5B7DA

Oxyr2 e204g mutant regulatory domain from vibrio vulnificus (sulfate-bound)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
212
Chain Sequence
GAMELSMQGQLKLGCIPTIAPFLLCDLVQEINQRFPQLNLLLREDTTTNLLTALRHGELDVLILALPVEIDGMESRVVGQDPFKMVISRHQAGAIKVPIKYDDLPDESVFLLEKGHCLTEHAVSACKLTDKEKINPFSATSLHTLVQMVANGLGTTFIPQMAIDHGLLDNQNLVVIEPPGQQAYRDIGLVWRPSSSRSKTFNQLAEVVSELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR family transcriptional regulator
publication title The hydrogen peroxide hypersensitivity of OxyR2 in Vibrio vulnificus depends on conformational constraints
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription
total genus 63
structure length 212
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5b7dA01
4E0XA 4R73A 5CBRA 3VXCA 2AYSA 2Q88A 2RCBA 2XXTA 4IGTA 2E1SA 4O3BA 4JB7A 5I58B 3VE1B 4KR5A 5I2KA 4F2QA 4PFTA 1SW4A 2I6EA 5CC2A 1LAGE 2XHDA 4F1YA 1IZ1A 3BBRA 1M5CA 1IXIA 3TAJA 1US4A 2GH9A 1BP5A 1Y1ZA 3MQ9A 2QS1A 2DQVA 4WEDA 2NWJA 1M5DA 3VFJA 2RC9A 4G68C 1LBBA 2VGQA 1FQEA 2HAVA 3KG2A 5DVFA 4RA1A 1B4ZA 2HEUA 2QMXA 3C31A 1I6BA 4R72A 4GVOA 1AIVA 1Y3QA 4ZEFA 3QIMA 5F1QA 1SW5A 1FQDA 2H9BA 5HBCA 5I56B 1OLCA 2DS9A 3RGYA 2DE3A 2WKYA 4DCXA 1ZIUA 4RY1A 1ANFA 5CMKA 3S2VA 1XC1A 3K01A 1P1WA 3MPLA 3OEKA 4BDMA 4BLAA 5BUUA 4KFQA 3GZGA 5DT6A 2XX9A 4F18A 3M3KA 2P0SA 4JSDA 3E3KA 5H8FA 4NF6B 3LUYA 3OOAA 1SVXB 4TOZA 1LAHE 3QUFA 1BTJA 2Z8DA 1H76A 3FVOA 2F6PA 1Q35A 1MS7A 1PEBA 5AA2A 3VVDA 4EF2A 4C0RA 3L6GA 5H8QA 4IGRA 4RPOA 2ZNTA 3QSLA 1I69A 2XXVA 2OJTA 2H4IA 4R75A 1B5JA 2O7IA 4NF5B 3QK6A 1B5IA 3TTMA 4PFUA 3K6VA 4G2ZA 1PC3A 3H4ZA 2Y7WA 1A8EA 2DWHA 4ELOA 4OVJA 4YU0A 4YB7A 2D3IA 4ZE8A 3H7MA 2UVGA 4WXJA 3G3IA 4X1BA 3TTKA 3TTLA 3KN8A 2F97A 3T96B 1JW1A 3B7DA 3N6UA 3SDFA 3G7WA 2O84X 3H06B 3PPPA 3SEUA 4HS7A 1FTOA 3LR1A 3CG3A 3LSWA 5I59B 2BJJX 4TLLB 1IXHA 4ESXA 1Y4TA 1B0LA 3TFLA 4Q8RA 3N94A 4WKMA 5TU0A 3KN3A 3MVZA 4U22A 