5ID2B 3EWLA 4D73B 1SK0A 3ZVJD 4HI7A 4OFNA 4MABA 4IKHA 2VCVA 4TR1A 3ZLPA 4KDXA 4ILFA 2VCWA 1MEKA 1TK0B 1UVZA 5G5FA 5DDLA 3ZREA 4O5RA 4L8EA 1Q4JA 4KH7A 1UA5A 4XIHA 2DC5A 1DSBA 1V57A 3IRAA 3GTUB 3KGKA 1A24A 3FR3A 1BEDA 1GSUA 5FT3A 1M2DA 4ID0A 3IK9A 1V98A 3DVXA 4IW9A 4TN8A 1SJZA 4MK3A 4I97A 5IOWA 4MPGA 1BJXA 4BWQA 3LYPA 3W8JA 1JHBA 5ELGA 2J23A 1GSDA 4ZBAA 4EE0A 5J41A 4L5OA 4E8HA 2O87A 2V2GA 1SL0B 4PNFA 4KF9A 1HNBA 2DLXA 4XRDA 4Q5FA 2OKAA 2FA4A 1XWAA 3C7MA 2HNLA 4HJMA 1TKDB 5G5EA 4J2FA 2GS3A 1FO5A 1XVQA 3L4NA 1F6MC 6GSUA 4TR3A 4DSRA 2GT6A 2GVPA 1TP9A 3TKSC 2RIIA 1OC9B 3ZIJA 2JU5A 2WS2A 1MDKA 2XPEA 4PX1A 3HHVA 1TXXA 1A23A 1RK4A 5IO0A 1OVNA 4JR4A 4ZL8A 2HSNB 1QMVA 2GZYA 2IMDA 3W8SA 4F2IA 4FYUA 2OE0A 2JZTA 4OO5A 4TXOA 1YY7A 3AY8A 2AYTA 2H1BA 3D5JA 5A4VA 2X8GA 3R2QA 3CRUA 1QUWA 3L9UA 3F9UA 3IR4A 2N5AA 3E3EA 1SENA 2LQQA 2DJ3A 5CRDA 1YJ6A 3HKRA 5ECKB 5GSSA 4OFTA 1ZZYA 1RQMA 2PVOC 4MJEA 2K18A 5HR2A 1U3AA 2IMEA 2TRCP 2HZEB 4P3YB 4N10A 3TJFA 4N11A 2N5BA 2YWNA 5ECMB 1GSYA 2LJAA 3P8WA 1PKZA 2GSTA 4G9HA 2X99A 4N30A 4IP1A 5HR3A 3GFKA 1PRXA 5D96A 3GL3A 3HD5A 1A8LA 2M72A 3C8EA 4EVMA 1GUKA 3CRTA 2JZRA 1E6BA 1OE8A 20GSA 2FA8A 1K0NA 4F82A 1PSQA 2YP6A 5IMFA 2O7KA 2C8UA 4I8BA 2D2ZA 2ZCTA 4ZB8A 1WPIA 1AXDA 1T4ZA 2C80A 3HJMA 1GSQA 1ERWA 3DEXA 2IFQB 5AISA 3D22A 2OE3A 2MMAA 1LBKA 1SYXA 1DBYA 4PUAA 3FZAA 2IMKA 4TOPA 4JE1A 2GLRA 4PGTA 3RPPA 2VD0A 1ACVA 19GSA 1Z6MA 1IYIA 1XCCA 3IDVA 3M0FA 2WFCA 3FYGA 3ERGA 1VGLA 2HT9A 2WJUA 2L6CA 3C73A 4MJCA 5FHIA 5DAKA 2H76A 3RBTA 2CX3A 3TKSE 3F63A 1GULA 3VWXA 4Q5RA 4YQMA 2AB6A 2H8LA 3F3QA 3I9V2 3APSA 2YWMA 5CREA 3ISOA 3TJJA 4IQAA 2MYGA 3KP9A 4KDUA 2HSHA 2PU9C 2V6OA 4MA9A 3FHKA 3L9SA 3I6AA 2FGXA 2G2QA 2KP1A 4OMVA 1GWCA 1MTCA 1ON4A 5BMUA 2VOCA 1OKDA 3J7Yk 3IAS2 2XBQA 3TJGA 4QQ7A 5HFIA 1EEJA 2MBTA 5JWOB 1ML6A 1GSSA 2FWFA 4AGSA 3VWVA 3EURA 5CNWA 4TW5A 1B8XA 2E2MA 3RHBA 4MDCA 2VAFA 3CSJA 4ZB6A 4L5LA 1RW1A 4AF2A 1YF1A 3HJPA 1ZGNA 3APOA 4YQVA 5CRWA 4FO5A 3GH9A 3GKNA 5D93A 2J9HA 4WETA 2BMXA 4IS0A 5ECQB 1SU9A 3M8NA 2CZ3A 3DRNA 4NPBA 1VF1A 1QGVA 1A0RP 1S3AA 1O85A 3O76A 2HZFA 4KX4A 2RUFA 6GSXA 2KOKA 4MF5A 5C00A 1W4VA 3HXSA 3MAKA 5IPHA 4NV2A 2O85A 4POLA 3QOUA 4F03A 2G0FA 4XS4A 1GL8A 5CRHA 3KEBA 4TKYA 4IBPA 5ECRB 3VI7A 2VM1A 2HRKB 3TOUA 3TRQA 1A2LA 1EP8A 1V9WA 1XWKA 3GSSA 1JZWA 4GSSA 1OC3A 3DD3A 2KUCA 1ILOA 3KH9A 3LWAA 4QL9A 1R7HA 3KM6A 3CMIA 4E8EA 2VL9A 1ERVA 2HE3A 4WF5A 2Z9SA 4G0LA 2HQTA 3A5WA 4K7IA 4X43A 1PX6A 4RQXA 3BOAA 3DYRA 2LRNA 3GKXA 2WB9A 3H79A 1EGRA 4BVXA 3ZIVA 1V2AA 2M80A 2CA8A 4MH2A 2GDRA 4YH2A 3OR5A 3DKSA 1BAYA 5G1LA 5E4WA 2H72A 4MLYA 3MNGA 2PMTA 4EC0A 3LQ7A 5CRGA 1T1VA 5J5NA 3ZZXA 1S3CA 4EL1A 3UBLA 3UVHA 6GSYA 5DJMA 3KZQA 5D9VA 4GCIA 4POMA 2H1DA 1GTAA 4PQIA 3WGEA 1CQGA 2B1LA 4N0VA 2H0IA 1AC1A 5L71A 3P7XA 2I1UA 3HZ8A 3TKPA 1M9AA 2DJ1A 2GSRA 3KH7A 4PURA 3IC8A 6GSTA 3GKMA 1BYEA 2P0GA 1SKRB 4HZ2A 3TRXA 1J0FA 3BBYA 2H75A 3GKKA 2KLXA 3KJYA 2LRTA 2LSTA 3GMFA 2X64A 3D4MA 2B5YA 2NDOA 5IMAA 4G10A 1H75A 3ERFA 5HFKA 4TRXA 3FKFA 1T4YA 4LL4B 4K7NA 2OE1A 1PX7A 1F3BA 4PQHA 2FY6A 5DVBA 2AJQB 1WE0A 4OD7A 3ZFLA 1H4OA 2VIMA 5G30A 3FZ5A 2LUSA 3UAPA 3QCPA 4KCAA 3VI5A 1YKCA 4MPFA 4EF0A 2FHEA 4MJBA 4IGJA 2YWOA 4KGIA 2E7PA 2EIQA 3DWVA 2LRCA 3EMPA 4XHMA 1AQVA 1DE2A 4HZ4A 1NHYA 2YN1A 1ZYEA 2H71A 2QC7A 2E2GA 4GF0A 5EVOA 5B7CA 3HYPA 2VCZA 5IIZA 1O8XA 4X1UA 1U87A 3QMXA 3ZMLA 3R3EA 4USSA 5F0GA 1F3AA 1YQ1A 4OFMA 1EOGA 3UMAA 2AHEA 3Q19A 1DE1A 1KBNA 4G0IA 5J4UA 2PWJA 4ZBDA 2LKUA 5ECPB 3TKSA 1ABAA 1TJDA 3SBCA 4DSSA 1XXUA 3F0IA 3LYKA 1WIKA 5DCHA 1EOHA 1B9XC 2HXKA 3TKRA 1W89A 5ID2A 5ECSA 1WJKA 3EMXA 4I2TA 3APQA 1V58A 3M9JA 2LJKA 2FNOA 1X9SB 2YWIA 1SD8A 2H6XA 3GRXA 3IK7A 4WEYA 2X8CA 4K8MA 4V2MA 1XW6A 5D9XA 4KUNA 2BTOT 4BL7B 1PN9A 2YNXA 3PPUA 3DGQA 5LCZA 1GSEA 3G7IA 1AAZA 4KNDA 5F05A 4AJ6A 1OYJA 2R2JA 4OCEA 1XWBA 3GTUA 5DALB 2K8SA 2PN8A 2OADA 1FW1A 1EEMA 2O89A 4V1Ag 2HSYA 3W6GA 4ZIJA 4MZCA 4NHWA 4ML6A 2VLVA 5D73A 3RPNA 1XOAA 1ST9A 1TOFA 2A4VA 2OBIA 4YAPA 2I4AA 4EKZA 2HFDA 2BJXA 4GQFA 3MSZA 4RI6A 4MF7A 4NV5A 1DUGA 3ZTLA 1T7PB 2WULA 3U5RE 2MBSA 3VWWA 1ZOFA 1I9DA 1PD21 3GL5A 2DJJA 2JADA 4WXTA 3EYTA 3Q6OA 4FH8A 3TB2A 1C72A 1O73A 1Z5YE 1F2EA 1M9BA 1I5GA 1MDJA 1AQWA 3VPTA 4KAEA 3KTLA 3M3MA 1OC9A 5C04A 1MD3A 5GZZB 2XBIA 1M2BA 1TI1A 4G2EA 2H01A 4G0KA 4HU7A 3HJOA 3H1NA 3CXGA 4Q5NA 4KE3A 3FY7A 1URMA 3GA4A 3WGDA 2CAIA 3HA9A 1O8WA 4K1FA 2A2RA 4TR4A 3G9BA 1XBSA 3ZVJA 1VRSD 1MDIA 2XPDA 3GURA 1UC7A 1GSFA 2H66A 2YZUA 5IMCA 2C0FA 3FZ4A 1X0RA 4EXJA 2K9FA 1GH2A 4FIWA 2A2SA 4KCEA 2HZEA 3F8UA 2VD1A 1KTEA 1USBA 1XOBA 2ON5A 5JWRB 3QAVA 2H73A 3E9JB 2DIYA 2DMMA 2B7KA 2YJ7A 4F0BA 4I5QA 5LNKe 3ZITA 3HVSA 3HVVA 2C4JA 4KW6A 3K8NA 3P2AA 3U6VA 3QFAC 3FZ9A 1O7UA 3I69A 2IJYA 4XRAA 1FB6A 2CT6A 2JACA 3IV4A 1XZOA 5KN3A 3H93A 2LTKA 2E0QA 1UN2A 3FK8A 4WF4A 4XTSA 3IA1A 1Z7PA 4TR0A 4JR6A 4IVFA 2MMOA 1HYUA 4HEA2 3WGXA 1OAZA 2H6YA 3HY2A 3QAWA 2JSZA 3KMOA 9GSSA 3Q74A 1T3BA 1PGTA 1K0AA 2R5GA 3IOSA 4BVYB 4LMVA 4K0NA 3HVXA 2N5FA 1U3IA 5J9BA 1SD9A 2YV7A 5G2ZA 5B6NA 2IFQA 1YKAA 3VFIA 4ZL9A 3TOTA 2K6VA 2UZ8A 2IMFA 4L0UA 4WR4A 4RQRA 2B6MA 3DVWA 2HSMB 5AIVA 1ERTA 2PPTA 5F06A 3UOMA 1X9WB 4HJ2A 3ZYWA 1ZL9A 2WCIA 1EZKA 1WWJA 3PH9A 1X5EA 1B48A 5IMDA 3KD0A 3KIJA 5F07A 5COHA 3LFLA 4POKA 5CYYA 3C71A 3DXBA 1SL2B 2C3NA 3HDCA 2ALBA 3KP8A 3NIVA 1VF2A 2JL4A 2YJHA 1A0FA 3ED3A 3SWLA 1B4QA 2ZUPA 3ZL5A 2VL2A 2CV4A 3D21A 1PMTA 4IELA 5FWGA 3UBKA 1GP1A 4MZWA 4HOJA 1FB0A 1AQXA 2ES7A 5KN2A 3LGCA 5ECHB 2IWTA 3IPZA 2IL3A 2MMZA 2H1GA 4DVCA 5DQYA 2H6ZA 2JZSA 1ZMAA 5HR1A 2M46A 1SKWB 22GSA 3A2XA 3UIWA 2OACA 5LD0A 3LG6A 1ZYQB 4MP4A 2CAQA 1TRWA 3IHQA 3P90A 1GLPA 4ECBA 5HR0A 4FYBA 2YV9A 16GSA 3CBUA 2LEGA 5DCGA 3PR8A 4ECIA 3IE3A 3QAGA 1M7TA 3LXTA 1GRXA 4HUAA 3Q18A 3IC4A 1YDKA 3WD6A 1TI3A 3LORA 5DJLA 2GT5A 1S3DA 1HNCA 4QL7A 3WYWA 1Z6NA 1U88A 2VL3A 4EDZA 2LJRA 4FYCA 1PA3A 2HYXA 2FWHA 1GLQA 4IHUA 4GSNA 1SL1B 1SYRA 3ZFBA 2ZNMA 4TR1B 3VLNA 1PL1A 1ERUA 2HRKA 1MD4A 4CDOA 4NWYA 4Q5QA 5A4WA 2VO4A 3QR6A 4HU9A 3RDWA 4XCSA 4OCFA 2FCHA 4J57E 1Y6EA 2VLUA 3EU4A 1JFUA 2OA7A 4ZBBA 2LNTA 3A2WA 3UL3A 1GUHA 1U6TA 1JZDA 1TRSA 5CO3A 1JZRA 3UARA 5EL8A 14GSA 3CTFA 5CP1A 2NVLA 3EE2A 3F4RA 4L0WA 1A2JA 3L9VA 2CVDA 1YEPA 2GGTA 2I81A 1R26A 1GTBA 1CQHA 5IQYA 5DBQA 1FAAA 4GRFA 1VF3A 2HI7A 2LNSA 2VCQA 2CX4A 4RUVA 5A4UA 3O3TA 1GNWA 5IM9A 3ME8A 2H30A 1VF4A 4JU5A 1XW9A 2H19A 3CSHA 4YQUA 4ACSA 2MZCA 5ABRA 2H0HA 4GWRA 2KHPA 1GUMA 3H4KA 3VPQA 1GTUA 1NSWA 1T00A 3M9KA 4MH3A 1BQ7A 2JSYA 1QQ2A 1HD2A 1YZXA 2C0DA 4TXVA 4GTUA 2R37A 2FD3A 4LL1B 1AW9A 6GSVA 4KSMA 3D0ZA 4GSTA 1OKTA 2GSQA 5JCUA 1EGOA 3GNJA 5D9WA 3C1RA 3QFBC 1PL2A 3C1SA 1TW9A 3GX0A 1YF0A 1M0UA 4BPYA 1NHOA 4WR5A 5D8IA 2GQKA 3RAZA 3US3A 2FUG2 2LS5A 3QPMA 5DQSA 5JCGA 2HRAA 4O92A 4LA1A 2GZPA 2PVQA 3TRPA 1R5AA 2P31A 5EY6A 5B6MA 4TXOB 2NPBA 2P5QA 2C0GA 5G1KA 5GAPD 3BCIA 8GSSA 2L4QA 5AN1A 1QXHA 4ECJA 4D73A 2EIOA 2CZ2A 1Q98A 3FR9A 4ML1A 3TGZA 1G7OA 4HQSA 5HFGA 4POBA 1JLWA 3VWUA 3FR6A 3V1WA 4CHSA 4LMWA 2L6DA 4BWSA 1NM3A 4EUYA 2F8AA 6GSSA 1E2YA 1NW2A 4MJAA 11GSA 1R5PA 1TK5B 2XHFA 3G7JA 1TRUA 5GAND 2RM6A 2OJLA 3GH6A 4MCUA 7GSSA 4DSQA 2LQOA 4KDYA 1KNGA 3LJRA 2YANA 3FRCA 3UJ1A 4K7OA 1R4WA 2TRXA 1EP7A 4GLTA 1K3LA 3GUSA 3HCZA 1K0CA 2MMNA 2DJKA 4X0XA 4V2LA 1GTIA 1HNAA 2F9SA 1TRVA 1G6YA 3NZNA 4LLRA 1XWGA 3ZMKA 2GQLA 2FWGA 1SJIA 5KN0A 2YCDA 3VURA 2EC4A 4AJ8A 2CQ9A 1OE7A 2HLSA 3MDKA 3BJ5A 2L57A 2F3MA 4MF6A 1K3OA 4K2DA 1M99A 2FWEA 5A5KA 4ISDA 1WRYA 5KN1A 4K6XA 3F6FA 2WDUA 3MWHA 2PERA 1T8EB 4BL7A 3ZRDA 3N9JA 4I6XA 4ZXGA 3FW2A 5ELAA 4NMUA 4O32A 4I2UA 5ENUA 1K0MA 2QGVA 5ECIB 5DALA 4OO4A 2H70A 3HZ4A 1ZCPA 2DIZA 5GSTA 3LEFA 4YAVA 4MZBA 1V40A 2LV3A 2B3SA 3KXOA 5DAKB 1B9YC 1FG4A 4EDYA 3A2VA 2B7JA 3DIEA 3UVTA 3PINA 1K0DA 4EO3A 2HRFA 2NBSA 1TU8A 1SK1A 3CSIA 3KTBA 4XS1A 3WT2A 3D4TA 2PGTA 3EVIA 1F9MA 18GSA 1WOUA 4K9ZA 5J3RA 4HQZA 5B8BA 1A2MA 3BD2A 2F51A 1SKSB 4NHZA 4PUFC 1G0TA 5IOXA 1TDIA 3N5OA 1O6JA 2IPAA 3TDGA 17GSA 3QDNA 3O6TA 1XIYA 2C3QA 1LJRA 2C3TA 3TUEA 1QFNA 2R4VA 2H0GA 2H74A 1EV9A 3G7YA 1XVWA 5JCWA 4H86A 4KB3A 3L78A 3TKQA 3KCMA 5IPGA 2V32A 2R6KA 2K8VA 4WKWA 3WT1A 3RHCA 1X5CA 2PUKC 1QK8A 2F8FA 13GSA 1BX9A 2NTOA 2DSAA 3IBHA 5ECOB 1PQNA
chains in the Genus database with same CATH superfamily