4XKNA 4GL0A 4QFNA 2B3BA 4ZZEA 4RJZA 5KZTA 1M5FA 4P11A 2Q2AA 4IO4A 1SW2A 3R6UA 2ZYMA 1DOTA 1LAXA 1ZBMA 5AA4A 4FATA 1CB6A 4BDRA 3OXNA 3R26A 1MXVA 4JWXA 4OEVA 2OWSA 2F5XA 1Y9UA 3PUVE 1NMUA 4C1TA 3HCQA 1H44A 3E13X 5JEIA 3IOVA 2NVUB 1R6ZA 1JEVA 3PUZE 4POXA 3PPNA 3MBPA 1LLSA 4POWA 3JZJA 3FASA 4FE8A 2AIXA 4ECFA 4F3SA 3T93B 3UK4A 3W9VA 3G3GA 3PD9A 1KWHA 4AQ4A 5A5XA 4EQBA 4GWOA 5EHMA 1D3KA 2CMOA 4DXBA 4YMBA 2GFEA 5K2YA 1JQFA 4QHQA 5B7DA 5LOMA 5L8DA 1IITA 3I6VA 2Y7IA 4ONYA 1JETA 2V25A 4NF8B 1LFHA 3T9UA 4GXAA 2XXQA 1NKXA 4FEBA 2Q8JA 4YKPA 2B65A 3IX1A 5KDTB 3C33A 1FQAA 5ITPA 1GR2A 1ZKBA 4O3AA 5EHSA 4EF1A 1POTA 1B1XA 1MXZA 2F78A 3N26A 3VLWA 1MXWA 2GHAA 3Q27A 1ZMGA 1JW5A 1NFTA 3IR1A 1TFAA 3AXFA 4RYAA 3GXAA 2AL4A 1MXYA 4YZZA 1B6HA 2H99A 3EN3A 1EZOA 1OMPA 5FHNA 3Q25A 1P1NA 2REGA 3E4RA 4GF8A 1N04A 3FUZA 4OERA 1A55A 1N3XA 2ZYOA 2DE4A 2VHAA 3CIJA 3RT8A 4HW8A 1L5TA 1MQIA 4LP2B 1MXXA 3QXMA 2IA4A 4LZ7A 5I57B 4YKIA 3O29A 1URDA 1XVYA 3MC2A 3PD8A 3UA8A 3O97A 3FV2A 4IO2A 4ESWA 3BFUA 3KJ7A 2RKMA 3TKDA 1OQHA 4H5GA 2A5TB 4OHNA 1XT8A 4G8MA 5H8SA 4OFJA 2ESNA 1MH3A 5DYHA 3DLNA 5H8NB 3FXUA 1MQHA 4H1XA 4OZ9A 1UTHA 3HHFA 3IOTA 5CMBA 2G29A 4YB6A 4GXSB 3Q29A 1MY1A 2P2AA 4XKQA 3MP6A 5L9SA 3OO6A 2HAUA 3T22A 1P1OA 4F22A 3PUWE 3ZKLA 1MY3A 2Q89A 3VV5A 4HCWA 1OQGA 1TFDA 3HN0A 3QUJA 1ZTYA 3N5LA 4G4PA 5KCJA 3HO7A 4G68A 3DELB 2PX1A 2NXOA 4KYDA 1B5HA 5DEXB 3KEIA 3KOTA 4MFIA 1R1NA 1YPNA 3PMVA 2I0BA 2O1MA 4PE5B 5I2KB 4IY6A 4IO6A 1B1HA 4X48A 1S9TA 3O6GA 2HXWA 3JV9A 4G8HA 4H5FA 3U92A 3I5OA 3K6XA 3PMWA 1AOVA 2RF1A 4MF3A 3TTNA 2W7YA 3K6UA 4OESA 2RINA 4OMBA 5CRYA 2QRYA 1B2HA 5AA1A 1SI0A 4QF9A 2HFBA 2PT1A 1IUDA 4MH5A 4LA9A 1AMFA 1RKMA 1A7LA 3LBSA 4R6HA 4ELRA 1N7XA 4PFWA 1Z7NE 3VVFA 2XXIA 4NF4A 4F39A 1MDP1 1SD3A 4IO5A 1SQYA 3PU5A 3PUYE 2D21A 4ZS9A 2ZMBA 3K6WA 3CG1A 3MWBA 1YTVA 3EPEA 3GBBA 1B58A 4AB6A 5JK4A 2PT2A 4QFLA 4C1UA 1XHYA 3TCFA 3GBAA 1NNPA 3FATA 2UYEA 3VLUA 3W9WA 4E0WA 4KCDA 1H43A 4YKKA 1MY4A 2H98A 2ZYKA 2UXAA 5H8FB 4KYEA 5TPAA 4NWDA 2XXHA 1ZJLA 3FVNA 1S7YA 1VSOA 4GOTA 1B0HA 1UTBA 5AA3A 3MZ9A 5AA2B 2VP1A 2XXUA 2O51A 1URGA 5H8QB 3LSLA 2FYIA 2VD2A 4EXKA 1BKAA 3W15C 1OLAA 1DSNA 4DXUA 5ITOA 1JNFA 4PETA 3EF7A 2UVJA 4P0IA 2I3VA 2E0SA 3PMXA 3T9HB 1JVYA 1SW1A 4EXLA 4N6PA 1RYOA 2NOOA 1MQGA 2XD2A 3RT6B 3TODA 2V3UA 1HSLA 2I4BA 4NMYA 1US5A 1A8FA 1WDNA 5L9MA 4M1VA 3CSBA 2Y84A 1JW4A 2ANJA 1LCFA 4JBZA 1J1NA 4EUOA 3IO6A 4JWYA 1VFDA 4ELPA 5M2VA 3U94A 5CI5A 1T0KA 4FIMA 3ZS6A 4DIGA 3FJ7A 1QKAA 1LB8A 3EHSA 2DWIA 2D5WA 4U21A 3HV1A 3RQTA 4THIA 1B3FA 5FHMA 2NUVA 1P1QA 2V93A 1HSJA 3TZAA 4YB5A 3RY3A 3OO7A 1YAEA 4I62A 1POY1 1MPCA 1SYIA 1ZU0A 1NNTA 1LBCA 4ZEIA 2PMSA 1IXGA 2I4CA 4F3GA 3T9XB 3O6HA 1TXFA 3FXRA 2DYXA 2ONRA 3TCHA 4OWDA 2O6AA 4GRKA 4Q5TA 1SBPA 4NTLA 1MG1A 2R6GE 3O9PA 5I2NA 3EHUA 3TEPA 1MM7A 2ALUA 4FEDA 5L9OA 2A5SA 3DP6A 3UP9A 4EQ9A 3CI8A 4QSCA 1F9BA 1FW0A 4GLIA 2F6GA 4HTGA 4NE4A 5DVJA 4H0WA 3UGWA 3K4UA 2V84A 1NNKA 4H65A 1PDAA 5IKBA 5DTBA 4ZECA 4YKJA 5A5XB 5CBSA 4KCCA 3IO4A 4BDNA 1EZPA 1FTJA 4R74A 4I9DA 4R9GA 3PUXE 1DTGA 3M8UA 2QL3A 4XKRA 2ZNUA 4LZ8A 3V5AA 2XX7A 3T9VA 2UVIA 1DTZA 1RYXA 3DM0A 3FV1A 4IO7A 3C32A 3WAEA 4LUBA 3UORA 4UA8A 4O3CA 3ZKKA 1MM6A 1S50A 1CE2A 3G3HA 4F31B 3TMGA 2YLNA 1VFEA 3OEMA 1Y1MA 3OSRA 3MVWA 1B51A 2YJPA 3B6QA 4TQUQ 2F7BA 1B3EA 3K1PA 2REJA 4ISUA 4OFLA 2Z8FA 4OENA 2QS4A 4F3BA 1PB9A 3KFMA 5H8HA 1B32A 2ONSA 1QW0A 1IEJA 4L17A 1R9QA 1Y20A 3S9LC 1NH7A 3PV0E 1B7HA 4G8NA 4I1DA 1LCTA 2FA7A 1UIVA 5DVIA 4HCYA 2M8CA 4F3PA 4Q30B 2ZYNA 4M4GA 4UACA 1QUIA 3BFTA 3DP4A 3CFXA 2P1SA 5EYFA 4U4SA 5FHOA 2XD3A 5JTYB 3SERA 1NNFA 1VR5A 2I3WA 3SEYA 1UTHB 4U1OA 3S4UA 4JWOA 3R7XA 3IB0A 1QJMA 4N13A 2I0CA 2ZNSA 5AA2D 3MP1A 4U23A 1DPEA 2F8DA 1PBQA 4ELQA 4Q0CA 3M3FA 2F7CA 3U1OA 4ZE9A 2F34A 3K0VA 2Q2CA 3RN8A 1BLFA 2Y7PA 3MZ1A 1P99A 2I48A 2V3QA 1MPDA 2F36A 4G68B 1AL3A 2F35A 3TTRA 2QMWA 