2VCTA 2C1YA 3CYNA 2HRNA 3JCML 5H5SA 4PHZC 1WMJA 3LXZA 4IN0A 5H5RA 2YOIA 4J56E 2CVKA 5IMZA 2L5OA 2WZSA 4XS4B 4ECCA 5INYA 4JBBA 4WBJA 4O7HA 1ZYNA 3QD9A 5IO2A 4AJ7A 4K5SA 3HVNA 4JEDA 3CTGA 1Z7RA 5D9TA 2TIRA 4E68A 1EV4A 1YEWC 2DMLA 4KA0A 3ME7A 1XW5A 3F6DA 1AIUA 3IAM2 3S9FA 5A1NB 4FQUA 3F3RA 2WGRA 3VK9A 1K0BA 4K0GA 2B5EA 2DJ0A 3A3TA 2QKEA 2WRTA 5H5QA 5E59A 4JRRA 2I9HA 5HQPA 1JLVA 4K5RA 5G31A 4YKFA 2L59A 4ZILA 4G19A 4MMMA 1FOVA 1K0OA 1G7EA 1HQOA 4BVXB 2IIYA 3PGTA 4PTSA 4YKGA 2L4CA 2IMIA 2AV4A 2VM2A 4AKHA 1TK8B 4GXZA 2FLSA 3DMLA 2WVXA 4F0CA 4F9ZA 1G6WA 4G01A 2REMA 2B5XA 4BA7A 2GZZA 4N0ZA 1XPVA 2H1LA 3I43A 2VLTA 3TCOA 4BVYA 5AIXA 4WBRD 1JZOA 3EC3A 1F37A 4V2NA 2I3YA 4ZB9A 3D6IA 3GSTA 2DBCA 3GX8A 2V41A 1FVJA 5CAXA 2GQMA 1LU4A 3TJKA 4PNGA 2HSMA 4NAXA 4GQCA 1TU7A 1A8YA 1KEBA 2H1AA 4RI7A 5JWQB 1WP0A 4V1Ap 2XC2A 2P5RA 2L5LA 6GSWA 1XWCA 3EINA 2EIRA 1GNEA 1N2AA 1OC8A 4PXOA 2X8HA 5F8BA 4IJIA 1Z3EA 3IXRA 4HDEA 2B1KA 2GSSA 4XS6A 2VL2C 1X9MB 1B4PA 1J9BA 1XFLA 4HS1A 3E0UA 4Z7XA 1FHEA 5ECNB 2V6KA 2AUVA 2RLIA 3FEUA 3ERWA 1THOA 4CW9A 4TVEA 4JZQA 1IYHA 3KMNA 1PKWA 3BCKA 3F4TA 1THXA 1Z9HA 1X5DA 2V1MA 2PBJA 2RM5A 4ZL7A 1M2AA 3NOFA 1YEXA 2YPMA 5ECLB 4ULXA 3GYKA 12GSA 4CY8A 3F4SA 4PQ1A 4KSOA 2VCXA 1Y25A 2ON7A 5J9CA 1SJ6A 1SK2A 4IQ1A 4IJ3A 5KEJA 4OWYA 3L0HA 2A4HA 2YZHA 2KP2A 5B8AA 4NXIA 2C0EA 2OBKA 1N8JA 2R3XA 2CVBA 3GHAA 2VUPA 2IN3A 5EPFA 2AAWA 3GN3A 4IP6A 2RUEA 2DJ2A 3UEMA 1O81A 2O8VB 5IMVA 1FVKA 2QSIA 1AUCA 10GSA 1K3YA 3J7Yb 3M1GA 1J08A 4DSSB 3LSZA 5AGYA 3GIXA 2O36A 1M3IA 2WZ9A 3H8QA 1BG5A 1TTZA 3EU3A 3TJBA 2GTUA 4DEJA 1EWXA 3GV1A 5ID2B 3EWLA 4D73B 1SK0A 2DKHA 3ZVJD 4HI7A 4OFNA 4MABA 4IKHA 2VCVA 4TR1A 3ZLPA 4AKIA 5J4YA 4KDXA 4ILFA 2VCWA 3MYDA 1MEKA 1TK0B 1UVZA 5G5FA 5DDLA 3ZREA 4O5RA 2O5VA 4L8EA 1Q4JA 4KH7A 1UA5A 4XIHA 2DC5A 1DSBA 1V57A 3IRAA 3GTUB 3KGKA 1A24A 2OT3A 3FR3A 1BEDA 1GSUA 5FT3A 1M2DA 4ID0A 3IK9A 1V98A 3DVXA 4IW9A 4TN8A 1SJZA 4MK3A 4I97A 5IOWA 4MPGA 1BJXA 4BWQA 3LYPA 3W8JA 1JHBA 5ELGA 2J23A 1GSDA 4ZBAA 4EE0A 5J41A 4L5OA 4E8HA 2O87A 2V2GA 1SL0B 4PNFA 4KF9A 1HNBA 2DLXA 4XRDA 4Q5FA 2OKAA 2FA4A 1XWAA 3C7MA 2HNLA 4HJMA 1TKDB 4PI2C 5G5EA 4J2FA 2GS3A 1FO5A 1PFOA 1XVQA 3L4NA 1F6MC 6GSUA 4TR3A 4DSRA 2GT6A 4AI6A 2GVPA 1TP9A 3TKSC 2RIIA 1OC9B 3ZIJA 2JU5A 2WS2A 1MDKA 2XPEA 4PX1A 3HHVA 1TXXA 1A23A 1RK4A 5IO0A 1OVNA 4JR4A 4ZL8A 2HSNB 1QMVA 2GZYA 2IMDA 3W8SA 4F2IA 4FYUA 2OE0A 2JZTA 4OO5A 4TXOA 1YY7A 3AY8A 2AYTA 2H1BA 3D5JA 5A4VA 2X8GA 3R2QA 3CRUA 1QUWA 3L9UA 3F9UA 3IR4A 2N5AA 3E3EA 1SENA 2LQQA 2DJ3A 5CRDA 1YJ6A 3HKRA 5ECKB 5GSSA 4OFTA 1ZZYA 2WW0A 1RQMA 2PVOC 4MJEA 2K18A 3TU3B 5HR2A 1U3AA 2IMEA 2TRCP 2HZEB 4P3YB 4N10A 3TJFA 4N11A 2N5BA 2YWNA 5ECMB 1GSYA 2LJAA 3P8WA 1PKZA 2GSTA 4G9HA 2X99A 4N30A 4IP1A 5HR3A 3GFKA 1PRXA 1XG8A 5D96A 1SVOA 3GL3A 3HD5A 2EFHA 1A8LA 2M72A 3C8EA 4EVMA 1GUKA 3CRTA 2JZRA 1E6BA 1OE8A 20GSA 2FA8A 1K0NA 4F82A 1PSQA 2YP6A 5IMFA 2O7KA 2C8UA 4I8BA 2D2ZA 2ZCTA 4ZB8A 1WPIA 1AXDA 1T4ZA 2C80A 3HJMA 1GSQA 1ERWA 3DEXA 2IFQB 5AISA 3D22A 2OE3A 2MMAA 4EIPA 1LBKA 1SYXA 1DBYA 2QA2A 4PUAA 3FZAA 5A5HB 2IMKA 4TOPA 4JE1A 2GLRA 4PGTA 3RPPA 2VD0A 1ACVA 2X49A 19GSA 1Z6MA 1IYIA 1XCCA 3IDVA 3M0FA 2WFCA 3FYGA 3ERGA 1VGLA 2HT9A 2WJUA 2L6CA 3C73A 4MJCA 5FHIA 5DAKA 2H76A 3RBTA 2CX3A 3TKSE 3F63A 1GULA 3VWXA 4Q5RA 4YQMA 2AB6A 2H8LA 3F3QA 3I9V2 3APSA 2YWMA 1BG1A 5CREA 3ISOA 3TJJA 4IQAA 2MYGA 3KP9A 4KDUA 2HSHA 2PU9C 2V6OA 4MA9A 3FHKA 3IHGA 3L9SA 3I6AA 2FGXA 2G2QA 2KP1A 4OMVA 1GWCA 1MTCA 1ON4A 5BMUA 2VOCA 2DKIA 1OKDA 3J7Yk 3IAS2 2XBQA 3TJGA 4QQ7A 5HFIA 1EEJA 2MBTA 5JWOB 1ML6A 1GSSA 2FWFA 2R0GA 4AGSA 3VWVA 3EURA 5CNWA 4TW5A 1B8XA 2E2MA 1I1IP 3RHBA 4MDCA 2VAFA 3CSJA 4ZB6A 4L5LA 1RW1A 4AF2A 3MIXA 1YF1A 3HJPA 1ZGNA 3APOA 4YQVA 5CRWA 4FO5A 3GH9A 3GKNA 5D93A 2J9HA 4WETA 2BMXA 4IS0A 5ECQB 1SU9A 3M8NA 2CZ3A 3DRNA 4NPBA 1VF1A 1QGVA 1A0RP 1S3AA 1O85A 3O76A 2HZFA 4Z2RA 4KX4A 2RUFA 6GSXA 2KOKA 4MF5A 5C00A 1W4VA 3HXSA 3MAKA 5IPHA 3HMJG 4NV2A 2O85A 4POLA 3QOUA 4F03A 2G0FA 4XS4A 1GL8A 5CRHA 3KEBA 4TKYA 4IBPA 5ECRB 3VI7A 2VM1A 2HRKB 3TOUA 3TRQA 1A2LA 1EP8A 1V9WA 1XWKA 3GSSA 1JZWA 4GSSA 1OC3A 3DD3A 2WW1A 2KUCA 1ILOA 3KH9A 5A1NA 3FMWA 3LWAA 4QL9A 1R7HA 3KM6A 3CMIA 4E8EA 2VL9A 1ERVA 2HE3A 4WF5A 2Z9SA 4G0LA 2HQTA 3A5WA 4K7IA 3CHXC 4X43A 1PX6A 4RQXA 3BOAA 3DYRA 2LRNA 3GKXA 2WB9A 3H79A 1EGRA 4BVXA 3ZIVA 1V2AA 2M80A 2CA8A 4MH2A 2GDRA 4YH2A 3OR5A 3DKSA 1BAYA 5G1LA 5E4WA 2H72A 4MLYA 3MNGA 2PMTA 4EC0A 3LQ7A 5CRGA 1T1VA 5J5NA 3ZZXA 1S3CA 4EL1A 3UBLA 3UVHA 6GSYA 5DJMA 3KZQA 5D9VA 4GCIA 4POMA 2H1DA 5J4VA 1GTAA 4PQIA 3WGEA 1CQGA 2B1LA 4N0VA 2H0IA 1AC1A 5L71A 3P7XA 2I1UA 3HZ8A 3TKPA 1M9AA 2DJ1A 2GSRA 3KH7A 4PURA 3IC8A 6GSTA 3GKMA 1BYEA 2P0GA 1SKRB 4HZ2A 3TRXA 4FXYP 1J0FA 3BBYA 2H75A 3GKKA 2KLXA 3KJYA 2LRTA 2LSTA 3GMFA 2X64A 3D4MA 2B5YA 2NDOA 5IMAA 4G10A 1H75A 3ERFA 5HFKA 4TRXA 3FKFA 1T4YA 4LL4B 4K7NA 2OE1A 1PX7A 1F3BA 4PQHA 2FY6A 5DVBA 2AJQB 1WE0A 4OD7A 3ZFLA 1H4OA 2VIMA 5G30A 3FZ5A 2LUSA 3UAPA 1M3JA 3QCPA 4KCAA 3VI5A 1YKCA 4MPFA 4EF0A 2FHEA 4MJBA 4IGJA 2YWOA 4KGIA 2E7PA 2EIQA 3DWVA 2LRCA 3EMPA 4XHMA 1AQVA 1DE2A 4HZ4A 1NHYA 2YN1A 1ZYEA 2H71A 2QC7A 2E2GA 4GF0A 5EVOA 5B7CA 3HYPA 2VCZA 5IIZA 1O8XA 4X1UA 1U87A 3QMXA 3ZMLA 3R3EA 4USSA 5F0GA 1F3AA 1YQ1A 4OFMA 1EOGA 3UMAA 2VKZG 2AHEA 3Q19A 4X4JA 1DE1A 1KBNA 4G0IA 5J4UA 2PWJA 4ZBDA 2LKUA 4HSCX 5ECPB 3TKSA 1ABAA 1TJDA 3SBCA 4DSSA 1XXUA 3F0IA 3LYKA 1WIKA 5DCHA 1EOHA 1B9XC 2HXKA 3TKRA 1W89A 5ID2A 5ECSA 1WJKA 3EMXA 4I2TA 3APQA 2A2PA 1V58A 3M9JA 2LJKA 2FNOA 1X9SB 2YWIA 1SD8A 2H6XA 3GRXA 3IK7A 4WEYA 2X8CA 4K8MA 4V2MA 4N3ZA 1XW6A 5D9XA 4KUNA 2BTOT 4BL7B 1PN9A 2YNXA 3PPUA 3DGQA 5LCZA 3G7IA 1GSEA 1AAZA 4KNDA 5F05A 4AJ6A 1OYJA 2R2JA 4OCEA 1XWBA 3GTUA 5DALB 2K8SA 2PN8A 2OADA 1SVMA 1BF5A 1FW1A 1EEMA 2O89A 4V1Ag 2HSYA 3W6GA 4ZIJA 4MZCA 4NHWA 4ML6A 2VLVA 5D73A 3RPNA 2EFDA 1XOAA 1ST9A 1TOFA 2A4VA 4MNNA 2OBIA 2O3EA 4YAPA 2I4AA 4EKZA 4A5PA 2HFDA 1Y1UA 2BJXA 4GQFA 3MSZA 4RI6A 4MF7A 4NV5A 1DUGA 3ZTLA 1T7PB 2WULA 3U5RE 2MBSA 3VWWA 1ZOFA 1I9DA 1PD21 3GL5A 2DJJA 2JADA 4WXTA 3EYTA 3Q6OA 4FH8A 3TB2A 1C72A 1O73A 1Z5YE 1F2EA 1M9BA 1I5GA 1MDJA 1AQWA 3VPTA 4KAEA 4AKGA 3KTLA 4Z2TA 3M3MA 1OC9A 5C04A 1MD3A 5GZZB 2XBIA 1M2BA 1TI1A 4G2EA 2H01A 4G0KA 4HU7A 3HJOA 5A34B 3H1NA 3CXGA 4Q5NA 4KE3A 3FY7A 1URMA 3GA4A 3WGDA 2CAIA 3HA9A 1TXUA 1O8WA 4K1FA 2A2RA 4TR4A 3G9BA 1XBSA 1PN0A 3ZVJA 1VRSD 1MDIA 2XPDA 3GURA 1UC7A 1GSFA 2H66A 2YZUA 5IMCA 2C0FA 3FZ4A 1FOHA 1X0RA 4EXJA 2K9FA 1GH2A 5BMUB 4FIWA 2A2SA 4KCEA 2HZEA 3F8UA 2VD1A 1KTEA 1USBA 1XOBA 2ON5A 5JWRB 3QAVA 2H73A 3E9JB 2DIYA 2DMMA 2B7KA 2YJ7A 4F0BA 4I5QA 5LNKe 3ZITA 3HVSA 3HVVA 2C4JA 4KW6A 3K8NA 3P2AA 3U6VA 3QFAC 3FZ9A 1O7UA 3I69A 2IJYA 4XRAA 1FB6A 2CT6A 2JACA 3IV4A 1XZOA 5KN3A 3H93A 1SVLA 2LTKA 2E0QA 5KOXA 1UN2A 3FK8A 4WF4A 4XTSA 3IA1A 1Z7PA 4TR0A 4JR6A 2WVXB 4IVFA 2MMOA 1HYUA 4HEA2 3WGXA 1OAZA 2H6YA 3HY2A 3QAWA 2JSZA 3KMOA 9GSSA 3Q74A 1T3BA 1PGTA 1K0AA 2R5GA 3IOSA 4BVYB 4LMVA 4K0NA 3HVXA 2N5FA 1U3IA 5J9BA 3CQFA 1SD9A 2YV7A 5G2ZA 5B6NA 2IFQA 1YKAA 3VFIA 4ZL9A 3TOTA 2K6VA 2UZ8A 2IMFA 4L0UA 4WR4A 1S4BP 4RQRA 2B6MA 4CY6A 5A5HA 3DVWA 2HSMB 5AIVA 1ERTA 2PPTA 4K2XA 5F06A 3UOMA 1X9WB 4HJ2A 3ZYWA 1ZL9A 2WCIA 1EZKA 1WWJA 3PH9A 1X5EA 4O5QA 1B48A 5IMDA 3KD0A 3KIJA 5F07A 5COHA 3LFLA 4POKA 5CYYA 3C71A 3DXBA 1SL2B 2C3NA 3HDCA 2ALBA 3KP8A 3NIVA 1VF2A 2JL4A 2YJHA 1A0FA 3ED3A 3SWLA 1B4QA 4BIKA 2ZUPA 3ZL5A 2VL2A 2CV4A 3D21A 1PMTA 4IELA 5FWGA 3UBKA 1GP1A 4MZWA 4HOJA 1FB0A 1AQXA 2ES7A 5KN2A 3LGCA 5ECHB 2IWTA 3IPZA 2IL3A 2MMZA 2H1GA 4DVCA 2EFCA 5DQYA 2H6ZA 2JZSA 1ZMAA 5HR1A 2M46A 1SKWB 22GSA 3A2XA 3UIWA 2OACA 5LD0A 3LG6A 1ZYQB 4MP4A 2CAQA 1TRWA 3IHQA 3P90A 1GLPA 4ECBA 4O5UA 5HR0A 2YV9A 4FYBA 16GSA 3CBUA 2LEGA 5DCGA 3PR8A 4ECIA 3IE3A 3QAGA 1M7TA 3LXTA 1GRXA 4HUAA 3Q18A 3IC4A 1YDKA 3WD6A 1TI3A 3LORA 5DJLA 2WVYA 2GT5A 4ZB7A 1S3DA 1HNCA 4QL7A 3WYWA 1Z6NA 1U88A 2VL3A 4EDZA 2LJRA 4FYCA 2QA1A 3RGBC 1PA3A 2HYXA 2FWHA 1GLQA 4IHUA 4GSNA 1SL1B 5J40A 1SYRA 3ZFBA 2ZNMA 4TR1B 3VLNA 1PL1A 1ERUA 2HRKA 1MD4A 3A5IA 4CDOA 4NWYA 4Q5QA 5A4WA 1ZYPA 2VO4A 3QR6A 4HU9A 3RDWA 4XCSA 4OCFA 2FCHA 4J57E 1Y6EA 2VLUA 3EU4A 1JFUA 2OA7A 4ZBBA 2LNTA 3A2WA 3UL3A 1GUHA 1U6TA 1JZDA 2WW3A 1TRSA 5CO3A 1JZRA 3UARA 5EL8A 14GSA 3CTFA 5CP1A 2NVLA 3EE2A 3F4RA 4L0WA 1A2JA 3L9VA 2CVDA 1YEPA 2GGTA 2I81A 1R26A 1GTBA 1CQHA 5IQYA 5DBQA 1FAAA 4GRFA 1VF3A 2HI7A 2LNSA 2VCQA 2CX4A 4RUVA 5A4UA 1GNWA 3O3TA 5IM9A 3ME8A 2H30A 3EPTA 1VF4A 4JU5A 4PI0C 1XW9A 2H19A 1S3RA 2R0PA 3CSHA 4YQUA 4ACSA 2MZCA 5ABRA 2H0HA 4GWRA 2KHPA 1GUMA 3H4KA 3VPQA 1GTUA 1NSWA 1T00A 3M9KA 4MH3A 1BQ7A 2JSYA 1QQ2A 1HD2A 1YZXA 2C0DA 4TXVA 4GTUA 2R37A 2FD3A 5BRTA 4LL1B 1AW9A 6GSVA 4KSMA 3D0ZA 4GSTA 1OKTA 2GSQA 5JCUA 1EGOA 3GNJA 5D9WA 3C1RA 3QFBC 1PL2A 3C1SA 1TW9A 3GX0A 1YF0A 1M0UA 4BPYA 1NHOA 4WR5A 5D8IA 2GQKA 3RAZA 3US3A 2FUG2 2LS5A 3QPMA 5DQSA 2WW2A 5JCGA 2HRAA 4O92A 4LA1A 4GDFA 2GZPA 2X4AA 2PVQA 3TRPA 1R5AA 2P31A 2EFEA 5EY6A 5B6MA 4TXOB 2NPBA 2P5QA 2C0GA 5G1KA 5GAPD 3BCIA 8GSSA 2L4QA 5AN1A 1QXHA 4ECJA 4D73A 2EIOA 2CZ2A 1Q98A 3FR9A 4ML1A 3TGZA 1N25A 4AKXB 1G7OA 4HQSA 5HFGA 4POBA 1JLWA 3VWUA 3FR6A 4ICYA 3V1WA 4CHSA 4LMWA 2L6DA 4BWSA 1NM3A 3LW9A 5J47A 4EUYA 2F8AA 6GSSA 1E2YA 1NW2A 4MJAA 11GSA 1R5PA 1TK5B 2XHFA 3G7JA 1TRUA 5GAND 2RM6A 2OJLA 3GH6A 4MCUA 7GSSA 4DSQA 2LQOA 4KDYA 1KNGA 3LJRA 2YANA 3FRCA 3UJ1A 4K7OA 1R4WA 2TRXA 1EP7A 5KOWA 4GLTA 1K3LA 3GUSA 3HCZA 1K0CA 2MMNA 2DJKA 4X0XA 4V2LA 1GTIA 1HNAA 2F9SA 1TRVA 1G6YA 2R0CA 3NZNA 4LLRA 1XWGA 3ZMKA 2GQLA 2FWGA 1SJIA 5KN0A 2YCDA 3VURA 2EC4A 4AJ8A 2CQ9A 1OE7A 2HLSA 3MDKA 3BJ5A 2L57A 2F3MA 4MF6A 1K3OA 4K2DA 1M99A 2FWEA 5A5KA 4ISDA 1WRYA 5KN1A 4K6XA 3F6FA 2WDUA 3MWHA 2PERA 1T8EB 4BL7A 3ZRDA 3N9JA 4I6XA 4ZXGA 3FW2A 5ELAA 4NMUA 4O32A 4I2UA 5ENUA 1K0MA 2QGVA 5ECIB 5DALA 4OO4A 2H70A 3HZ4A 3RFRC 1ZCPA 2HSNA 2DIZA 5GSTA 3LEFA 4YAVA 4MZBA 1V40A 2LV3A 2B3SA 3KXOA 5DAKB 1B9YC 1FG4A 4EDYA 3A2VA 1YVLA 4QMKA 2B7JA 3DIEA 3UVTA 3PINA 3CWGA 1K0DA 4EO3A 2HRFA 2NBSA 1TU8A 1SK1A 3CSIA 3KTBA 4XS1A 3WT2A 3D4TA 2PGTA 2UV8G 4EIQA 3EVIA 1F9MA 4Z2UA 18GSA 1WOUA 4K9ZA 5J3RA 4HQZA 5B8BA 1A2MA 3BD2A 2F51A 1SKSB 4NHZA 4W66A 4PUFC 1G0TA 5IOXA 1TDIA 3N5OA 1O6JA 2IPAA 3TDGA 17GSA 3QDNA 3O6TA 1XIYA 2C3QA 1LJRA 2C3TA 3TUEA 1QFNA 2WVZA 2R4VA 2H0GA 2H74A 1EV9A 3G7YA 1XVWA 5JCWA 4H86A 4KB3A 3L78A 3TKQA 3KCMA 5IPGA 2V32A 2R6KA 2K8VA 4WKWA 3WT1A 3RHCA 1X5CA 2PUKC 1QK8A 2F8FA 13GSA 1BX9A 2NTOA 2DSAA 3IBHA 5ECOB 5A34A 1PQNA