1B3LA 2GRVA 4Z0IA 3IAZA 4QFKA 3MJNA 5ICQA 4F19A 4P0GA 1QVSA 3K1NA 2Y7RA 3O66A 1I6AA 1MQDA 1FQCA 4KPTA 3A3UA 4IO3A 4R6YA 2X26A 2KLFA 1OVTA 3SESA 1EH3A 1ZLQA 4ZEBA 5H8NA 3C34A 4FJPA 4LQ2A 2QS3A 2QJEA 4QFOA 3PPQA 4OEUA 3OSQA 3OD7A 1O63A 2Z22A 4PFYA 4X9TA 5TP9A 3H6UA 4GD5A 4YMAA 1Y4CA 2RC7A 4YAHX 1PB7A 4QRZA 4DZ1A 3H03A 3THIA 1NL5A 3HPIA 2XXWA 5DEXA 5ISUA 3PPRA 4JXIA 4MLQA 4DLDA 2DOJA 3F11A 4EDPA 3TQWA 2O68A 5ELVA 3MVYA 1A99A 2G93A 4JDFA 3SEVA 3KN7A 1UIUA 3RLFE 4NEDA 3G3KA 5I58A 1N76A 5TPAB 3V83A 3A09A 3E9XA 2XXXA 3CRBA 1MY2A 4U2RA 3S9NC 2OLBA 3G3FA 1DMBA 3BKIB 4EQ7A 3MP8A 3TDJA 3FJGA 1GTKA 4XKPA 2X7PA 2PVUA 4OQOA 1UTBB 3SKPA 4KD5A 2PYYA 3U93A 3PPOA 1B4HA 3CFLA 2DWAA 3IL1B 2AL5A 3IJOB 1B40A 1DPPA 4GFRA 2DP8A 4RK9A 3LSFB 3IORA 4OXVA 2O7UA 3KZGA 3G3JA 1B3GA 3PGFA 1XS5A 3LSXA 3MPKA 3C4MA 3O6IA 3IB1A 2QS2A 2DWJA 5I56A 3VVEA 1OIBA 2VOZA 3OELA 1D9YA 4ZZAA 4QSEA 4LATA 3TCGA 3KOSA 1IIWA 3Q28A 2UYFA 3H6VA 2QPQA 1JEUA 1A54A 2Y7KA 2O69A 1B3HA 3RTFB 1QULA 1LB9A 5K2XA 1XVXA 1FTMA 3CR9A 1LAFE 4BDOA 4NF6A 4LQ5A 4IB2A 3KSXA 3VDFA 1LGBC 2RCAA 3L6HA 2FNCA 2DVCA 3D4CA 4RPNA 4XXUA 5F7VA 1B7ZA 2GHBA 1FTLA 4PQJA 3HHGA 1B46A 1N84A 3RUMA 1MDQA 3H3GA 3KBRA 2OZZA 2HZKA 3KJTA 3FXQA 1MH4A 4DE8A 3VLVA 1FQFA 2DVZA 1Y3PA 4R9FA 5B70A 4FAJA 3U72A 3K1MA 4GL8A 4XTCQ 4OYVA 4QSDA 2DXRA 4NF5A 3ODBA 4QFPA 1P1UA 1WVJA 2Z8EA 5IAIA 4LVQA 1B9JA 4X1DA 1D9VA 5CM6A 3FIRA 2R9JA 1Q1KA 1LFGA 2I49A 1OVBA 3MW0A 3OO8A 5I2NB 1UQWA 3FJMA 5I84A 3VXBA 4F1UA 2H5YA 2THIA 4LZ5A 3RNNA 5AA4B 4DCYA 3V89B 4FORA 3MVXA 1B05A 1PBPA 2HQ0A 1JVXA 1TWYA 4H8JA 2HCAA 3TQLA 1FQBA 3OO9A 3GLBA 3OENA 4GIZA 5I59A 1URSA 3FZVA 2B3FA 3ECRA 4KHZE 1IQ7A 2I58A 1N0TA 3B6WA 3OMBA 3C36A 3I3VA 4KQPA 3H6WA 1QKBA 1Z7ME 4XIGQ 3CSGA 4DXCA 1BIYA 4NWCA 3A3CA 4U1ZA 4R2BA 4G77A 2PBWA 1FCKA 1R9LA 4Z7EA 3UN6A 3SEXA 2ABHA 1I6QA 2XXRA 3C35A 3FVKA 1USYH 4F1VA 3EQ1A 3P7IA 4KI0E 5FTHA 3WAFA 2DE2A 2VD3A 1GGGA 1M5EA 2QSXA 4LONB 4F2OA 3TPAA 1PB8A 2X7QA 1GV8A 3QYTA 3B6TA 2ONKE 2F7AA 4R2FA 1II5A 4MBPA 4WEPA 4IY5A 3D4GA 3JYRA 3K00A 1XOCA 1EU8A 1B52A 4OFOA 3O28A 3FGSA 1LSTA 2DSFA 3ZSFA 5H8HB 1QUJA 4H8IA 3KGCA 1GVCA 2UVHA 3IK6B 3C9HA 3N6TA 4ZDMA 2DXYA 4FECA 3ILTB 1N3WA 2CZLA 1USYE 1AH5A 1MPBA 5CMMA 4JSOA 3IOWA 3IOUA 1MQJA 5HPQA 3TYHA 1ATGA 3FD3A 3O2AA 1MXUA 4RNSA 3RTWB 4N07A 4RXLA 5HM4B 4NF8A 2XXPA 4H6DA 4BDQA 1YCJA 5KDTA 5AE4A 3MUQA 1M5BA 1H45A 4OETA 3HSTA 4U4XA 1B7UA 2V3TA 1Y3NA 1O64A 3EHTA 1MRPA 4R6KA 4ZEKA 4DDDA 1LFIA 1TT1A 3SETA 4YICA 1SDXA 3RPWA 3CVGA 3K2DA 4BDLA 3M3LA 4K3FA 2O1LA 3IB2A 3DP8A 3LC8A 4TLMB 3S9MC 1ELJA 3MZBA 4RK2A 1IXCA 3S9EA 1FTKA 3KSJA 4F29A 3CFZA 2IEEA 2XX8A 5KCJB 3V8XB 3ONMA 3QAXA 3TELA 4GQOA 3U8QA 5I57A 3K02A 2ZXTA 4ND9A 5BWJA 2XXYA 5JTYA 3T66A 3USDA 3SEWA 1VE4A 3FVGA 4MLVA 1EZ9A 2LAOA 4PP0A 2A5TA 1MY0A 4AB5A 2OWTA 1SYHA 1D4NA 1WODA 5ICTA 2H25A 5FTIA 1NH8A 3MAMA 5TP9B 2OCUA 4H67A 5CMCA 1SI1A 3ILUB 4I8CA 5J1DA 1H3DA 3UIFA 2R71A 4ZEDA 1A40A 1O7TA 1HSEA 2Z23A 2Q9TA 3H6TA 2YPNA 4OTEA 1N7WA 2RC8A 3IJXB 3Q26A 4KYSA 3TUSA 2OBGA 4NF4B 1QUKA 2HZLA 2OK2A
chains in the Genus database with same CATH superfamily
1LBVA 4E0XA 4R73A 4NG7A 5CBRA 3VXCA 2AYSA 2Q88A 2RCBA 2XXTA 4IGTA 2E1SA 4O3BA 4JB7A 4N8GA 5I58B 3VE1B 4KR5A 4P3LA 5I2KA 4F2QA 4PFTA 1SW4A 2I6EA 5CC2A 1LAGE 2XHDA 4F1YA 1IZ1A 3BBRA 1M5CA 4UABA 1IXIA 3TAJA 1US4A 2GH9A 1BP5A 1Y1ZA 3MQ9A 2QS1A 5EQ7A 2DQVA 4WEDA 1AWBA 2NWJA 1VDWA 1M5DA 2HHMA 3VFJA 2RC9A 4G68C 1LBBA 2VGQA 1FQEA 2B4MA 2HAVA 4H46A 3KG2A 5DVFA 4RA1A 1B4ZA 2HEUA 2QMXA 4NF0A 1FTAA 3C31A 1I6BA 4R72A 4GVOA 1AIVA 1Y3QA 4ZEFA 3QIMA 5F1QA 5EQ9A 1SW5A 1FQDA 2H9BA 1FBEA 5HBCA 5I56B 1OLCA 2DS9A 3RGYA 2DE3A 2WKYA 4DCXA 1ZIUA 1IMCA 4RY1A 1ANFA 5CMKA 3S2VA 1XC1A 3K01A 1P1WA 3MPLA 3OEKA 4BDMA 4BLAA 4XEQA 5BUUA 4KFQA 3GZGA 5DT6A 2XX9A 4F18A 3D1RA 3M3KA 2P0SA 4JSDA 4MJOA 3E3KA 5IZ3A 5H8FA 4NF6B 3LUYA 3OOAA 1SVXB 