chains in the Genus database with same CATH topology
2VCTA 2C1YA 3CYNA 2HRNA 3JCML 5H5SA 1WMJA 3LXZA 4IN0A 5H5RA 2YOIA 4J56E 2CVKA 5IMZA 2L5OA 4XS4B 5INYA 4ECCA 4JBBA 4WBJA 4O7HA 1ZYNA 3QD9A 5IO2A 4AJ7A 4K5SA 4JEDA 3CTGA 1Z7RA 5D9TA 2TIRA 4E68A 1EV4A 2DMLA 4KA0A 3ME7A 1XW5A 3F6DA 1AIUA 3IAM2 3S9FA 5A1NB 4FQUA 3F3RA 2WGRA 3VK9A 1K0BA 4K0GA 2B5EA 2DJ0A 3A3TA 2QKEA 2WRTA 5H5QA 5E59A 4JRRA 2I9HA 5HQPA 1JLVA 4K5RA 5G31A 4YKFA 2L59A 4ZILA 4G19A 4MMMA 1FOVA 1K0OA 1G7EA 1HQOA 4BVXB 2IIYA 3PGTA 4PTSA 4YKGA 2L4CA 2IMIA 2AV4A 2VM2A 4AKHA 1TK8B 4GXZA 2FLSA 3DMLA 4F9ZA 4F0CA 1G6WA 4G01A 2REMA 2B5XA 4BA7A 2GZZA 4N0ZA 1XPVA 2H1LA 3I43A 2VLTA 3TCOA 4BVYA 5AIXA 4WBRD 1JZOA 3EC3A 1F37A 4V2NA 2I3YA 4ZB9A 3D6IA 3GSTA 2DBCA 3GX8A 2V41A 1FVJA 5CAXA 2GQMA 1LU4A 3TJKA 4PNGA 2HSMA 4NAXA 4GQCA 1TU7A 1A8YA 1KEBA 2H1AA 4RI7A 5JWQB 1WP0A 4V1Ap 2XC2A 2P5RA 2L5LA 6GSWA 1XWCA 3EINA 2EIRA 1GNEA 1N2AA 1OC8A 4PXOA 2X8HA 5F8BA 4IJIA 1Z3EA 3IXRA 4HDEA 2B1KA 2GSSA 4XS6A 2VL2C 1X9MB 1B4PA 1J9BA 1XFLA 4HS1A 3E0UA 4Z7XA 1FHEA 5ECNB 2V6KA 2AUVA 2RLIA 3FEUA 3ERWA 1THOA 4CW9A 4TVEA 4JZQA 1IYHA 3KMNA 1PKWA 3BCKA 3F4TA 1THXA 1Z9HA 1X5DA 2V1MA 2PBJA 2RM5A 4ZL7A 1M2AA 3NOFA 1YEXA 2YPMA 5ECLB 4ULXA 3GYKA 12GSA 4CY8A 3F4SA 4PQ1A 4KSOA 2VCXA 1Y25A 2ON7A 5J9CA 1SJ6A 1SK2A 4IQ1A 4IJ3A 5KEJA 4OWYA 3L0HA 2A4HA 2YZHA 2KP2A 5B8AA 4NXIA 2C0EA 2OBKA 1N8JA 2R3XA 2CVBA 3GHAA 2VUPA 2IN3A 5EPFA 2AAWA 3GN3A 4IP6A 2RUEA 2DJ2A 3UEMA 1O81A 2O8VB 5IMVA 1FVKA 2QSIA 1AUCA 10GSA 1K3YA 3J7Yb 3M1GA 1J08A 4DSSB 3LSZA 5AGYA 3GIXA 2WZ9A 3H8QA 1BG5A 1TTZA 3EU3A 3TJBA 2GTUA 4DEJA 1EWXA 3GV1A 5ID2B 3EWLA 4D73B 1SK0A 2DKHA 3ZVJD 4HI7A 4OFNA 4MABA 4IKHA 2VCVA 4TR1A 3ZLPA 4AKIA 5J4YA 4KDXA 4ILFA 2VCWA 3MYDA 1MEKA 1TK0B 1UVZA 5G5FA 5DDLA 3ZREA 4O5RA 2O5VA 4L8EA 1Q4JA 4KH7A 1UA5A 4XIHA 2DC5A 1DSBA 1V57A 3IRAA 3GTUB 3KGKA 1A24A 2OT3A 3FR3A 1BEDA 1GSUA 5FT3A 1M2DA 4ID0A 3IK9A 1V98A 3DVXA 4IW9A 4TN8A 1SJZA 4MK3A 4I97A 5IOWA 4MPGA 1BJXA 4BWQA 3LYPA 3W8JA 1JHBA 5ELGA 2J23A 1GSDA 4ZBAA 4EE0A 5J41A 4L5OA 4E8HA 2O87A 2V2GA 1SL0B 4PNFA 4KF9A 1HNBA 2DLXA 4XRDA 4Q5FA 2OKAA 2FA4A 1XWAA 3C7MA 2HNLA 4HJMA 1TKDB 5G5EA 4J2FA 2GS3A 1FO5A 1XVQA 3L4NA 1F6MC 6GSUA 4TR3A 4DSRA 2GT6A 4AI6A 2GVPA 1TP9A 3TKSC 2RIIA 1OC9B 3ZIJA 2JU5A 2WS2A 1MDKA 2XPEA 4PX1A 3HHVA 1TXXA 1A23A 1RK4A 5IO0A 1OVNA 4JR4A 4ZL8A 2HSNB 1QMVA 2GZYA 2IMDA 3W8SA 4F2IA 4FYUA 2OE0A 2JZTA 4OO5A 4TXOA 1YY7A 3AY8A 2AYTA 2H1BA 3D5JA 5A4VA 2X8GA 3R2QA 3CRUA 1QUWA 3L9UA 3F9UA 3IR4A 2N5AA 3E3EA 1SENA 2LQQA 2DJ3A 5CRDA 1YJ6A 3HKRA 5ECKB 5GSSA 4OFTA 1ZZYA 1RQMA 2PVOC 4MJEA 2K18A 3TU3B 5HR2A 1U3AA 2IMEA 2TRCP 2HZEB 4P3YB 4N10A 3TJFA 4N11A 2N5BA 2YWNA 5ECMB 1GSYA 2LJAA 3P8WA 1PKZA 2GSTA 4G9HA 2X99A 4N30A 4IP1A 5HR3A 3GFKA 1PRXA 5D96A 1SVOA 3GL3A 3HD5A 2EFHA 1A8LA 2M72A 3C8EA 4EVMA 1GUKA 3CRTA 2JZRA 1E6BA 1OE8A 20GSA 2FA8A 1K0NA 4F82A 1PSQA 2YP6A 5IMFA 2O7KA 2C8UA 4I8BA 2D2ZA 2ZCTA 4ZB8A 1WPIA 1AXDA 1T4ZA 2C80A 3HJMA 1GSQA 1ERWA 3DEXA 2IFQB 5AISA 3D22A 2OE3A 2MMAA 4EIPA 1LBKA 1SYXA 1DBYA 2QA2A 4PUAA 3FZAA 5A5HB 2IMKA 4TOPA 4JE1A 2GLRA 4PGTA 3RPPA 2VD0A 1ACVA 2X49A 19GSA 1Z6MA 1IYIA 1XCCA 3IDVA 3M0FA 2WFCA 3FYGA 3ERGA 1VGLA 2HT9A 2WJUA 2L6CA 3C73A 4MJCA 5FHIA 5DAKA 2H76A 3RBTA 2CX3A 3TKSE 3F63A 1GULA 3VWXA 4Q5RA 4YQMA 2AB6A 2H8LA 3F3QA 3I9V2 3APSA 2YWMA 1BG1A 5CREA 3ISOA 3TJJA 4IQAA 2MYGA 3KP9A 4KDUA 2HSHA 2PU9C 2V6OA 4MA9A 3FHKA 3IHGA 3L9SA 3I6AA 2FGXA 2G2QA 2KP1A 4OMVA 1GWCA 1MTCA 1ON4A 5BMUA 2VOCA 2DKIA 1OKDA 3J7Yk 3IAS2 2XBQA 3TJGA 4QQ7A 5HFIA 1EEJA 2MBTA 5JWOB 1ML6A 1GSSA 2FWFA 2R0GA 4AGSA 3VWVA 3EURA 5CNWA 4TW5A 1B8XA 2E2MA 3RHBA 4MDCA 2VAFA 3CSJA 4ZB6A 4L5LA 1RW1A 4AF2A 3MIXA 1YF1A 3HJPA 1ZGNA 3APOA 4YQVA 5CRWA 4FO5A 3GH9A 3GKNA 5D93A 2J9HA 4WETA 2BMXA 4IS0A 5ECQB 1SU9A 3M8NA 2CZ3A 3DRNA 4NPBA 1VF1A 1QGVA 1A0RP 1S3AA 1O85A 3O76A 2HZFA 4Z2RA 4KX4A 2RUFA 6GSXA 2KOKA 4MF5A 5C00A 1W4VA 3HXSA 3MAKA 5IPHA 3HMJG 4NV2A 2O85A 4POLA 3QOUA 4F03A 2G0FA 4XS4A 1GL8A 5CRHA 3KEBA 4TKYA 4IBPA 5ECRB 3VI7A 2VM1A 2HRKB 3TOUA 3TRQA 1A2LA 1EP8A 1V9WA 1XWKA 3GSSA 1JZWA 4GSSA 1OC3A 3DD3A 2KUCA 1ILOA 3KH9A 5A1NA 3FMWA 3LWAA 4QL9A 1R7HA 3KM6A 3CMIA 4E8EA 2VL9A 1ERVA 2HE3A 4WF5A 2Z9SA 4G0LA 2HQTA 3A5WA 4K7IA 4X43A 1PX6A 4RQXA 3BOAA 3DYRA 2LRNA 3GKXA 2WB9A 3H79A 1EGRA 4BVXA 3ZIVA 1V2AA 2M80A 2CA8A 4MH2A 2GDRA 4YH2A 3OR5A 3DKSA 1BAYA 5G1LA 5E4WA 2H72A 4MLYA 3MNGA 2PMTA 4EC0A 3LQ7A 5CRGA 1T1VA 5J5NA 3ZZXA 1S3CA 4EL1A 3UBLA 3UVHA 6GSYA 5DJMA 3KZQA 5D9VA 4GCIA 4POMA 2H1DA 5J4VA 1GTAA 4PQIA 3WGEA 1CQGA 2B1LA 4N0VA 2H0IA 1AC1A 5L71A 3P7XA 2I1UA 3HZ8A 3TKPA 1M9AA 2DJ1A 2GSRA 3KH7A 4PURA 3IC8A 6GSTA 3GKMA 1BYEA 2P0GA 1SKRB 4HZ2A 3TRXA 1J0FA 3BBYA 2H75A 3GKKA 2KLXA 3KJYA 2LRTA 2LSTA 3GMFA 2X64A 3D4MA 2B5YA 2NDOA 5IMAA 4G10A 1H75A 3ERFA 5HFKA 4TRXA 3FKFA 1T4YA 4LL4B 4K7NA 2OE1A 1PX7A 1F3BA 4PQHA 2FY6A 5DVBA 2AJQB 1WE0A 4OD7A 3ZFLA 1H4OA 2VIMA 5G30A 3FZ5A 2LUSA 3UAPA 3QCPA 4KCAA 3VI5A 1YKCA 4MPFA 4EF0A 2FHEA 4MJBA 4IGJA 2YWOA 4KGIA 2E7PA 2EIQA 3DWVA 2LRCA 3EMPA 4XHMA 1AQVA 1DE2A 4HZ4A 1NHYA 2YN1A 1ZYEA 2H71A 2QC7A 2E2GA 4GF0A 5EVOA 5B7CA 3HYPA 2VCZA 5IIZA 1O8XA 4X1UA 1U87A 3QMXA 3ZMLA 3R3EA 4USSA 5F0GA 1F3AA 1YQ1A 4OFMA 1EOGA 3UMAA 2VKZG 2AHEA 3Q19A 4X4JA 1DE1A 1KBNA 4G0IA 5J4UA 2PWJA 4ZBDA 2LKUA 5ECPB 3TKSA 1ABAA 1TJDA 3SBCA 4DSSA 1XXUA 3F0IA 3LYKA 1WIKA 5DCHA 1EOHA 1B9XC 2HXKA 3TKRA 1W89A 5ID2A 5ECSA 1WJKA 3EMXA 4I2TA 3APQA 2A2PA 1V58A 3M9JA 2LJKA 2FNOA 1X9SB 2YWIA 1SD8A 2H6XA 3GRXA 3IK7A 4WEYA 2X8CA 4K8MA 4V2MA 4N3ZA 1XW6A 5D9XA 4KUNA 2BTOT 4BL7B 1PN9A 2YNXA 3PPUA 3DGQA 5LCZA 3G7IA 1GSEA 1AAZA 4KNDA 5F05A 4AJ6A 1OYJA 2R2JA 4OCEA 1XWBA 3GTUA 5DALB 2K8SA 2PN8A 2OADA 1SVMA 1BF5A 1FW1A 1EEMA 2O89A 4V1Ag 2HSYA 3W6GA 4ZIJA 4MZCA 4NHWA 4ML6A 2VLVA 5D73A 3RPNA 2EFDA 1XOAA 1ST9A 1TOFA 2A4VA 4MNNA 2OBIA 4YAPA 2I4AA 4EKZA 4A5PA 2HFDA 1Y1UA 2BJXA 4GQFA 3MSZA 4RI6A 4MF7A 4NV5A 1DUGA 3ZTLA 1T7PB 2WULA 3U5RE 2MBSA 3VWWA 1ZOFA 1I9DA 1PD21 3GL5A 2DJJA 2JADA 4WXTA 3EYTA 3Q6OA 4FH8A 3TB2A 1C72A 1O73A 1Z5YE 1F2EA 1M9BA 1I5GA 1MDJA 1AQWA 3VPTA 4KAEA 4AKGA 3KTLA 4Z2TA 3M3MA 1OC9A 5C04A 1MD3A 5GZZB 2XBIA 1M2BA 1TI1A 4G2EA 2H01A 4G0KA 4HU7A 3HJOA 5A34B 3H1NA 3CXGA 4Q5NA 4KE3A 3FY7A 1URMA 3GA4A 3WGDA 2CAIA 3HA9A 1TXUA 1O8WA 4K1FA 2A2RA 4TR4A 3G9BA 1XBSA 1PN0A 3ZVJA 1VRSD 1MDIA 2XPDA 3GURA 1UC7A 1GSFA 2H66A 2YZUA 5IMCA 2C0FA 3FZ4A 1FOHA 1X0RA 4EXJA 2K9FA 1GH2A 5BMUB 4FIWA 2A2SA 4KCEA 2HZEA 3F8UA 2VD1A 1KTEA 1USBA 1XOBA 2ON5A 5JWRB 3QAVA 2H73A 3E9JB 2DIYA 2DMMA 2B7KA 2YJ7A 4F0BA 4I5QA 5LNKe 3ZITA 3HVSA 3HVVA 2C4JA 4KW6A 3K8NA 3P2AA 3U6VA 3QFAC 3FZ9A 1O7UA 3I69A 2IJYA 4XRAA 1FB6A 2CT6A 2JACA 3IV4A 1XZOA 5KN3A 3H93A 1SVLA 2LTKA 2E0QA 5KOXA 1UN2A 3FK8A 4WF4A 4XTSA 3IA1A 1Z7PA 4TR0A 4JR6A 4IVFA 2MMOA 1HYUA 4HEA2 3WGXA 1OAZA 2H6YA 3HY2A 3QAWA 2JSZA 3KMOA 9GSSA 3Q74A 1T3BA 1PGTA 1K0AA 2R5GA 3IOSA 4BVYB 4LMVA 4K0NA 3HVXA 2N5FA 1U3IA 5J9BA 1SD9A 2YV7A 5G2ZA 5B6NA 2IFQA 1YKAA 3VFIA 4ZL9A 3TOTA 2K6VA 2UZ8A 2IMFA 4L0UA 4WR4A 4RQRA 2B6MA 4CY6A 5A5HA 3DVWA 2HSMB 5AIVA 1ERTA 2PPTA 4K2XA 5F06A 3UOMA 1X9WB 4HJ2A 3ZYWA 1ZL9A 2WCIA 1EZKA 1WWJA 3PH9A 1X5EA 4O5QA 1B48A 5IMDA 3KD0A 3KIJA 5F07A 5COHA 3LFLA 4POKA 5CYYA 3C71A 3DXBA 1SL2B 2C3NA 3HDCA 2ALBA 3KP8A 3NIVA 1VF2A 2JL4A 2YJHA 1A0FA 3ED3A 3SWLA 1B4QA 2ZUPA 3ZL5A 2VL2A 2CV4A 3D21A 1PMTA 4IELA 5FWGA 3UBKA 1GP1A 4MZWA 4HOJA 1FB0A 1AQXA 2ES7A 5KN2A 3LGCA 5ECHB 2IWTA 3IPZA 2IL3A 2MMZA 2H1GA 4DVCA 2EFCA 5DQYA 2H6ZA 2JZSA 1ZMAA 5HR1A 2M46A 1SKWB 22GSA 3A2XA 3UIWA 2OACA 5LD0A 3LG6A 1ZYQB 4MP4A 2CAQA 1TRWA 3IHQA 3P90A 1GLPA 4ECBA 4O5UA 5HR0A 2YV9A 4FYBA 16GSA 3CBUA 2LEGA 5DCGA 3PR8A 4ECIA 3IE3A 3QAGA 1M7TA 3LXTA 1GRXA 4HUAA 3Q18A 3IC4A 1YDKA 3WD6A 1TI3A 3LORA 5DJLA 2GT5A 4ZB7A 1S3DA 1HNCA 4QL7A 3WYWA 1Z6NA 1U88A 2VL3A 4EDZA 2LJRA 4FYCA 2QA1A 1PA3A 2HYXA 2FWHA 1GLQA 4IHUA 4GSNA 1SL1B 5J40A 1SYRA 3ZFBA 2ZNMA 4TR1B 3VLNA 1PL1A 1ERUA 2HRKA 1MD4A 3A5IA 4CDOA 4NWYA 4Q5QA 5A4WA 1ZYPA 2VO4A 3QR6A 4HU9A 3RDWA 4XCSA 4OCFA 2FCHA 4J57E 1Y6EA 2VLUA 3EU4A 1JFUA 2OA7A 4ZBBA 2LNTA 3A2WA 3UL3A 1GUHA 1U6TA 1JZDA 1TRSA 5CO3A 1JZRA 3UARA 5EL8A 14GSA 3CTFA 5CP1A 2NVLA 3EE2A 3F4RA 4L0WA 1A2JA 3L9VA 2CVDA 1YEPA 2GGTA 2I81A 1R26A 1GTBA 1CQHA 5IQYA 5DBQA 1FAAA 4GRFA 1VF3A 2HI7A 2LNSA 2VCQA 2CX4A 4RUVA 5A4UA 3O3TA 1GNWA 5IM9A 3ME8A 2H30A 3EPTA 1VF4A 4JU5A 1XW9A 2H19A 2R0PA 3CSHA 4YQUA 4ACSA 2MZCA 5ABRA 2H0HA 4GWRA 2KHPA 1GUMA 3H4KA 3VPQA 1GTUA 1NSWA 1T00A 3M9KA 4MH3A 1BQ7A 2JSYA 1QQ2A 1HD2A 1YZXA 2C0DA 4TXVA 4GTUA 2R37A 2FD3A 5BRTA 4LL1B 1AW9A 6GSVA 4KSMA 3D0ZA 4GSTA 1OKTA 2GSQA 5JCUA 1EGOA 3GNJA 5D9WA 3C1RA 3QFBC 1PL2A 3C1SA 1TW9A 3GX0A 1YF0A 1M0UA 4BPYA 1NHOA 4WR5A 5D8IA 2GQKA 3RAZA 3US3A 2FUG2 2LS5A 3QPMA 5DQSA 5JCGA 2HRAA 4O92A 4LA1A 4GDFA 2GZPA 2X4AA 2PVQA 3TRPA 1R5AA 2P31A 2EFEA 5EY6A 5B6MA 4TXOB 2NPBA 2P5QA 2C0GA 5G1KA 5GAPD 3BCIA 8GSSA 2L4QA 5AN1A 1QXHA 4ECJA 4D73A 2EIOA 2CZ2A 1Q98A 3FR9A 4ML1A 3TGZA 1N25A 4AKXB 1G7OA 4HQSA 5HFGA 4POBA 1JLWA 3VWUA 3FR6A 4ICYA 3V1WA 4CHSA 4LMWA 2L6DA 4BWSA 1NM3A 3LW9A 5J47A 4EUYA 2F8AA 6GSSA 1E2YA 1NW2A 4MJAA 11GSA 1R5PA 1TK5B 2XHFA 3G7JA 1TRUA 5GAND 2RM6A 2OJLA 3GH6A 4MCUA 7GSSA 4DSQA 2LQOA 4KDYA 1KNGA 3LJRA 2YANA 3FRCA 3UJ1A 4K7OA 1R4WA 2TRXA 1EP7A 5KOWA 4GLTA 1K3LA 3GUSA 3HCZA 1K0CA 2MMNA 2DJKA 4X0XA 4V2LA 1GTIA 1HNAA 2F9SA 1TRVA 1G6YA 2R0CA 3NZNA 4LLRA 1XWGA 3ZMKA 2GQLA 2FWGA 1SJIA 5KN0A 2YCDA 3VURA 2EC4A 4AJ8A 2CQ9A 1OE7A 2HLSA 3MDKA 3BJ5A 2L57A 2F3MA 4MF6A 1K3OA 4K2DA 1M99A 2FWEA 5A5KA 4ISDA 1WRYA 5KN1A 4K6XA 3F6FA 2WDUA 3MWHA 2PERA 1T8EB 4BL7A 3ZRDA 3N9JA 4I6XA 4ZXGA 3FW2A 5ELAA 4NMUA 4O32A 4I2UA 5ENUA 1K0MA 2QGVA 5ECIB 5DALA 4OO4A 2H70A 3HZ4A 1ZCPA 2HSNA 2DIZA 5GSTA 3LEFA 4YAVA 4MZBA 1V40A 2LV3A 2B3SA 3KXOA 5DAKB 1B9YC 1FG4A 4EDYA 3A2VA 1YVLA 4QMKA 2B7JA 3DIEA 3UVTA 3PINA 3CWGA 1K0DA 4EO3A 2HRFA 2NBSA 1TU8A 1SK1A 3CSIA 3KTBA 4XS1A 3WT2A 3D4TA 2PGTA 2UV8G 4EIQA 3EVIA 1F9MA 4Z2UA 18GSA 1WOUA 4K9ZA 5J3RA 4HQZA 5B8BA 1A2MA 3BD2A 2F51A 1SKSB 4NHZA 4W66A 4PUFC 1G0TA 5IOXA 1TDIA 3N5OA 1O6JA 2IPAA 3TDGA 17GSA 3QDNA 3O6TA 1XIYA 2C3QA 1LJRA 2C3TA 3TUEA 1QFNA 2R4VA 2H0GA 2H74A 1EV9A 3G7YA 1XVWA 5JCWA 4H86A 4KB3A 3L78A 3TKQA 3KCMA 5IPGA 2V32A 2R6KA 2K8VA 4WKWA 3WT1A 3RHCA 1X5CA 2PUKC 1QK8A 2F8FA 13GSA 1BX9A 2NTOA 2DSAA 3IBHA 5ECOB 5A34A 1PQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCT A;  2C1Y A;  3CYN A;  2HRN A;  3JCM L;  5H5S A;  1WMJ A;  3LXZ A;  4IN0 A;  5H5R A;  2YOI A;  4J56 E;  2CVK A;  5IMZ A;  2L5O A;  4XS4 B;  5INY A;  4ECC A;  4JBB A;  4WBJ A;  4O7H A;  3QD9 A;  5IO2 A;  4AJ7 A;  4JED A;  3CTG A;  1Z7R A;  5D9T A;  2TIR A;  1EV4 A;  2DML A;  4KA0 A;  3ME7 A;  1XW5 A;  3F6D A;  1AIU A;  3IAM 2;  3S9F A;  4FQU A;  3F3R A;  2WGR A;  3VK9 A;  1K0B A;  4K0G A;  2B5E A;  2DJ0 A;  3A3T A;  2QKE A;  2WRT A;  5H5Q A;  5E59 A;  4JRR A;  2I9H A;  5HQP A;  1JLV A;  5G31 A;  2L59 A;  4ZIL A;  4G19 A;  4MMM A;  1FOV A;  1K0O A;  1G7E A;  1HQO A;  4BVX B;  2IIY A;  3PGT A;  4PTS A;  2L4C A;  2IMI A;  2AV4 A;  2VM2 A;  1TK8 B;  4GXZ A;  2FLS A;  3DML A;  4F9Z A;  4F0C A;  1G6W A;  2REM A;  2B5X A;  4BA7 A;  2GZZ A;  4N0Z A;  1XPV A;  3I43 A;  2VLT A;  3TCO A;  4BVY A;  5AIX A;  4WBR D;  1JZO A;  3EC3 A;  1F37 A;  4V2N A;  2I3Y A;  4ZB9 A;  3D6I A;  3GST A;  2DBC A;  3GX8 A;  2V41 A;  1FVJ A;  5CAX A;  2GQM A;  1LU4 A;  3TJK A;  4PNG A;  2HSM A;  4NAX A;  4GQC A;  1TU7 A;  1A8Y A;  1KEB A;  2H1A A;  4RI7 A;  5JWQ B;  1WP0 A;  4V1A p;  2XC2 A;  2P5R A;  2L5L A;  6GSW A;  1XWC A;  3EIN A;  2EIR A;  1GNE A;  1N2A A;  1OC8 A;  4PXO A;  2X8H A;  5F8B A;  4IJI A;  1Z3E A;  3IXR A;  4HDE A;  2B1K A;  2GSS A;  4XS6 A;  2VL2 C;  1X9M B;  1B4P A;  1J9B A;  1XFL A;  4HS1 A;  3E0U A;  4Z7X A;  1FHE A;  5ECN B;  2V6K A;  2AUV A;  2RLI A;  3FEU A;  3ERW A;  1THO A;  4CW9 A;  4TVE A;  4JZQ A;  1IYH A;  3KMN A;  1PKW A;  3BCK A;  3F4T A;  1THX A;  1Z9H A;  1X5D A;  2V1M A;  2PBJ A;  2RM5 A;  4ZL7 A;  1M2A A;  3NOF A;  1YEX A;  2YPM A;  5ECL B;  4ULX A;  3GYK A;  12GS A;  3F4S A;  4PQ1 A;  4KSO A;  2VCX A;  1Y25 A;  2ON7 A;  5J9C A;  1SJ6 A;  1SK2 A;  4IQ1 A;  4IJ3 A;  5KEJ A;  4OWY A;  3L0H A;  2YZH A;  2KP2 A;  5B8A A;  4NXI A;  2C0E A;  2OBK A;  1N8J A;  2R3X A;  2CVB A;  3GHA A;  2VUP A;  2IN3 A;  5EPF A;  2AAW A;  3GN3 A;  4IP6 A;  2RUE A;  2DJ2 A;  3UEM A;  1O81 A;  2O8V B;  5IMV A;  1FVK A;  2QSI A;  1AUC A;  10GS A;  1K3Y A;  3J7Y b;  3M1G A;  1J08 A;  4DSS B;  3LSZ A;  5AGY A;  3GIX A;  2WZ9 A;  3H8Q A;  1BG5 A;  1TTZ A;  3EU3 A;  3TJB A;  2GTU A;  4DEJ A;  1EWX A;  3GV1 A;  5ID2 B;  3EWL A;  4D73 B;  1SK0 A;  3ZVJ D;  4HI7 A;  4OFN A;  4MAB A;  4IKH A;  2VCV A;  4TR1 A;  3ZLP A;  4KDX A;  4ILF A;  2VCW A;  1MEK A;  1TK0 B;  1UVZ A;  5G5F A;  5DDL A;  3ZRE A;  4O5R A;  4L8E A;  1Q4J A;  4KH7 A;  1UA5 A;  4XIH A;  2DC5 A;  1DSB A;  1V57 A;  3IRA A;  3GTU B;  3KGK A;  1A24 A;  3FR3 A;  1BED A;  1GSU A;  5FT3 A;  1M2D A;  4ID0 A;  3IK9 A;  1V98 A;  3DVX A;  4IW9 A;  4TN8 A;  1SJZ A;  4MK3 A;  4I97 A;  5IOW A;  4MPG A;  1BJX A;  4BWQ A;  3LYP A;  3W8J A;  1JHB A;  5ELG A;  2J23 A;  1GSD A;  4ZBA A;  4EE0 A;  5J41 A;  4L5O A;  4E8H A;  2O87 A;  2V2G A;  1SL0 B;  4PNF A;  4KF9 A;  1HNB A;  2DLX A;  4XRD A;  4Q5F A;  2OKA A;  2FA4 A;  1XWA A;  3C7M A;  2HNL A;  4HJM A;  1TKD B;  5G5E A;  4J2F A;  2GS3 A;  1FO5 A;  1XVQ A;  3L4N A;  1F6M C;  6GSU A;  4TR3 A;  4DSR A;  2GT6 A;  2GVP A;  1TP9 A;  3TKS C;  2RII A;  1OC9 B;  3ZIJ A;  2JU5 A;  2WS2 A;  1MDK A;  2XPE A;  4PX1 A;  3HHV A;  1TXX A;  1A23 A;  1RK4 A;  5IO0 A;  1OVN A;  4JR4 A;  4ZL8 A;  2HSN B;  1QMV A;  2GZY A;  2IMD A;  3W8S A;  4F2I A;  4FYU A;  2OE0 A;  2JZT A;  4OO5 A;  4TXO A;  1YY7 A;  3AY8 A;  2AYT A;  2H1B A;  3D5J A;  5A4V A;  2X8G A;  3R2Q A;  3CRU A;  1QUW A;  3L9U A;  3F9U A;  3IR4 A;  2N5A A;  3E3E A;  1SEN A;  2LQQ A;  2DJ3 A;  5CRD A;  1YJ6 A;  3HKR A;  5ECK B;  5GSS A;  4OFT A;  1ZZY A;  1RQM A;  2PVO C;  4MJE A;  2K18 A;  5HR2 A;  1U3A A;  2IME A;  2TRC P;  2HZE B;  4P3Y B;  4N10 A;  3TJF A;  4N11 A;  2N5B A;  2YWN A;  5ECM B;  1GSY A;  2LJA A;  3P8W A;  1PKZ A;  2GST A;  4G9H A;  2X99 A;  4N30 A;  4IP1 A;  5HR3 A;  3GFK A;  1PRX A;  5D96 A;  3GL3 A;  3HD5 A;  1A8L A;  2M72 A;  3C8E A;  4EVM A;  1GUK A;  3CRT A;  2JZR A;  1E6B A;  1OE8 A;  20GS A;  2FA8 A;  1K0N A;  4F82 A;  1PSQ A;  2YP6 A;  5IMF A;  2O7K A;  2C8U A;  4I8B A;  2D2Z A;  2ZCT A;  4ZB8 A;  1WPI A;  1AXD A;  1T4Z A;  2C80 A;  3HJM A;  1GSQ A;  1ERW A;  3DEX A;  2IFQ B;  5AIS A;  3D22 A;  2OE3 A;  2MMA A;  1LBK A;  1SYX A;  1DBY A;  4PUA A;  3FZA A;  2IMK A;  4TOP A;  4JE1 A;  2GLR A;  4PGT A;  3RPP A;  2VD0 A;  1ACV A;  19GS A;  1Z6M A;  1IYI A;  1XCC A;  3IDV A;  3M0F A;  2WFC A;  3FYG A;  3ERG A;  1VGL A;  2HT9 A;  2WJU A;  2L6C A;  3C73 A;  4MJC A;  5FHI A;  5DAK A;  2H76 A;  3RBT A;  2CX3 A;  3TKS E;  3F63 A;  1GUL A;  3VWX A;  4Q5R A;  4YQM A;  2AB6 A;  2H8L A;  3F3Q A;  3I9V 2;  3APS A;  2YWM A;  5CRE A;  3ISO A;  3TJJ A;  4IQA A;  2MYG A;  3KP9 A;  4KDU A;  2HSH A;  2PU9 C;  2V6O A;  4MA9 A;  3FHK A;  3L9S A;  3I6A A;  2FGX A;  2G2Q A;  2KP1 A;  4OMV A;  1GWC A;  1MTC A;  1ON4 A;  5BMU A;  2VOC A;  1OKD A;  3J7Y k;  3IAS 2;  2XBQ A;  3TJG A;  4QQ7 A;  5HFI A;  1EEJ A;  2MBT A;  5JWO B;  1ML6 A;  1GSS A;  2FWF A;  4AGS A;  3VWV A;  3EUR A;  5CNW A;  4TW5 A;  1B8X A;  2E2M A;  3RHB A;  4MDC A;  2VAF A;  3CSJ A;  4ZB6 A;  4L5L A;  1RW1 A;  4AF2 A;  1YF1 A;  3HJP A;  1ZGN A;  3APO A;  4YQV A;  5CRW A;  4FO5 A;  3GH9 A;  3GKN A;  5D93 A;  2J9H A;  4WET A;  2BMX A;  4IS0 A;  5ECQ B;  1SU9 A;  3M8N A;  2CZ3 A;  3DRN A;  4NPB A;  1VF1 A;  1QGV A;  1A0R P;  1S3A A;  1O85 A;  3O76 A;  2HZF A;  4KX4 A;  2RUF A;  6GSX A;  2KOK A;  4MF5 A;  5C00 A;  1W4V A;  3HXS A;  3MAK A;  5IPH A;  4NV2 A;  2O85 A;  4POL A;  3QOU A;  4F03 A;  2G0F A;  4XS4 A;  1GL8 A;  5CRH A;  3KEB A;  4TKY A;  4IBP A;  5ECR B;  3VI7 A;  2VM1 A;  2HRK B;  3TOU A;  3TRQ A;  1A2L A;  1EP8 A;  1V9W A;  1XWK A;  3GSS A;  1JZW A;  4GSS A;  1OC3 A;  3DD3 A;  2KUC A;  1ILO A;  3KH9 A;  3LWA A;  4QL9 A;  1R7H A;  3KM6 A;  3CMI A;  4E8E A;  2VL9 A;  1ERV A;  2HE3 A;  4WF5 A;  2Z9S A;  4G0L A;  2HQT A;  3A5W A;  4K7I A;  4X43 A;  1PX6 A;  4RQX A;  3BOA A;  3DYR A;  2LRN A;  3GKX A;  2WB9 A;  3H79 A;  1EGR A;  4BVX A;  3ZIV A;  1V2A A;  2M80 A;  2CA8 A;  4MH2 A;  2GDR A;  4YH2 A;  3OR5 A;  3DKS A;  1BAY A;  5G1L A;  5E4W A;  2H72 A;  4MLY A;  3MNG A;  2PMT A;  4EC0 A;  3LQ7 A;  5CRG A;  1T1V A;  5J5N A;  3ZZX A;  1S3C A;  4EL1 A;  3UBL A;  3UVH A;  6GSY A;  5DJM A;  3KZQ A;  5D9V A;  4GCI A;  4POM A;  2H1D A;  1GTA A;  4PQI A;  3WGE A;  1CQG A;  2B1L A;  4N0V A;  2H0I A;  1AC1 A;  5L71 A;  3P7X A;  2I1U A;  3HZ8 A;  3TKP A;  1M9A A;  2DJ1 A;  2GSR A;  3KH7 A;  4PUR A;  3IC8 A;  6GST A;  3GKM A;  1BYE A;  2P0G A;  1SKR B;  4HZ2 A;  3TRX A;  1J0F A;  3BBY A;  2H75 A;  3GKK A;  2KLX A;  3KJY A;  2LRT A;  2LST A;  3GMF A;  2X64 A;  3D4M A;  2B5Y A;  2NDO A;  5IMA A;  4G10 A;  1H75 A;  3ERF A;  5HFK A;  4TRX A;  3FKF A;  1T4Y A;  4LL4 B;  4K7N A;  2OE1 A;  1PX7 A;  1F3B A;  4PQH A;  2FY6 A;  5DVB A;  2AJQ B;  1WE0 A;  4OD7 A;  3ZFL A;  1H4O A;  2VIM A;  5G30 A;  3FZ5 A;  2LUS A;  3UAP A;  3QCP A;  4KCA A;  3VI5 A;  1YKC A;  4MPF A;  4EF0 A;  2FHE A;  4MJB A;  4IGJ A;  2YWO A;  4KGI A;  2E7P A;  2EIQ A;  3DWV A;  2LRC A;  3EMP A;  4XHM A;  1AQV A;  1DE2 A;  4HZ4 A;  1NHY A;  2YN1 A;  1ZYE A;  2H71 A;  2QC7 A;  2E2G A;  4GF0 A;  5EVO A;  5B7C A;  3HYP A;  2VCZ A;  5IIZ A;  1O8X A;  4X1U A;  1U87 A;  3QMX A;  3ZML A;  3R3E A;  4USS A;  5F0G A;  1F3A A;  1YQ1 A;  4OFM A;  1EOG A;  3UMA A;  2AHE A;  3Q19 A;  1DE1 A;  1KBN A;  4G0I A;  5J4U A;  2PWJ A;  4ZBD A;  2LKU A;  5ECP B;  3TKS A;  1ABA A;  1TJD A;  3SBC A;  4DSS A;  1XXU A;  3F0I A;  3LYK A;  1WIK A;  5DCH A;  1EOH A;  1B9X C;  2HXK A;  3TKR A;  1W89 A;  5ID2 A;  5ECS A;  1WJK A;  3EMX A;  4I2T A;  3APQ A;  1V58 A;  3M9J A;  2LJK A;  2FNO A;  1X9S B;  2YWI A;  1SD8 A;  2H6X A;  3GRX A;  3IK7 A;  4WEY A;  2X8C A;  4K8M A;  4V2M A;  1XW6 A;  5D9X A;  4KUN A;  2BTO T;  4BL7 B;  1PN9 A;  2YNX A;  3PPU A;  3DGQ A;  5LCZ A;  1GSE A;  3G7I A;  1AAZ A;  4KND A;  5F05 A;  4AJ6 A;  1OYJ A;  2R2J A;  4OCE A;  1XWB A;  3GTU A;  5DAL B;  2K8S A;  2PN8 A;  2OAD A;  1FW1 A;  1EEM A;  2O89 A;  4V1A g;  2HSY A;  3W6G A;  4ZIJ A;  4MZC A;  4NHW A;  4ML6 A;  2VLV A;  5D73 A;  3RPN A;  1XOA A;  1ST9 A;  1TOF A;  2A4V A;  2OBI A;  4YAP A;  2I4A A;  4EKZ A;  2HFD A;  2BJX A;  4GQF A;  3MSZ A;  4RI6 A;  4MF7 A;  4NV5 A;  1DUG A;  