4TOZA 1LAHE 3QUFA 1BTJA 2Z8DA 1H76A 3FVOA 2F6PA 4HE2A 1Q35A 1MS7A 1PEBA 4I3YA 5AA2A 3VVDA 4EF2A 4C0RA 3L6GA 5H8QA 4IGRA 1RDXA 4RPOA 2ZNTA 2Y5KA 3QSLA 1I69A 2XXVA 2OJTA 2H4IA 4R75A 1B5JA 2O7IA 4N17A 4NF5B 3QK6A 1B5IA 3TTMA 4PFUA 4MEVA 3K6VA 4G2ZA 1PC3A 3H4ZA 2Y7WA 1A8EA 2DWHA 4NX1A 4MIJA 2XWOA 4ELOA 1NV1A 4OVJA 5IZ1A 4YU0A 4YB7A 2D3IA 4ZE8A 3H7MA 2UVGA 4WXJA 3G3IA 4X1BA 3TTKA 3TTLA 3KN8A 2F97A 4I3EA 3T96B 1JW1A 3B7DA 1NV5A 3N6UA 3SDFA 3G7WA 2O84X 2F3BA 1KA0A 3H06B 3PPPA 3SEUA 4HS7A 2PFZA 1FTOA 1D9QA 3LR1A 1FPLA 3CG3A 3LSWA 5I59B 2BJJX 4TLLB 4HE1A 1NV3A 1IXHA 4ESXA 1Y4TA 1B0LA 2JJKA 3TFLA 4Q8RA 3N94A 4WKMA 5TU0A 3KN3A 3MVZA 4U22A 4PE3A 2P3NA 1LBYA 4XKNA 4GL0A 1KZ8A 4QFNA 2B3BA 3IFCA 4ZZEA 4RJZA 5KZTA 1M5FA 3HFUA 1INPA 4P11A 4G61A 2Q2AA 4IO4A 1SW2A 3R6UA 2ZYMA 1DOTA 1LAXA 1ZBMA 5AA4A 4FATA 1CB6A 4BDRA 3OXNA 3R26A 1MXVA 4JWXA 4OEVA 2OWSA 2F5XA 1Y9UA 3PUVE 1NMUA 4C1TA 5ET6A 3HCQA 1LBZA 1H44A 3E13X 4PGPA 5JEIA 3IOVA 2NVUB 3FBPA 4OA4A 1R6ZA 1JEVA 4MHFA 3PUZE 4POXA 4OANA 3PPNA 3MBPA 1LLSA 3QMFA 4POWA 3JZJA 3FASA 4FE8A 4PC9A 2OWZA 1FBGA 2AIXA 4ECFA 1FBPA 4F3SA 3T93B 3UK4A 3W9VA 3G3GA 3PD9A 1KWHA 4AQ4A 5A5XA 4EQBA 2DDKA 4GWOA 5EHMA 1D3KA 2CMOA 1NUYA 4DXBA 1FSAA 4YMBA 2GFEA 5K2YA 1JQFA 4QHQA 5B7DA 5LOMA 5L8DA 1IITA 3I6VA 2Y7IA 4ONYA 1JETA 2V25A 4NF8B 1LFHA 3T9UA 4GXAA 2XXQA 1NKXA 4FEBA 2Q8JA 4YKPA 2B65A 3BIHA 1SPIA 3IX1A 1KA1A 5KDTB 3C33A 4NHBA 1FQAA 5ITPA 1GR2A 1ZKBA 3KC0A 4O3AA 2OX3A 1Q9DA 4GWWA 5EHSA 4EF1A 3NOHA 5IZZA 1POTA 4O8MA 1B1XA 4IR8A 1MXZA 2CEYA 2F78A 3N26A 3VLWA 1MXWA 2GHAA 3Q27A 1ZMGA 1JW5A 1NFTA 3IR1A 1TFAA 3AXFA 4RYAA 3GXAA 2AL4A 1MXYA 4YZZA 1B6HA 2H99A 3EN3A 1EZOA 1OMPA 4N4UA 5FHNA 3Q25A 1P1NA 2REGA 3E4RA 4GF8A 1N04A 3FUZA 4OERA 3E78A 1A55A 1N3XA 2ZYOA 4OVTA 2DE4A 2VHAA 5LDZA 2WEFA 3CIJA 3RT8A 4HW8A 1L5TA 1MQIA 4LP2B 1MXXA 3QXMA 2IA4A 4LZ7A 5I57B 4YKIA 3O29A 1URDA 1XVYA 3MC2A 3PD8A 4O7MA 3O97A 3UA8A 