3ZTL A;  1T7P B;  2WUL A;  3U5R E;  2MBS A;  3VWW A;  1ZOF A;  1I9D A;  1PD2 1;  3GL5 A;  2DJJ A;  2JAD A;  4WXT A;  3EYT A;  3Q6O A;  4FH8 A;  3TB2 A;  1C72 A;  1O73 A;  1Z5Y E;  1F2E A;  1M9B A;  1I5G A;  1MDJ A;  1AQW A;  3VPT A;  4KAE A;  3KTL A;  3M3M A;  1OC9 A;  5C04 A;  1MD3 A;  5GZZ B;  2XBI A;  1M2B A;  1TI1 A;  4G2E A;  2H01 A;  4G0K A;  4HU7 A;  3HJO A;  3H1N A;  3CXG A;  4Q5N A;  4KE3 A;  3FY7 A;  1URM A;  3GA4 A;  3WGD A;  2CAI A;  3HA9 A;  1O8W A;  4K1F A;  2A2R A;  4TR4 A;  3G9B A;  1XBS A;  3ZVJ A;  1VRS D;  1MDI A;  2XPD A;  3GUR A;  1UC7 A;  1GSF A;  2H66 A;  2YZU A;  5IMC A;  2C0F A;  3FZ4 A;  1X0R A;  4EXJ A;  2K9F A;  1GH2 A;  4FIW A;  2A2S A;  4KCE A;  2HZE A;  3F8U A;  2VD1 A;  1KTE A;  1USB A;  1XOB A;  2ON5 A;  5JWR B;  3QAV A;  2H73 A;  3E9J B;  2DIY A;  2DMM A;  2B7K A;  2YJ7 A;  4F0B A;  4I5Q A;  5LNK e;  3ZIT A;  3HVS A;  3HVV A;  2C4J A;  4KW6 A;  3K8N A;  3P2A A;  3U6V A;  3QFA C;  3FZ9 A;  1O7U A;  3I69 A;  2IJY A;  4XRA A;  1FB6 A;  2CT6 A;  2JAC A;  3IV4 A;  1XZO A;  5KN3 A;  3H93 A;  2LTK A;  2E0Q A;  1UN2 A;  3FK8 A;  4WF4 A;  4XTS A;  3IA1 A;  1Z7P A;  4TR0 A;  4JR6 A;  4IVF A;  2MMO A;  1HYU A;  4HEA 2;  3WGX A;  1OAZ A;  2H6Y A;  3HY2 A;  3QAW A;  2JSZ A;  3KMO A;  9GSS A;  3Q74 A;  1T3B A;  1PGT A;  1K0A A;  2R5G A;  3IOS A;  4BVY B;  4LMV A;  4K0N A;  3HVX A;  2N5F A;  1U3I A;  5J9B A;  1SD9 A;  2YV7 A;  5G2Z A;  5B6N A;  2IFQ A;  1YKA A;  3VFI A;  4ZL9 A;  3TOT A;  2K6V A;  2UZ8 A;  2IMF A;  4L0U A;  4WR4 A;  4RQR A;  2B6M A;  3DVW A;  2HSM B;  5AIV A;  1ERT A;  2PPT A;  5F06 A;  3UOM A;  1X9W B;  4HJ2 A;  3ZYW A;  1ZL9 A;  2WCI A;  1EZK A;  1WWJ A;  3PH9 A;  1X5E A;  1B48 A;  5IMD A;  3KD0 A;  3KIJ A;  5F07 A;  5COH A;  3LFL A;  4POK A;  5CYY A;  3C71 A;  3DXB A;  1SL2 B;  2C3N A;  3HDC A;  2ALB A;  3KP8 A;  3NIV A;  1VF2 A;  2JL4 A;  2YJH A;  1A0F A;  3ED3 A;  3SWL A;  1B4Q A;  2ZUP A;  3ZL5 A;  2VL2 A;  2CV4 A;  3D21 A;  1PMT A;  4IEL A;  5FWG A;  3UBK A;  1GP1 A;  4MZW A;  4HOJ A;  1FB0 A;  1AQX A;  2ES7 A;  5KN2 A;  3LGC A;  5ECH B;  2IWT A;  3IPZ A;  2IL3 A;  2MMZ A;  2H1G A;  4DVC A;  5DQY A;  2H6Z A;  2JZS A;  1ZMA A;  5HR1 A;  2M46 A;  1SKW B;  22GS A;  3A2X A;  3UIW A;  2OAC A;  5LD0 A;  3LG6 A;  1ZYQ B;  4MP4 A;  2CAQ A;  1TRW A;  3IHQ A;  3P90 A;  1GLP A;  4ECB A;  5HR0 A;  4FYB A;  2YV9 A;  16GS A;  3CBU A;  2LEG A;  5DCG A;  3PR8 A;  4ECI A;  3IE3 A;  3QAG A;  1M7T A;  3LXT A;  1GRX A;  4HUA A;  3Q18 A;  3IC4 A;  1YDK A;  3WD6 A;  1TI3 A;  3LOR A;  5DJL A;  2GT5 A;  1S3D A;  1HNC A;  4QL7 A;  3WYW A;  1Z6N A;  1U88 A;  2VL3 A;  4EDZ A;  2LJR A;  4FYC A;  1PA3 A;  2HYX A;  2FWH A;  1GLQ A;  4IHU A;  4GSN A;  1SL1 B;  1SYR A;  3ZFB A;  2ZNM A;  4TR1 B;  3VLN A;  1PL1 A;  1ERU A;  2HRK A;  1MD4 A;  4CDO A;  4NWY A;  4Q5Q A;  5A4W A;  2VO4 A;  3QR6 A;  4HU9 A;  3RDW A;  4XCS A;  4OCF A;  2FCH A;  4J57 E;  1Y6E A;  2VLU A;  3EU4 A;  1JFU A;  2OA7 A;  4ZBB A;  2LNT A;  3A2W A;  3UL3 A;  1GUH A;  1U6T A;  1JZD A;  1TRS A;  5CO3 A;  1JZR A;  3UAR A;  5EL8 A;  14GS A;  3CTF A;  5CP1 A;  2NVL A;  3EE2 A;  3F4R A;  4L0W A;  1A2J A;  3L9V A;  2CVD A;  1YEP A;  2GGT A;  2I81 A;  1R26 A;  1GTB A;  1CQH A;  5IQY A;  5DBQ A;  1FAA A;  4GRF A;  1VF3 A;  2HI7 A;  2LNS A;  2VCQ A;  2CX4 A;  4RUV A;  5A4U A;  3O3T A;  1GNW A;  5IM9 A;  3ME8 A;  2H30 A;  1VF4 A;  4JU5 A;  1XW9 A;  2H19 A;  3CSH A;  4YQU A;  4ACS A;  2MZC A;  5ABR A;  2H0H A;  4GWR A;  2KHP A;  1GUM A;  3H4K A;  3VPQ A;  1GTU A;  1NSW A;  1T00 A;  3M9K A;  4MH3 A;  1BQ7 A;  2JSY A;  1QQ2 A;  1HD2 A;  1YZX A;  2C0D A;  4TXV A;  4GTU A;  2R37 A;  2FD3 A;  4LL1 B;  1AW9 A;  6GSV A;  4KSM A;  3D0Z A;  4GST A;  1OKT A;  2GSQ A;  5JCU A;  1EGO A;  3GNJ A;  5D9W A;  3C1R A;  3QFB C;  1PL2 A;  3C1S A;  1TW9 A;  3GX0 A;  1YF0 A;  1M0U A;  4BPY A;  1NHO A;  4WR5 A;  5D8I A;  2GQK A;  3RAZ A;  3US3 A;  2FUG 2;  2LS5 A;  3QPM A;  5DQS A;  5JCG A;  2HRA A;  4O92 A;  4LA1 A;  2GZP A;  2PVQ A;  3TRP A;  1R5A A;  2P31 A;  5EY6 A;  5B6M A;  4TXO B;  2NPB A;  2P5Q A;  2C0G A;  5G1K A;  5GAP D;  3BCI A;  8GSS A;  2L4Q A;  5AN1 A;  1QXH A;  4ECJ A;  4D73 A;  2EIO A;  2CZ2 A;  1Q98 A;  3FR9 A;  4ML1 A;  3TGZ A;  1G7O A;  4HQS A;  5HFG A;  4POB A;  1JLW A;  3VWU A;  3FR6 A;  3V1W A;  4CHS A;  4LMW A;  2L6D A;  4BWS A;  1NM3 A;  4EUY A;  2F8A A;  6GSS A;  1E2Y A;  1NW2 A;  4MJA A;  11GS A;  1R5P A;  1TK5 B;  2XHF A;  3G7J A;  1TRU A;  5GAN D;  2RM6 A;  2OJL A;  3GH6 A;  4MCU A;  7GSS A;  4DSQ A;  2LQO A;  4KDY A;  1KNG A;  3LJR A;  2YAN A;  3FRC A;  3UJ1 A;  4K7O A;  1R4W A;  2TRX A;  1EP7 A;  4GLT A;  1K3L A;  3GUS A;  3HCZ A;  1K0C A;  2MMN A;  2DJK A;  4X0X A;  4V2L A;  1GTI A;  1HNA A;  2F9S A;  1TRV A;  1G6Y A;  3NZN A;  4LLR A;  1XWG A;  3ZMK A;  2GQL A;  2FWG A;  1SJI A;  5KN0 A;  2YCD A;  3VUR A;  2EC4 A;  4AJ8 A;  2CQ9 A;  1OE7 A;  2HLS A;  3MDK A;  3BJ5 A;  2L57 A;  2F3M A;  4MF6 A;  1K3O A;  4K2D A;  1M99 A;  2FWE A;  5A5K A;  4ISD A;  1WRY A;  5KN1 A;  4K6X A;  3F6F A;  2WDU A;  3MWH A;  2PER A;  1T8E B;  4BL7 A;  3ZRD A;  3N9J A;  4I6X A;  4ZXG A;  3FW2 A;  5ELA A;  4NMU A;  4O32 A;  4I2U A;  5ENU A;  1K0M A;  2QGV A;  5ECI B;  5DAL A;  4OO4 A;  2H70 A;  3HZ4 A;  1ZCP A;  2DIZ A;  5GST A;  3LEF A;  4YAV A;  4MZB A;  1V40 A;  2LV3 A;  2B3S A;  3KXO A;  5DAK B;  1B9Y C;  1FG4 A;  4EDY A;  3A2V A;  2B7J A;  3DIE A;  3UVT A;  3PIN A;  1K0D A;  4EO3 A;  2HRF A;  2NBS A;  1TU8 A;  1SK1 A;  3CSI A;  3KTB A;  4XS1 A;  3WT2 A;  3D4T A;  2PGT A;  3EVI A;  1F9M A;  18GS A;  1WOU A;  4K9Z A;  5J3R A;  4HQZ A;  5B8B A;  1A2M A;  3BD2 A;  2F51 A;  1SKS B;  4NHZ A;  4PUF C;  1G0T A;  5IOX A;  1TDI A;  3N5O A;  1O6J A;  2IPA A;  3TDG A;  17GS A;  3QDN A;  3O6T A;  1XIY A;  2C3Q A;  1LJR A;  2C3T A;  3TUE A;  1QFN A;  2R4V A;  2H0G A;  2H74 A;  1EV9 A;  3G7Y A;  1XVW A;  5JCW A;  4H86 A;  4KB3 A;  3L78 A;  3TKQ A;  3KCM A;  5IPG A;  2V32 A;  2R6K A;  2K8V A;  4WKW A;  3WT1 A;  3RHC A;  1X5C A;  2PUK C;  1QK8 A;  2F8F A;  13GS A;  1BX9 A;  2NTO A;  2DSA A;  3IBH A;  5ECO B;  1PQN A; 
#chains in the Genus database with same CATH topology
 2VCT A;  2C1Y A;  3CYN A;  2HRN A;  3JCM L;  5H5S A;  4PHZ C;  1WMJ A;  3LXZ A;  4IN0 A;  5H5R A;  2YOI A;  4J56 E;  2CVK A;  5IMZ A;  2L5O A;  2WZS A;  4XS4 B;  4ECC A;  5INY A;  4JBB A;  4WBJ A;  4O7H A;  1ZYN A;  3QD9 A;  5IO2 A;  4AJ7 A;  4K5S A;  3HVN A;  4JED A;  3CTG A;  1Z7R A;  5D9T A;  2TIR A;  4E68 A;  1EV4 A;  1YEW C;  2DML A;  4KA0 A;  3ME7 A;  1XW5 A;  3F6D A;  1AIU A;  3IAM 2;  3S9F A;  5A1N B;  4FQU A;  3F3R A;  2WGR A;  3VK9 A;  1K0B A;  4K0G A;  2B5E A;  2DJ0 A;  3A3T A;  2QKE A;  2WRT A;  5H5Q A;  5E59 A;  4JRR A;  2I9H A;  5HQP A;  1JLV A;  4K5R A;  5G31 A;  4YKF A;  2L59 A;  4ZIL A;  4G19 A;  4MMM A;  1FOV A;  1K0O A;  1G7E A;  1HQO A;  4BVX B;  2IIY A;  3PGT A;  4PTS A;  4YKG A;  2L4C A;  2IMI A;  2AV4 A;  2VM2 A;  4AKH A;  1TK8 B;  4GXZ A;  2FLS A;  3DML A;  2WVX A;  4F0C A;  4F9Z A;  1G6W A;  4G01 A;  2REM A;  2B5X A;  4BA7 A;  2GZZ A;  4N0Z A;  1XPV A;  2H1L A;  3I43 A;  2VLT A;  3TCO A;  4BVY A;  5AIX A;  4WBR D;  1JZO A;  3EC3 A;  1F37 A;  4V2N A;  2I3Y A;  4ZB9 A;  3D6I A;  3GST A;  2DBC A;  3GX8 A;  2V41 A;  1FVJ A;  5CAX A;  2GQM A;  1LU4 A;  3TJK A;  4PNG A;  2HSM A;  4NAX A;  4GQC A;  1TU7 A;  1A8Y A;  1KEB A;  2H1A A;  4RI7 A;  5JWQ B;  1WP0 A;  4V1A p;  2XC2 A;  2P5R A;  2L5L A;  6GSW A;  1XWC A;  3EIN A;  2EIR A;  1GNE A;  1N2A A;  1OC8 A;  4PXO A;  2X8H A;  5F8B A;  4IJI A;  1Z3E A;  3IXR A;  4HDE A;  2B1K A;  2GSS A;  4XS6 A;  2VL2 C;  1X9M B;  1B4P A;  1J9B A;  1XFL A;  4HS1 A;  3E0U A;  4Z7X A;  1FHE A;  5ECN B;  2V6K A;  2AUV A;  2RLI A;  3FEU A;  3ERW A;  1THO A;  4CW9 A;  4TVE A;  4JZQ A;  1IYH A;  3KMN A;  1PKW A;  3BCK A;  3F4T A;  1THX A;  1Z9H A;  1X5D A;  2V1M A;  2PBJ A;  2RM5 A;  4ZL7 A;  1M2A A;  3NOF A;  1YEX A;  2YPM A;  5ECL B;  4ULX A;  3GYK A;  12GS A;  4CY8 A;  3F4S A;  4PQ1 A;  4KSO A;  2VCX A;  1Y25 A;  2ON7 A;  5J9C A;  1SJ6 A;  1SK2 A;  4IQ1 A;  4IJ3 A;  5KEJ A;  4OWY A;  3L0H A;  2A4H A;  2YZH A;  2KP2 A;  5B8A A;  4NXI A;  2C0E A;  2OBK A;  1N8J A;  2R3X A;  2CVB A;  3GHA A;  2VUP A;  2IN3 A;  5EPF A;  2AAW A;  3GN3 A;  4IP6 A;  2RUE A;  2DJ2 A;  3UEM A;  1O81 A;  2O8V B;  5IMV A;  1FVK A;  2QSI A;  1AUC A;  10GS A;  1K3Y A;  3J7Y b;  3M1G A;  1J08 A;  4DSS B;  3LSZ A;  5AGY A;  3GIX A;  2O36 A;  1M3I A;  2WZ9 A;  3H8Q A;  1BG5 A;  1TTZ A;  3EU3 A;  3TJB A;  2GTU A;  4DEJ A;  1EWX A;  3GV1 A;  5ID2 B;  3EWL A;  4D73 B;  1SK0 A;  2DKH A;  3ZVJ D;  4HI7 A;  4OFN A;  4MAB A;  4IKH A;  2VCV A;  4TR1 A;  3ZLP A;  4AKI A;  5J4Y A;  4KDX A;  4ILF A;  2VCW A;  3MYD A;  1MEK A;  1TK0 B;  1UVZ A;  5G5F A;  5DDL A;  3ZRE A;  4O5R A;  2O5V A;  4L8E A;  1Q4J A;  4KH7 A;  1UA5 A;  4XIH A;  2DC5 A;  1DSB A;  1V57 A;  3IRA A;  3GTU B;  3KGK A;  1A24 A;  2OT3 A;  3FR3 A;  1BED A;  1GSU A;  5FT3 A;  1M2D A;  4ID0 A;  3IK9 A;  1V98 A;  3DVX A;  4IW9 A;  4TN8 A;  1SJZ A;  4MK3 A;  4I97 A;  5IOW A;  4MPG A;  1BJX A;  4BWQ A;  3LYP A;  3W8J A;  1JHB A;  5ELG A;  2J23 A;  1GSD A;  4ZBA A;  4EE0 A;  5J41 A;  4L5O A;  4E8H A;  2O87 A;  2V2G A;  1SL0 B;  4PNF A;  4KF9 A;  1HNB A;  2DLX A;  4XRD A;  4Q5F A;  2OKA A;  2FA4 A;  1XWA A;  3C7M A;  2HNL A;  4HJM A;  1TKD B;  4PI2 C;  5G5E A;  4J2F A;  2GS3 A;  1FO5 A;  1PFO A;  1XVQ A;  3L4N A;  1F6M C;  6GSU A;  4TR3 A;  4DSR A;  2GT6 A;  4AI6 A;  2GVP A;  1TP9 A;  3TKS C;  2RII A;  1OC9 B;  3ZIJ A;  2JU5 A;  2WS2 A;  1MDK A;  2XPE A;  4PX1 A;  3HHV A;  1TXX A;  1A23 A;  1RK4 A;  5IO0 A;  1OVN A;  4JR4 A;  4ZL8 A;  2HSN B;  1QMV A;  2GZY A;  2IMD A;  3W8S A;  4F2I A;  4FYU A;  2OE0 A;  2JZT A;  4OO5 A;  4TXO A;  1YY7 A;  3AY8 A;  2AYT A;  2H1B A;  3D5J A;  5A4V A;  2X8G A;  3R2Q A;  3CRU A;  1QUW A;  3L9U A;  3F9U A;  3IR4 A;  2N5A A;  3E3E A;  1SEN A;  2LQQ A;  2DJ3 A;  5CRD A;  1YJ6 A;  3HKR A;  5ECK B;  5GSS A;  4OFT A;  1ZZY A;  2WW0 A;  1RQM A;  2PVO C;  4MJE A;  2K18 A;  3TU3 B;  5HR2 A;  1U3A A;  2IME A;  2TRC P;  2HZE B;  4P3Y B;  4N10 A;  3TJF A;  4N11 A;  2N5B A;  2YWN A;  5ECM B;  1GSY A;  2LJA A;  3P8W A;  1PKZ A;  2GST A;  4G9H A;  2X99 A;  4N30 A;  4IP1 A;  5HR3 A;  3GFK A;  1PRX A;  1XG8 A;  5D96 A;  1SVO A;  3GL3 A;  3HD5 A;  2EFH A;  1A8L A;  2M72 A;  3C8E A;  4EVM A;  1GUK A;  3CRT A;  2JZR A;  1E6B A;  1OE8 A;  20GS A;  2FA8 A;  1K0N A;  4F82 A;  1PSQ A;  2YP6 A;  5IMF A;  2O7K A;  2C8U A;  4I8B A;  2D2Z A;  2ZCT A;  4ZB8 A;  1WPI A;  1AXD A;  1T4Z A;  2C80 A;  3HJM A;  1GSQ A;  1ERW A;  3DEX A;  2IFQ B;  5AIS A;  3D22 A;  2OE3 A;  2MMA A;  4EIP A;  1LBK A;  1SYX A;  1DBY A;  2QA2 A;  4PUA A;  3FZA A;  5A5H B;  2IMK A;  4TOP A;  4JE1 A;  2GLR A;  4PGT A;  3RPP A;  2VD0 A;  1ACV A;  2X49 A;  19GS A;  1Z6M A;  1IYI A;  1XCC A;  3IDV A;  3M0F A;  2WFC A;  3FYG A;  3ERG A;  1VGL A;  2HT9 A;  2WJU A;  2L6C A;  3C73 A;  4MJC A;  5FHI A;  5DAK A;  2H76 A;  3RBT A;  2CX3 A;  3TKS E;  3F63 A;  1GUL A;  3VWX A;  4Q5R A;  4YQM A;  2AB6 A;  2H8L A;  3F3Q A;  3I9V 2;  3APS A;  2YWM A;  1BG1 A;  5CRE A;  3ISO A;  3TJJ A;  4IQA A;  2MYG A;  3KP9 A;  4KDU A;  2HSH A;  2PU9 C;  2V6O A;  4MA9 A;  3FHK A;  3IHG A;  3L9S A;  3I6A A;  2FGX A;  2G2Q A;  2KP1 A;  4OMV A;  1GWC A;  1MTC A;  1ON4 A;  5BMU A;  2VOC A;  2DKI A;  1OKD A;  3J7Y k;  3IAS 2;  2XBQ A;  3TJG A;  4QQ7 A;  5HFI A;  1EEJ A;  2MBT A;  5JWO B;  1ML6 A;  1GSS A;  2FWF A;  2R0G A;  4AGS A;  3VWV A;  3EUR A;  5CNW A;  4TW5 A;  1B8X A;  2E2M A;  1I1I P;  3RHB A;  4MDC A;  2VAF A;  3CSJ A;  4ZB6 A;  4L5L A;  1RW1 A;  4AF2 A;  3MIX A;  1YF1 A;  3HJP A;  1ZGN A;  3APO A;  4YQV A;  5CRW A;  4FO5 A;  3GH9 A;  3GKN A;  5D93 A;  2J9H A;  4WET A;  2BMX A;  4IS0 A;  5ECQ B;  1SU9 A;  3M8N A;  2CZ3 A;  3DRN A;  4NPB A;  1VF1 A;  1QGV A;  1A0R P;  1S3A A;  1O85 A;  3O76 A;  2HZF A;  4Z2R A;  4KX4 A;  2RUF A;  6GSX A;  2KOK A;  4MF5 A;  5C00 A;  1W4V A;  3HXS A;  3MAK A;  5IPH A;  3HMJ G;  4NV2 A;  2O85 A;  4POL A;  3QOU A;  4F03 A;  2G0F A;  4XS4 A;  1GL8 A;  5CRH A;  3KEB A;  4TKY A;  4IBP A;  5ECR B;  3VI7 A;  2VM1 A;  2HRK B;  3TOU A;  3TRQ A;  1A2L A;  1EP8 A;  1V9W A;  1XWK A;  3GSS A;  1JZW A;  4GSS A;  1OC3 A;  3DD3 A;  2WW1 A;  2KUC A;  1ILO A;  3KH9 A;  5A1N A;  3FMW A;  3LWA A;  4QL9 A;  1R7H A;  3KM6 A;  3CMI A;  4E8E A;  2VL9 A;  1ERV A;  2HE3 A;  4WF5 A;  2Z9S A;  4G0L A;  2HQT A;  3A5W A;  4K7I A;  3CHX C;  4X43 A;  1PX6 A;  4RQX A;  3BOA A;  3DYR A;  2LRN A;  3GKX A;  2WB9 A;  3H79 A;  1EGR A;  4BVX A;  3ZIV A;  1V2A A;  2M80 A;  2CA8 A;  4MH2 A;  2GDR A;  4YH2 A;  3OR5 A;  3DKS A;  1BAY A;  5G1L A;  5E4W A;  2H72 A;  4MLY A;  3MNG A;  2PMT A;  4EC0 A;  3LQ7 A;  5CRG A;  1T1V A;  5J5N A;  3ZZX A;  1S3C A;  4EL1 A;  3UBL A;  3UVH A;  6GSY A;  5DJM A;  3KZQ A;  5D9V A;  4GCI A;  4POM A;  2H1D A;  5J4V A;  1GTA A;  4PQI A;  3WGE A;  1CQG A;  2B1L A;  4N0V A;  2H0I A;  1AC1 A;  5L71 A;  3P7X A;  2I1U A;  3HZ8 A;  3TKP A;  1M9A A;  2DJ1 A;  2GSR A;  3KH7 A;  4PUR A;  3IC8 A;  6GST A;  3GKM A;  1BYE A;  2P0G A;  1SKR B;  4HZ2 A;  3TRX A;  4FXY P;  1J0F A;  3BBY A;  2H75 A;  3GKK A;  2KLX A;  3KJY A;  2LRT A;  2LST A;  3GMF A;  2X64 A;  3D4M A;  2B5Y A;  2NDO A;  5IMA A;  4G10 A;  1H75 A;  3ERF A;  5HFK A;  4TRX A;  3FKF A;  1T4Y A;  4LL4 B;  4K7N A;  2OE1 A;  1PX7 A;  1F3B A;  4PQH A;  2FY6 A;  5DVB A;  2AJQ B;  1WE0 A;  4OD7 A;  3ZFL A;  1H4O A;  2VIM A;  5G30 A;  3FZ5 A;  2LUS A;  3UAP A;  1M3J A;  3QCP A;  4KCA A;  3VI5 A;  1YKC A;  4MPF A;  4EF0 A;  2FHE A;  4MJB A;  4IGJ A;  2YWO A;  4KGI A;  2E7P A;  2EIQ A;  3DWV A;  2LRC A;  3EMP A;  4XHM A;  1AQV A;  1DE2 A;  4HZ4 A;  1NHY A;  2YN1 A;  1ZYE A;  2H71 A;  2QC7 A;  2E2G A;  4GF0 A;  5EVO A;  5B7C A;  3HYP A;  2VCZ A;  5IIZ A;  1O8X A;  4X1U A;  1U87 A;  3QMX A;  3ZML A;  3R3E A;  4USS A;  5F0G A;  1F3A A;  1YQ1 A;  4OFM A;  1EOG A;  3UMA A;  2VKZ G;  2AHE A;  3Q19 A;  4X4J A;  1DE1 A;  1KBN A;  4G0I A;  5J4U A;  2PWJ A;  4ZBD A;  2LKU A;  4HSC X;  5ECP B;  3TKS A;  1ABA A;  1TJD A;  3SBC A;  4DSS A;  1XXU A;  3F0I A;  3LYK A;  1WIK A;  5DCH A;  1EOH A;  1B9X C;  2HXK A;  3TKR A;  1W89 A;  5ID2 A;  5ECS A;  1WJK A;  3EMX A;  4I2T A;  3APQ A;  2A2P A;  1V58 A;  3M9J A;  2LJK A;  2FNO A;  1X9S B;  2YWI A;  1SD8 A;  2H6X A;  3GRX A;  3IK7 A;  4WEY A;  2X8C A;  4K8M A;  4V2M A;  4N3Z A;  1XW6 A;  5D9X A;  4KUN A;  2BTO T;  4BL7 B;  1PN9 A;  2YNX A;  3PPU A;  3DGQ A;  5LCZ A;  3G7I A;  1GSE A;  1AAZ A;  4KND A;  5F05 A;  4AJ6 A;  1OYJ A;  2R2J A;  4OCE A;  1XWB A;  3GTU A;  5DAL B;  2K8S A;  2PN8 A;  2OAD A;  1SVM A;  1BF5 A;  1FW1 A;  1EEM A;  2O89 A;  4V1A g;  2HSY A;  3W6G A;  4ZIJ A;  4MZC A;  4NHW A;  4ML6 A;  2VLV A;  5D73 A;  3RPN A;  2EFD A;  1XOA A;  1ST9 A;  1TOF A;  2A4V A;  4MNN A;  2OBI A;  2O3E A;  4YAP A;  2I4A A;  4EKZ A;  4A5P A;  2HFD A;  1Y1U A;  2BJX A;  4GQF A;  3MSZ A;  4RI6 A;  4MF7 A;  4NV5 A;  1DUG A;  3ZTL A;  1T7P B;  2WUL A;  3U5R E;  2MBS A;  3VWW A;  1ZOF A;  1I9D A;  1PD2 1;  3GL5 A;  2DJJ A;  2JAD A;  4WXT A;  3EYT A;  3Q6O A;  4FH8 A;  3TB2 A;  1C72 A;  1O73 A;  1Z5Y E;  1F2E A;  1M9B A;  1I5G A;  1MDJ A;  1AQW A;  3VPT A;  4KAE A;  4AKG A;  3KTL A;  4Z2T A;  3M3M A;  1OC9 A;  5C04 A;  1MD3 A;  5GZZ B;  2XBI A;  1M2B A;  1TI1 A;  4G2E A;  2H01 A;  4G0K A;  4HU7 A;  3HJO A;  5A34 B;  3H1N A;  3CXG A;  4Q5N A;  4KE3 A;  3FY7 A;  1URM A;  3GA4 A;  3WGD A;  2CAI A;  3HA9 A;  1TXU A;  1O8W A;  4K1F A;  2A2R A;  4TR4 A;  3G9B A;  1XBS A;  1PN0 A;  3ZVJ A;  1VRS D;  1MDI A;  2XPD A;  3GUR A;  1UC7 A;  1GSF A;  2H66 A;  2YZU A;  5IMC A;  2C0F A;  3FZ4 A;  1FOH A;  1X0R A;  4EXJ A;  2K9F A;  1GH2 A;  5BMU B;  4FIW A;  2A2S A;  4KCE A;  2HZE A;  3F8U A;  2VD1 A;  1KTE A;  1USB A;  1XOB A;  2ON5 A;  5JWR B;  3QAV A;  2H73 A;  3E9J B;  2DIY A;  2DMM A;  2B7K A;  2YJ7 A;  4F0B A;  4I5Q A;  5LNK e;  3ZIT A;  3HVS A;  3HVV A;  2C4J A;  4KW6 A;  3K8N A;  3P2A A;  3U6V A;  3QFA C;  3FZ9 A;  1O7U A;  3I69 A;  2IJY A;  4XRA A;  1FB6 A;  2CT6 A;  2JAC A;  3IV4 A;  1XZO A;  5KN3 A;  3H93 A;  1SVL A;  2LTK A;  2E0Q A;  5KOX A;  1UN2 A;  3FK8 A;  4WF4 A;  4XTS A;  3IA1 A;  1Z7P A;  4TR0 A;  4JR6 A;  2WVX B;  4IVF A;  2MMO A;  1HYU A;  4HEA 2;  3WGX A;  1OAZ A;  2H6Y A;  3HY2 A;  3QAW A;  2JSZ A;  3KMO A;  9GSS A;  3Q74 A;  1T3B A;  1PGT A;  1K0A A;  2R5G A;  3IOS A;  4BVY B;  4LMV A;  4K0N A;  3HVX A;  2N5F A;  1U3I A;  5J9B A;  3CQF A;  1SD9 A;  2YV7 A;  5G2Z A;  5B6N A;  2IFQ A;  1YKA A;  3VFI A;  4ZL9 A;  3TOT A;  2K6V A;  2UZ8 A;  2IMF A;  4L0U A;  4WR4 A;  1S4B P;  4RQR A;  2B6M A;  4CY6 A;  5A5H A;  3DVW A;  2HSM B;  5AIV A;  1ERT A;  2PPT A;  4K2X A;  5F06 A;  3UOM A;  1X9W B;  4HJ2 A;  3ZYW A;  1ZL9 A;  2WCI A;  1EZK A;  1WWJ A;  3PH9 A;  1X5E A;  4O5Q A;  1B48 A;  5IMD A;  3KD0 A;  3KIJ A;  5F07 A;  5COH A;  3LFL A;  4POK A;  5CYY A;  3C71 A;  3DXB A;  1SL2 B;  2C3N A;  3HDC A;  2ALB A;  3KP8 A;  3NIV A;  1VF2 A;  2JL4 A;  2YJH A;  1A0F A;  3ED3 A;  3SWL A;  1B4Q A;  4BIK A;  2ZUP A;  3ZL5 A;  2VL2 A;  2CV4 A;  3D21 A;  1PMT A;  4IEL A;  5FWG A;  3UBK A;  1GP1 A;  4MZW A;  4HOJ A;  1FB0 A;  1AQX A;  2ES7 A;  5KN2 A;  3LGC A;  5ECH B;  2IWT A;  3IPZ A;  2IL3 A;  2MMZ A;  2H1G A;  4DVC A;  2EFC A;  5DQY A;  2H6Z A;  2JZS A;  1ZMA A;  5HR1 A;  2M46 A;  1SKW B;  22GS A;  3A2X A;  3UIW A;  2OAC A;  5LD0 A;  3LG6 A;  1ZYQ B;  4MP4 A;  2CAQ A;  1TRW A;  3IHQ A;  3P90 A;  1GLP A;  4ECB A;  4O5U A;  5HR0 A;  2YV9 A;  4FYB A;  16GS A;  3CBU A;  2LEG A;  5DCG A;  3PR8 A;  4ECI A;  3IE3 A;  3QAG A;  1M7T A;  3LXT A;  1GRX A;  4HUA A;  3Q18 A;  3IC4 A;  1YDK A;  3WD6 A;  1TI3 A;  3LOR A;  5DJL A;  2WVY A;  2GT5 A;  4ZB7 A;  1S3D A;  1HNC A;  4QL7 A;  3WYW A;  1Z6N A;  1U88 A;  2VL3 A;  4EDZ A;  2LJR A;  4FYC A;  2QA1 A;  3RGB C;  1PA3 A;  2HYX A;  2FWH A;  1GLQ A;  4IHU A;  4GSN A;  1SL1 B;  5J40 A;  1SYR A;  3ZFB A;  2ZNM A;  4TR1 B;  3VLN A;  1PL1 A;  1ERU A;  2HRK A;  1MD4 A;  3A5I A;  4CDO A;  4NWY A;  4Q5Q A;  5A4W A;  1ZYP A;  2VO4 A;  3QR6 A;  4HU9 A;  3RDW A;  4XCS A;  4OCF A;  2FCH A;  4J57 E;  1Y6E A;  2VLU A;  3EU4 A;  1JFU A;  2OA7 A;  4ZBB A;  2LNT A;  3A2W A;  3UL3 A;  1GUH A;  1U6T A;  1JZD A;  2WW3 A;  1TRS A;  5CO3 A;  1JZR A;  3UAR A;  5EL8 A;  14GS A;  3CTF A;  5CP1 A;  2NVL A;  3EE2 A;  3F4R A;  4L0W A;  1A2J A;  3L9V A;  2CVD A;  1YEP A;  2GGT A;  