3FV2A 4IO2A 4P1LA 4ESWA 4PF6A 3BFUA 1JP4A 4OVRA 3KJ7A 2RKMA 4PTKA 3TKDA 1OQHA 4H5GA 2A5TB 4OHNA 1XT8A 2MKZA 4G8MA 5H8SA 4OFJA 2ESNA 1MH3A 3ISPA 5DYHA 3DLNA 5H8NB 3FXUA 1MQHA 4H1XA 4OZ9A 1UTHA 4PCDA 3HHFA 3IOTA 5CMBA 2G29A 4YB6A 4GXSB 3Q29A 1MY1A 2P2AA 4XKQA 3MP6A 5L9SA 3OO6A 2HAUA 3T22A 1P1OA 3RPLA 4F22A 3PUWE 3ZKLA 1MY3A 4H45A 3FXBA 1FPKA 2Q89A 3VV5A 4HCWA 1OQGA 1TFDA 3HN0A 3QUJA 1ZTYA 3N5LA 5J16A 4G4PA 5KCJA 4PDDA 3HO7A 4G68A 3DELB 4O94A 2PX1A 2NXOA 4KYDA 1B5HA 5DEXB 3KEIA 2FHYA 3KOTA 4MFIA 2FIXA 1R1NA 2CZHA 1YPNA 3PMVA 2I0BA 2O1MA 2WBDA 4PE5B 5I2KB 4IY6A 3CHGA 4IO6A 1B1HA 4X48A 1S9TA 3O6GA 2HXWA 4JVIA 4GX6A 3JV9A 4G8HA 4H5FA 3U92A 3I5OA 3K6XA 3PMWA 1NUZA 4NN3A 1AOVA 2RF1A 4MF3A 3TTNA 2W7YA 3K6UA 4OESA 2RINA 4OMBA 5CRYA 2QRYA 1B2HA 5AA1A 1SI0A 4QF9A 2HFBA 1FBCA 2KR0A 1LBXA 4GWYA 2PT1A 1IUDA 4MH5A 4LA9A 1AMFA 1RKMA 1A7LA 3LBSA 4R6HA 4ELRA 1N7XA 4PFWA 1Z7NE 3VVFA 2XXIA 4NF4A 4F39A 1MDP1 1SD3A 4IO5A 2PFYA 1SQYA 2XWIA 3PU5A 3PUYE 5I7IA 2QVUA 2D21A 4ZS9A 2ZMBA 3K6WA 3CG1A 3MWBA 1YTVA 3EPEA 3GBBA 1B58A 4AB6A 5JK4A 2PT2A 4QFLA 4C1UA 1XHYA 3TCFA 3GBAA 1NNPA 3FATA 5EYHA 2UYEA 3RYDA 3VLUA 3W9WA 4E0WA 2ZZWA 4KCDA 1H43A 3PTYA 4YKKA 4JVDA 2QVVA 2R8TA 1MY4A 2H98A 2ZYKA 2UXAA 5IZ3B 5H8FB 4KYEA 4MNPA 5TPAA 4NWDA 2XXHA 1ZJLA 3FVNA 1S7YA 1VSOA 4GOTA 1B0HA 1UTBA 5AA3A 3MZ9A 5AA2B 2VP1A 2XXUA 2O51A 1URGA 5H8QB 3E79A 5I3SA 3LSLA 1FPDA 2FYIA 2VD2A 4EXKA 1BKAA 3W15C 1OLAA 1DSNA 5EQAA 4DXUA 5ITOA 1NUWA 1JNFA 2FVZA 4PETA 4P47A 3EF7A 2UVJA 4P0IA 2I3VA 2E0SA 3PMXA 3T9HB 4P9KA 1JVYA 2HXRA 1YYZA 1SW1A 4EXLA 4N6PA 1RYOA 2NOOA 1MQGA 2XD2A 3RT6B 3TODA 2V3UA 1HSLA 2I4BA 3SZPA 4NMYA 1US5A 1A8FA 1WDNA 3ROJA 5L9MA 4M1VA 3CSBA 4I40A 2Y84A 4PFRA 1JW4A 2ANJA 1LCFA 4JBZA 1J1NA 4EUOA 3IO6A 4JWYA 1VFDA 1IMAA 4ELPA 2L5VA 5M2VA 5CI5A 3U94A 1T0KA 4FIMA 3ZS6A 4DIGA 3FJ7A 1QKAA 1LB8A 3EHSA 2DWIA 2D5WA 4U21A 3HV1A 3RQTA 4THIA 4XF5A 4PBQA 1FBFA 1B3FA 5FHMA 