2I81 A;  1R26 A;  1GTB A;  1CQH A;  5IQY A;  5DBQ A;  1FAA A;  4GRF A;  1VF3 A;  2HI7 A;  2LNS A;  2VCQ A;  2CX4 A;  4RUV A;  5A4U A;  1GNW A;  3O3T A;  5IM9 A;  3ME8 A;  2H30 A;  3EPT A;  1VF4 A;  4JU5 A;  4PI0 C;  1XW9 A;  2H19 A;  1S3R A;  2R0P A;  3CSH A;  4YQU A;  4ACS A;  2MZC A;  5ABR A;  2H0H A;  4GWR A;  2KHP A;  1GUM A;  3H4K A;  3VPQ A;  1GTU A;  1NSW A;  1T00 A;  3M9K A;  4MH3 A;  1BQ7 A;  2JSY A;  1QQ2 A;  1HD2 A;  1YZX A;  2C0D A;  4TXV A;  4GTU A;  2R37 A;  2FD3 A;  5BRT A;  4LL1 B;  1AW9 A;  6GSV A;  4KSM A;  3D0Z A;  4GST A;  1OKT A;  2GSQ A;  5JCU A;  1EGO A;  3GNJ A;  5D9W A;  3C1R A;  3QFB C;  1PL2 A;  3C1S A;  1TW9 A;  3GX0 A;  1YF0 A;  1M0U A;  4BPY A;  1NHO A;  4WR5 A;  5D8I A;  2GQK A;  3RAZ A;  3US3 A;  2FUG 2;  2LS5 A;  3QPM A;  5DQS A;  2WW2 A;  5JCG A;  2HRA A;  4O92 A;  4LA1 A;  4GDF A;  2GZP A;  2X4A A;  2PVQ A;  3TRP A;  1R5A A;  2P31 A;  2EFE A;  5EY6 A;  5B6M A;  4TXO B;  2NPB A;  2P5Q A;  2C0G A;  5G1K A;  5GAP D;  3BCI A;  8GSS A;  2L4Q A;  5AN1 A;  1QXH A;  4ECJ A;  4D73 A;  2EIO A;  2CZ2 A;  1Q98 A;  3FR9 A;  4ML1 A;  3TGZ A;  1N25 A;  4AKX B;  1G7O A;  4HQS A;  5HFG A;  4POB A;  1JLW A;  3VWU A;  3FR6 A;  4ICY A;  3V1W A;  4CHS A;  4LMW A;  2L6D A;  4BWS A;  1NM3 A;  3LW9 A;  5J47 A;  4EUY A;  2F8A A;  6GSS A;  1E2Y A;  1NW2 A;  4MJA A;  11GS A;  1R5P A;  1TK5 B;  2XHF A;  3G7J A;  1TRU A;  5GAN D;  2RM6 A;  2OJL A;  3GH6 A;  4MCU A;  7GSS A;  4DSQ A;  2LQO A;  4KDY A;  1KNG A;  3LJR A;  2YAN A;  3FRC A;  3UJ1 A;  4K7O A;  1R4W A;  2TRX A;  1EP7 A;  5KOW A;  4GLT A;  1K3L A;  3GUS A;  3HCZ A;  1K0C A;  2MMN A;  2DJK A;  4X0X A;  4V2L A;  1GTI A;  1HNA A;  2F9S A;  1TRV A;  1G6Y A;  2R0C A;  3NZN A;  4LLR A;  1XWG A;  3ZMK A;  2GQL A;  2FWG A;  1SJI A;  5KN0 A;  2YCD A;  3VUR A;  2EC4 A;  4AJ8 A;  2CQ9 A;  1OE7 A;  2HLS A;  3MDK A;  3BJ5 A;  2L57 A;  2F3M A;  4MF6 A;  1K3O A;  4K2D A;  1M99 A;  2FWE A;  5A5K A;  4ISD A;  1WRY A;  5KN1 A;  4K6X A;  3F6F A;  2WDU A;  3MWH A;  2PER A;  1T8E B;  4BL7 A;  3ZRD A;  3N9J A;  4I6X A;  4ZXG A;  3FW2 A;  5ELA A;  4NMU A;  4O32 A;  4I2U A;  5ENU A;  1K0M A;  2QGV A;  5ECI B;  5DAL A;  4OO4 A;  2H70 A;  3HZ4 A;  3RFR C;  1ZCP A;  2HSN A;  2DIZ A;  5GST A;  3LEF A;  4YAV A;  4MZB A;  1V40 A;  2LV3 A;  2B3S A;  3KXO A;  5DAK B;  1B9Y C;  1FG4 A;  4EDY A;  3A2V A;  1YVL A;  4QMK A;  2B7J A;  3DIE A;  3UVT A;  3PIN A;  3CWG A;  1K0D A;  4EO3 A;  2HRF A;  2NBS A;  1TU8 A;  1SK1 A;  3CSI A;  3KTB A;  4XS1 A;  3WT2 A;  3D4T A;  2PGT A;  2UV8 G;  4EIQ A;  3EVI A;  1F9M A;  4Z2U A;  18GS A;  1WOU A;  4K9Z A;  5J3R A;  4HQZ A;  5B8B A;  1A2M A;  3BD2 A;  2F51 A;  1SKS B;  4NHZ A;  4W66 A;  4PUF C;  1G0T A;  5IOX A;  1TDI A;  3N5O A;  1O6J A;  2IPA A;  3TDG A;  17GS A;  3QDN A;  3O6T A;  1XIY A;  2C3Q A;  1LJR A;  2C3T A;  3TUE A;  1QFN A;  2WVZ A;  2R4V A;  2H0G A;  2H74 A;  1EV9 A;  3G7Y A;  1XVW A;  5JCW A;  4H86 A;  4KB3 A;  3L78 A;  3TKQ A;  3KCM A;  5IPG A;  2V32 A;  2R6K A;  2K8V A;  4WKW A;  3WT1 A;  3RHC A;  1X5C A;  2PUK C;  1QK8 A;  2F8F A;  13GS A;  1BX9 A;  2NTO A;  2DSA A;  3IBH A;  5ECO B;  5A34 A;  1PQN A; 
#chains in the Genus database with same CATH homology
 2VCT A;  2C1Y A;  3CYN A;  2HRN A;  3JCM L;  5H5S A;  1WMJ A;  3LXZ A;  4IN0 A;  5H5R A;  2YOI A;  4J56 E;  2CVK A;  5IMZ A;  2L5O A;  4XS4 B;  5INY A;  4ECC A;  4JBB A;  4WBJ A;  4O7H A;  1ZYN A;  3QD9 A;  5IO2 A;  4AJ7 A;  4K5S A;  4JED A;  3CTG A;  1Z7R A;  5D9T A;  2TIR A;  4E68 A;  1EV4 A;  2DML A;  4KA0 A;  3ME7 A;  1XW5 A;  3F6D A;  1AIU A;  3IAM 2;  3S9F A;  5A1N B;  4FQU A;  3F3R A;  2WGR A;  3VK9 A;  1K0B A;  4K0G A;  2B5E A;  2DJ0 A;  3A3T A;  2QKE A;  2WRT A;  5H5Q A;  5E59 A;  4JRR A;  2I9H A;  5HQP A;  1JLV A;  4K5R A;  5G31 A;  4YKF A;  2L59 A;  4ZIL A;  4G19 A;  4MMM A;  1FOV A;  1K0O A;  1G7E A;  1HQO A;  4BVX B;  2IIY A;  3PGT A;  4PTS A;  4YKG A;  2L4C A;  2IMI A;  2AV4 A;  2VM2 A;  4AKH A;  1TK8 B;  4GXZ A;  2FLS A;  3DML A;  4F9Z A;  4F0C A;  1G6W A;  4G01 A;  2REM A;  2B5X A;  4BA7 A;  2GZZ A;  4N0Z A;  1XPV A;  2H1L A;  3I43 A;  2VLT A;  3TCO A;  4BVY A;  5AIX A;  4WBR D;  1JZO A;  3EC3 A;  1F37 A;  4V2N A;  2I3Y A;  4ZB9 A;  3D6I A;  3GST A;  2DBC A;  3GX8 A;  2V41 A;  1FVJ A;  5CAX A;  2GQM A;  1LU4 A;  3TJK A;  4PNG A;  2HSM A;  4NAX A;  4GQC A;  1TU7 A;  1A8Y A;  1KEB A;  2H1A A;  4RI7 A;  5JWQ B;  1WP0 A;  4V1A p;  2XC2 A;  2P5R A;  2L5L A;  6GSW A;  1XWC A;  3EIN A;  2EIR A;  1GNE A;  1N2A A;  1OC8 A;  4PXO A;  2X8H A;  5F8B A;  4IJI A;  1Z3E A;  3IXR A;  4HDE A;  2B1K A;  2GSS A;  4XS6 A;  2VL2 C;  1X9M B;  1B4P A;  1J9B A;  1XFL A;  4HS1 A;  3E0U A;  4Z7X A;  1FHE A;  5ECN B;  2V6K A;  2AUV A;  2RLI A;  3FEU A;  3ERW A;  1THO A;  4CW9 A;  4TVE A;  4JZQ A;  1IYH A;  3KMN A;  1PKW A;  3BCK A;  3F4T A;  1THX A;  1Z9H A;  1X5D A;  2V1M A;  2PBJ A;  2RM5 A;  4ZL7 A;  1M2A A;  3NOF A;  1YEX A;  2YPM A;  5ECL B;  4ULX A;  3GYK A;  12GS A;  4CY8 A;  3F4S A;  4PQ1 A;  4KSO A;  2VCX A;  1Y25 A;  2ON7 A;  5J9C A;  1SJ6 A;  1SK2 A;  4IQ1 A;  4IJ3 A;  5KEJ A;  4OWY A;  3L0H A;  2A4H A;  2YZH A;  2KP2 A;  5B8A A;  4NXI A;  2C0E A;  2OBK A;  1N8J A;  2R3X A;  2CVB A;  3GHA A;  2VUP A;  2IN3 A;  5EPF A;  2AAW A;  3GN3 A;  4IP6 A;  2RUE A;  2DJ2 A;  3UEM A;  1O81 A;  2O8V B;  5IMV A;  1FVK A;  2QSI A;  1AUC A;  10GS A;  1K3Y A;  3J7Y b;  3M1G A;  1J08 A;  4DSS B;  3LSZ A;  5AGY A;  3GIX A;  2WZ9 A;  3H8Q A;  1BG5 A;  1TTZ A;  3EU3 A;  3TJB A;  2GTU A;  4DEJ A;  1EWX A;  3GV1 A;  5ID2 B;  3EWL A;  4D73 B;  1SK0 A;  2DKH A;  3ZVJ D;  4HI7 A;  4OFN A;  4MAB A;  4IKH A;  2VCV A;  4TR1 A;  3ZLP A;  4AKI A;  5J4Y A;  4KDX A;  4ILF A;  2VCW A;  3MYD A;  1MEK A;  1TK0 B;  1UVZ A;  5G5F A;  5DDL A;  3ZRE A;  4O5R A;  2O5V A;  4L8E A;  1Q4J A;  4KH7 A;  1UA5 A;  4XIH A;  2DC5 A;  1DSB A;  1V57 A;  3IRA A;  3GTU B;  3KGK A;  1A24 A;  2OT3 A;  3FR3 A;  1BED A;  1GSU A;  5FT3 A;  1M2D A;  4ID0 A;  3IK9 A;  1V98 A;  3DVX A;  4IW9 A;  4TN8 A;  1SJZ A;  4MK3 A;  4I97 A;  5IOW A;  4MPG A;  1BJX A;  4BWQ A;  3LYP A;  3W8J A;  1JHB A;  5ELG A;  2J23 A;  1GSD A;  4ZBA A;  4EE0 A;  5J41 A;  4L5O A;  4E8H A;  2O87 A;  2V2G A;  1SL0 B;  4PNF A;  4KF9 A;  1HNB A;  2DLX A;  4XRD A;  4Q5F A;  2OKA A;  2FA4 A;  1XWA A;  3C7M A;  2HNL A;  4HJM A;  1TKD B;  5G5E A;  4J2F A;  2GS3 A;  1FO5 A;  1XVQ A;  3L4N A;  1F6M C;  6GSU A;  4TR3 A;  4DSR A;  2GT6 A;  4AI6 A;  2GVP A;  1TP9 A;  3TKS C;  2RII A;  1OC9 B;  3ZIJ A;  2JU5 A;  2WS2 A;  1MDK A;  2XPE A;  4PX1 A;  3HHV A;  1TXX A;  1A23 A;  1RK4 A;  5IO0 A;  1OVN A;  4JR4 A;  4ZL8 A;  2HSN B;  1QMV A;  2GZY A;  2IMD A;  3W8S A;  4F2I A;  4FYU A;  2OE0 A;  2JZT A;  4OO5 A;  4TXO A;  1YY7 A;  3AY8 A;  2AYT A;  2H1B A;  3D5J A;  5A4V A;  2X8G A;  3R2Q A;  3CRU A;  1QUW A;  3L9U A;  3F9U A;  3IR4 A;  2N5A A;  3E3E A;  1SEN A;  2LQQ A;  2DJ3 A;  5CRD A;  1YJ6 A;  3HKR A;  5ECK B;  5GSS A;  4OFT A;  1ZZY A;  1RQM A;  2PVO C;  4MJE A;  2K18 A;  3TU3 B;  5HR2 A;  1U3A A;  2IME A;  2TRC P;  2HZE B;  4P3Y B;  4N10 A;  3TJF A;  4N11 A;  2N5B A;  2YWN A;  5ECM B;  1GSY A;  2LJA A;  3P8W A;  1PKZ A;  2GST A;  4G9H A;  2X99 A;  4N30 A;  4IP1 A;  5HR3 A;  3GFK A;  1PRX A;  5D96 A;  1SVO A;  3GL3 A;  3HD5 A;  2EFH A;  1A8L A;  2M72 A;  3C8E A;  4EVM A;  1GUK A;  3CRT A;  2JZR A;  1E6B A;  1OE8 A;  20GS A;  2FA8 A;  1K0N A;  4F82 A;  1PSQ A;  2YP6 A;  5IMF A;  2O7K A;  2C8U A;  4I8B A;  2D2Z A;  2ZCT A;  4ZB8 A;  1WPI A;  1AXD A;  1T4Z A;  2C80 A;  3HJM A;  1GSQ A;  1ERW A;  3DEX A;  2IFQ B;  5AIS A;  3D22 A;  2OE3 A;  2MMA A;  4EIP A;  1LBK A;  1SYX A;  1DBY A;  2QA2 A;  4PUA A;  3FZA A;  5A5H B;  2IMK A;  4TOP A;  4JE1 A;  2GLR A;  4PGT A;  3RPP A;  2VD0 A;  1ACV A;  2X49 A;  19GS A;  1Z6M A;  1IYI A;  1XCC A;  3IDV A;  3M0F A;  2WFC A;  3FYG A;  3ERG A;  1VGL A;  2HT9 A;  2WJU A;  2L6C A;  3C73 A;  4MJC A;  5FHI A;  5DAK A;  2H76 A;  3RBT A;  2CX3 A;  3TKS E;  3F63 A;  1GUL A;  3VWX A;  4Q5R A;  4YQM A;  2AB6 A;  2H8L A;  3F3Q A;  3I9V 2;  3APS A;  2YWM A;  1BG1 A;  5CRE A;  3ISO A;  3TJJ A;  4IQA A;  2MYG A;  3KP9 A;  4KDU A;  2HSH A;  2PU9 C;  2V6O A;  4MA9 A;  3FHK A;  3IHG A;  3L9S A;  3I6A A;  2FGX A;  2G2Q A;  2KP1 A;  4OMV A;  1GWC A;  1MTC A;  1ON4 A;  5BMU A;  2VOC A;  2DKI A;  1OKD A;  3J7Y k;  3IAS 2;  2XBQ A;  3TJG A;  4QQ7 A;  5HFI A;  1EEJ A;  2MBT A;  5JWO B;  1ML6 A;  1GSS A;  2FWF A;  2R0G A;  4AGS A;  3VWV A;  3EUR A;  5CNW A;  4TW5 A;  1B8X A;  2E2M A;  3RHB A;  4MDC A;  2VAF A;  3CSJ A;  4ZB6 A;  4L5L A;  1RW1 A;  4AF2 A;  3MIX A;  1YF1 A;  3HJP A;  1ZGN A;  3APO A;  4YQV A;  5CRW A;  4FO5 A;  3GH9 A;  3GKN A;  5D93 A;  2J9H A;  4WET A;  2BMX A;  4IS0 A;  5ECQ B;  1SU9 A;  3M8N A;  2CZ3 A;  3DRN A;  4NPB A;  1VF1 A;  1QGV A;  1A0R P;  1S3A A;  1O85 A;  3O76 A;  2HZF A;  4Z2R A;  4KX4 A;  2RUF A;  6GSX A;  2KOK A;  4MF5 A;  5C00 A;  1W4V A;  3HXS A;  3MAK A;  5IPH A;  3HMJ G;  4NV2 A;  2O85 A;  4POL A;  3QOU A;  4F03 A;  2G0F A;  4XS4 A;  1GL8 A;  5CRH A;  3KEB A;  4TKY A;  4IBP A;  5ECR B;  3VI7 A;  2VM1 A;  2HRK B;  3TOU A;  3TRQ A;  1A2L A;  1EP8 A;  1V9W A;  1XWK A;  3GSS A;  1JZW A;  4GSS A;  1OC3 A;  3DD3 A;  2KUC A;  1ILO A;  3KH9 A;  5A1N A;  3FMW A;  3LWA A;  4QL9 A;  1R7H A;  3KM6 A;  3CMI A;  4E8E A;  2VL9 A;  1ERV A;  2HE3 A;  4WF5 A;  2Z9S A;  4G0L A;  2HQT A;  3A5W A;  4K7I A;  4X43 A;  1PX6 A;  4RQX A;  3BOA A;  3DYR A;  2LRN A;  3GKX A;  2WB9 A;  3H79 A;  1EGR A;  4BVX A;  3ZIV A;  1V2A A;  2M80 A;  2CA8 A;  4MH2 A;  2GDR A;  4YH2 A;  3OR5 A;  3DKS A;  1BAY A;  5G1L A;  5E4W A;  2H72 A;  4MLY A;  3MNG A;  2PMT A;  4EC0 A;  3LQ7 A;  5CRG A;  1T1V A;  5J5N A;  3ZZX A;  1S3C A;  4EL1 A;  3UBL A;  3UVH A;  6GSY A;  5DJM A;  3KZQ A;  5D9V A;  4GCI A;  4POM A;  2H1D A;  5J4V A;  1GTA A;  4PQI A;  3WGE A;  1CQG A;  2B1L A;  4N0V A;  2H0I A;  1AC1 A;  5L71 A;  3P7X A;  2I1U A;  3HZ8 A;  3TKP A;  1M9A A;  2DJ1 A;  2GSR A;  3KH7 A;  4PUR A;  3IC8 A;  6GST A;  3GKM A;  1BYE A;  2P0G A;  1SKR B;  4HZ2 A;  3TRX A;  1J0F A;  3BBY A;  2H75 A;  3GKK A;  2KLX A;  3KJY A;  2LRT A;  2LST A;  3GMF A;  2X64 A;  3D4M A;  2B5Y A;  2NDO A;  5IMA A;  4G10 A;  1H75 A;  3ERF A;  5HFK A;  4TRX A;  3FKF A;  1T4Y A;  4LL4 B;  4K7N A;  2OE1 A;  1PX7 A;  1F3B A;  4PQH A;  2FY6 A;  5DVB A;  2AJQ B;  1WE0 A;  4OD7 A;  3ZFL A;  1H4O A;  2VIM A;  5G30 A;  3FZ5 A;  2LUS A;  3UAP A;  3QCP A;  4KCA A;  3VI5 A;  1YKC A;  4MPF A;  4EF0 A;  2FHE A;  4MJB A;  4IGJ A;  2YWO A;  4KGI A;  2E7P A;  2EIQ A;  3DWV A;  2LRC A;  3EMP A;  4XHM A;  1AQV A;  1DE2 A;  4HZ4 A;  1NHY A;  2YN1 A;  1ZYE A;  2H71 A;  2QC7 A;  2E2G A;  4GF0 A;  5EVO A;  5B7C A;  3HYP A;  2VCZ A;  5IIZ A;  1O8X A;  4X1U A;  1U87 A;  3QMX A;  3ZML A;  3R3E A;  4USS A;  5F0G A;  1F3A A;  1YQ1 A;  4OFM A;  1EOG A;  3UMA A;  2VKZ G;  2AHE A;  3Q19 A;  4X4J A;  1DE1 A;  1KBN A;  4G0I A;  5J4U A;  2PWJ A;  4ZBD A;  2LKU A;  5ECP B;  3TKS A;  1ABA A;  1TJD A;  3SBC A;  4DSS A;  1XXU A;  3F0I A;  3LYK A;  1WIK A;  5DCH A;  1EOH A;  1B9X C;  2HXK A;  3TKR A;  1W89 A;  5ID2 A;  5ECS A;  1WJK A;  3EMX A;  4I2T A;  3APQ A;  2A2P A;  1V58 A;  3M9J A;  2LJK A;  2FNO A;  1X9S B;  2YWI A;  1SD8 A;  2H6X A;  3GRX A;  3IK7 A;  4WEY A;  2X8C A;  4K8M A;  4V2M A;  4N3Z A;  1XW6 A;  5D9X A;  4KUN A;  2BTO T;  4BL7 B;  1PN9 A;  2YNX A;  3PPU A;  3DGQ A;  5LCZ A;  3G7I A;  1GSE A;  1AAZ A;  4KND A;  5F05 A;  4AJ6 A;  1OYJ A;  2R2J A;  4OCE A;  1XWB A;  3GTU A;  5DAL B;  2K8S A;  2PN8 A;  2OAD A;  1SVM A;  1BF5 A;  1FW1 A;  1EEM A;  2O89 A;  4V1A g;  2HSY A;  3W6G A;  4ZIJ A;  4MZC A;  4NHW A;  4ML6 A;  2VLV A;  5D73 A;  3RPN A;  2EFD A;  1XOA A;  1ST9 A;  1TOF A;  2A4V A;  4MNN A;  2OBI A;  4YAP A;  2I4A A;  4EKZ A;  4A5P A;  2HFD A;  1Y1U A;  2BJX A;  4GQF A;  3MSZ A;  4RI6 A;  4MF7 A;  4NV5 A;  1DUG A;  3ZTL A;  1T7P B;  2WUL A;  3U5R E;  2MBS A;  3VWW A;  1ZOF A;  1I9D A;  1PD2 1;  3GL5 A;  2DJJ A;  2JAD A;  4WXT A;  3EYT A;  3Q6O A;  4FH8 A;  3TB2 A;  1C72 A;  1O73 A;  1Z5Y E;  1F2E A;  1M9B A;  1I5G A;  1MDJ A;  1AQW A;  3VPT A;  4KAE A;  4AKG A;  3KTL A;  4Z2T A;  3M3M A;  1OC9 A;  5C04 A;  1MD3 A;  5GZZ B;  2XBI A;  1M2B A;  1TI1 A;  4G2E A;  2H01 A;  4G0K A;  4HU7 A;  3HJO A;  5A34 B;  3H1N A;  3CXG A;  4Q5N A;  4KE3 A;  3FY7 A;  1URM A;  3GA4 A;  3WGD A;  2CAI A;  3HA9 A;  1TXU A;  1O8W A;  4K1F A;  2A2R A;  4TR4 A;  3G9B A;  1XBS A;  1PN0 A;  3ZVJ A;  1VRS D;  1MDI A;  2XPD A;  3GUR A;  1UC7 A;  1GSF A;  2H66 A;  2YZU A;  5IMC A;  2C0F A;  3FZ4 A;  1FOH A;  1X0R A;  4EXJ A;  2K9F A;  1GH2 A;  5BMU B;  4FIW A;  2A2S A;  4KCE A;  2HZE A;  3F8U A;  2VD1 A;  1KTE A;  1USB A;  1XOB A;  2ON5 A;  5JWR B;  3QAV A;  2H73 A;  3E9J B;  2DIY A;  2DMM A;  2B7K A;  2YJ7 A;  4F0B A;  4I5Q A;  5LNK e;  3ZIT A;  3HVS A;  3HVV A;  2C4J A;  4KW6 A;  3K8N A;  3P2A A;  3U6V A;  3QFA C;  3FZ9 A;  1O7U A;  3I69 A;  2IJY A;  4XRA A;  1FB6 A;  2CT6 A;  2JAC A;  3IV4 A;  1XZO A;  5KN3 A;  3H93 A;  1SVL A;  2LTK A;  2E0Q A;  5KOX A;  1UN2 A;  3FK8 A;  4WF4 A;  4XTS A;  3IA1 A;  1Z7P A;  4TR0 A;  4JR6 A;  4IVF A;  2MMO A;  1HYU A;  4HEA 2;  3WGX A;  1OAZ A;  2H6Y A;  3HY2 A;  3QAW A;  2JSZ A;  3KMO A;  9GSS A;  3Q74 A;  1T3B A;  1PGT A;  1K0A A;  2R5G A;  3IOS A;  4BVY B;  4LMV A;  4K0N A;  3HVX A;  2N5F A;  1U3I A;  5J9B A;  1SD9 A;  2YV7 A;  5G2Z A;  5B6N A;  2IFQ A;  1YKA A;  3VFI A;  4ZL9 A;  3TOT A;  2K6V A;  2UZ8 A;  2IMF A;  4L0U A;  4WR4 A;  4RQR A;  2B6M A;  4CY6 A;  5A5H A;  3DVW A;  2HSM B;  5AIV A;  1ERT A;  2PPT A;  4K2X A;  5F06 A;  3UOM A;  1X9W B;  4HJ2 A;  3ZYW A;  1ZL9 A;  2WCI A;  1EZK A;  1WWJ A;  3PH9 A;  1X5E A;  4O5Q A;  1B48 A;  5IMD A;  3KD0 A;  3KIJ A;  5F07 A;  5COH A;  3LFL A;  4POK A;  5CYY A;  3C71 A;  3DXB A;  1SL2 B;  2C3N A;  3HDC A;  2ALB A;  3KP8 A;  3NIV A;  1VF2 A;  2JL4 A;  2YJH A;  1A0F A;  3ED3 A;  3SWL A;  1B4Q A;  2ZUP A;  3ZL5 A;  2VL2 A;  2CV4 A;  3D21 A;  1PMT A;  4IEL A;  5FWG A;  3UBK A;  1GP1 A;  4MZW A;  4HOJ A;  1FB0 A;  1AQX A;  2ES7 A;  5KN2 A;  3LGC A;  5ECH B;  2IWT A;  3IPZ A;  2IL3 A;  2MMZ A;  2H1G A;  4DVC A;  2EFC A;  5DQY A;  2H6Z A;  2JZS A;  1ZMA A;  5HR1 A;  2M46 A;  1SKW B;  22GS A;  3A2X A;  3UIW A;  2OAC A;  5LD0 A;  3LG6 A;  1ZYQ B;  4MP4 A;  2CAQ A;  1TRW A;  3IHQ A;  3P90 A;  1GLP A;  4ECB A;  4O5U A;  5HR0 A;  2YV9 A;  4FYB A;  16GS A;  3CBU A;  2LEG A;  5DCG A;  3PR8 A;  4ECI A;  3IE3 A;  3QAG A;  1M7T A;  3LXT A;  1GRX A;  4HUA A;  3Q18 A;  3IC4 A;  1YDK A;  3WD6 A;  1TI3 A;  3LOR A;  5DJL A;  2GT5 A;  4ZB7 A;  1S3D A;  1HNC A;  4QL7 A;  3WYW A;  1Z6N A;  1U88 A;  2VL3 A;  4EDZ A;  2LJR A;  4FYC A;  2QA1 A;  1PA3 A;  2HYX A;  2FWH A;  1GLQ A;  4IHU A;  4GSN A;  1SL1 B;  5J40 A;  1SYR A;  3ZFB A;  2ZNM A;  4TR1 B;  3VLN A;  1PL1 A;  1ERU A;  2HRK A;  1MD4 A;  3A5I A;  4CDO A;  4NWY A;  4Q5Q A;  5A4W A;  1ZYP A;  2VO4 A;  3QR6 A;  4HU9 A;  3RDW A;  4XCS A;  4OCF A;  2FCH A;  4J57 E;  1Y6E A;  2VLU A;  3EU4 A;  1JFU A;  2OA7 A;  4ZBB A;  2LNT A;  3A2W A;  3UL3 A;  1GUH A;  1U6T A;  1JZD A;  1TRS A;  5CO3 A;  1JZR A;  3UAR A;  5EL8 A;  14GS A;  3CTF A;  5CP1 A;  2NVL A;  3EE2 A;  3F4R A;  4L0W A;  1A2J A;  3L9V A;  2CVD A;  1YEP A;  2GGT A;  2I81 A;  1R26 A;  1GTB A;  1CQH A;  5IQY A;  5DBQ A;  1FAA A;  4GRF A;  1VF3 A;  2HI7 A;  2LNS A;  2VCQ A;  2CX4 A;  4RUV A;  5A4U A;  3O3T A;  1GNW A;  5IM9 A;  3ME8 A;  2H30 A;  3EPT A;  1VF4 A;  4JU5 A;  1XW9 A;  2H19 A;  2R0P A;  3CSH A;  4YQU A;  4ACS A;  2MZC A;  5ABR A;  2H0H A;  4GWR A;  2KHP A;  1GUM A;  3H4K A;  3VPQ A;  1GTU A;  1NSW A;  1T00 A;  3M9K A;  4MH3 A;  1BQ7 A;  2JSY A;  1QQ2 A;  1HD2 A;  1YZX A;  2C0D A;  4TXV A;  4GTU A;  2R37 A;  2FD3 A;  5BRT A;  4LL1 B;  1AW9 A;  6GSV A;  4KSM A;  3D0Z A;  4GST A;  1OKT A;  2GSQ A;  5JCU A;  1EGO A;  3GNJ A;  5D9W A;  3C1R A;  3QFB C;  1PL2 A;  3C1S A;  1TW9 A;  3GX0 A;  1YF0 A;  1M0U A;  4BPY A;  1NHO A;  4WR5 A;  5D8I A;  2GQK A;  3RAZ A;  3US3 A;  2FUG 2;  2LS5 A;  3QPM A;  5DQS A;  5JCG A;  2HRA A;  4O92 A;  4LA1 A;  4GDF A;  2GZP A;  2X4A A;  2PVQ A;  3TRP A;  1R5A A;  2P31 A;  2EFE A;  5EY6 A;  5B6M A;  4TXO B;  2NPB A;  2P5Q A;  2C0G A;  5G1K A;  5GAP D;  3BCI A;  8GSS A;  2L4Q A;  5AN1 A;  1QXH A;  4ECJ A;  4D73 A;  2EIO A;  2CZ2 A;  1Q98 A;  3FR9 A;  4ML1 A;  3TGZ A;  1N25 A;  4AKX B;  1G7O A;  4HQS A;  5HFG A;  4POB A;  1JLW A;  3VWU A;  3FR6 A;  4ICY A;  3V1W A;  4CHS A;  4LMW A;  2L6D A;  4BWS A;  1NM3 A;  3LW9 A;  5J47 A;  4EUY A;  2F8A A;  6GSS A;  1E2Y A;  1NW2 A;  4MJA A;  11GS A;  1R5P A;  1TK5 B;  2XHF A;  3G7J A;  1TRU A;  5GAN D;  2RM6 A;  2OJL A;  3GH6 A;  4MCU A;  7GSS A;  4DSQ A;  2LQO A;  4KDY A;  1KNG A;  3LJR A;  2YAN A;  3FRC A;  3UJ1 A;  4K7O A;  1R4W A;  2TRX A;  1EP7 A;  5KOW A;  4GLT A;  1K3L A;  3GUS A;  3HCZ A;  1K0C A;  2MMN A;  2DJK A;  4X0X A;  4V2L A;  1GTI A;  1HNA A;  2F9S A;  1TRV A;  1G6Y A;  2R0C A;  3NZN A;  4LLR A;  1XWG A;  3ZMK A;  2GQL A;  2FWG A;  1SJI A;  5KN0 A;  2YCD A;  3VUR A;  2EC4 A;  4AJ8 A;  2CQ9 A;  1OE7 A;  2HLS A;  3MDK A;  3BJ5 A;  2L57 A;  2F3M A;  4MF6 A;  1K3O A;  4K2D A;  1M99 A;  2FWE A;  5A5K A;  4ISD A;  1WRY A;  5KN1 A;  4K6X A;  3F6F A;  2WDU A;  3MWH A;  2PER A;  1T8E B;  4BL7 A;  3ZRD A;  3N9J A;  4I6X A;  4ZXG A;  3FW2 A;  5ELA A;  4NMU A;  4O32 A;  4I2U A;  5ENU A;  1K0M A;  2QGV A;  5ECI B;  5DAL A;  4OO4 A;  2H70 A;  3HZ4 A;  1ZCP A;  2HSN A;  2DIZ A;  5GST A;  3LEF A;  4YAV A;  4MZB A;  1V40 A;  2LV3 A;  2B3S A;  3KXO A;  5DAK B;  1B9Y C;  1FG4 A;  4EDY A;  3A2V A;  1YVL A;  4QMK A;  2B7J A;  3DIE A;  3UVT A;  3PIN A;  3CWG A;  1K0D A;  4EO3 A;  2HRF A;  2NBS A;  1TU8 A;  1SK1 A;  3CSI A;  3KTB A;  4XS1 A;  3WT2 A;  3D4T A;  2PGT A;  2UV8 G;  4EIQ A;  3EVI A;  1F9M A;  4Z2U A;  18GS A;  1WOU A;  4K9Z A;  5J3R A;  4HQZ A;  5B8B A;  1A2M A;  3BD2 A;  2F51 A;  1SKS B;  4NHZ A;  4W66 A;  4PUF C;  1G0T A;  5IOX A;  1TDI A;  3N5O A;  1O6J A;  2IPA A;  3TDG A;  17GS A;  3QDN A;  3O6T A;  1XIY A;  2C3Q A;  1LJR A;  2C3T A;  3TUE A;  1QFN A;  2R4V A;  2H0G A;  2H74 A;  1EV9 A;  3G7Y A;  1XVW A;  5JCW A;  4H86 A;  4KB3 A;  3L78 A;  3TKQ A;  3KCM A;  5IPG A;  2V32 A;  2R6K A;  2K8V A;  4WKW A;  3WT1 A;  3RHC A;  1X5C A;  2PUK C;  1QK8 A;  2F8F A;  13GS A;  1BX9 A;  2NTO A;  2DSA A;  3IBH A;  5ECO B;  5A34 A;  1PQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...