2CEXA 2NUVA 3A29A 1FRPA 1K9ZA 2ZZVA 1P1QA 2V93A 1HSJA 3TZAA 4PAFA 4YB5A 3RY3A 1XI6A 2WYPA 3OO7A 1YAEA 4I62A 2BJIA 1POY1 5A5LA 1MPCA 1SYIA 1ZU0A 2VPNA 1NNTA 1LBCA 4ZEIA 2PMSA 2FBPA 4X8RA 2VPOA 1IXGA 2I4CA 4F3GA 2CZKA 4MNCA 4GX4A 3T9XB 3O6HA 1RDYA 2PCRA 1TXFA 3FXRA 2DYXA 2ONRA 3TCHA 4OWDA 2O6AA 4XFEA 4GRKA 4Q5TA 1SBPA 4NTLA 1MG1A 2R6GE 3O9PA 5I2NA 2KQZA 3EHUA 3TEPA 1YXIA 4JVCA 1MM7A 2ALUA 4FEDA 5L9OA 2A5SA 2WYKA 1NV4A 3GYYA 4N91A 3DP6A 3UP9A 4GX3A 4EQ9A 3CI8A 4QSCA 1F9BA 1FW0A 4GLIA 2F6GA 4HTGA 4NE4A 1G0IA 5DVJA 4H0WA 3UGWA 1G0HA 3K4UA 2V84A 1RDZA 1NNKA 4H65A 1PDAA 5IKBA 5DTBA 4ZECA 1K9YA 4YKJA 5A5XB 4MNIA 5CBSA 4KCCA 3IO4A 4BDNA 2XWVA 1EZPA 1FTJA 1FPEA 4R74A 4I9DA 4R9GA 4GBWA 3PUXE 1DTGA 3M8UA 2QL3A 4XKRA 2ZNUA 4LZ8A 3V5AA 2XX7A 3T9VA 2UVIA 1DTZA 1RYXA 4DI3D 3DM0A 5EQ8A 3FV1A 4IO7A 3C32A 3WAEA 4LUBA 3UORA 4UA8A 4O3CA 3ZKKA 1MM6A 1S50A 1CE2A 3G3HA 4F31B 3TMGA 2YLNA 1VFEA 3OEMA 1DBZA 1Y1MA 3OSRA 3MVWA 1B51A 2YJPA 3B6QA 4TQUQ 2F7BA 1B3EA 3K1PA 2REJA 4ISUA 3MYUA 4OFLA 2Z8FA 4HE0A 4OENA 2QS4A 4F3BA 1PB9A 3KFMA 5H8HA 3KC1A 1B32A 4PBHA 2ONSA 1QW0A 1IEJA 4L17A 1R9QA 1Y20A 3S9LC 1NH7A 1DCUA 5DW8A 3PV0E 1B7HA 4G8NA 4I1DA 1LCTA 2FA7A 4GBVA 1UIVA 1IMFA 5DVIA 4HCYA 2HPGA 2M8CA 4O7IA 4F3PA 4Q30B 2ZYNA 4M4GA 5F24A 4UACA 1QUIA 3BFTA 2Q8MA 3DP4A 3CFXA 4GWXA 4AS4A 2P1SA 5EYFA 4U4SA 5FHOA 2XD3A 1DK4A 4AS5A 5JTYB 3SERA 1NNFA 1VR5A 4P8BA 2I3WA 3SEYA 1UTHB 4U1OA 3S4UA 4JWOA 3IFAA 3R7XA 3IB0A 1QJMA 4N13A 2I0CA 2ZNSA 5AA2D 3MP1A 4U23A 1DPEA 3RPLB 2F8DA 1PBQA 4ELQA 4Q0CA 4QXDA 3M3FA 2F7CA 3U1OA 4ZE9A 2F34A 3K0VA 2Q2CA 3RN8A 1BLFA 2Y7PA 3MZ1A 1P99A 2I48A 2V3QA 1MPDA 2F36A 4G68B 1AL3A 2F35A 3TTRA 2QMWA 1B3LA 2GRVA 4Z0IA 3IAZA 2XXKA 4FBPA 4QFKA 2QVRA 3MJNA 5ICQA 4F19A 4P0GA 1QVSA 1BK4A 3K1NA 2Y7RA 3O66A 1I6AA 1MQDA 1FQCA 4KPTA 3A3UA 4IO3A 1EYJA 4R6YA 2X26A 2KLFA 2Q74A 1OVTA 3SESA 1EH3A 1ZLQA 4ZEBA 5H8NA 3C34A 4FJPA 4NGUA 4LQ2A 2QS3A 2QJEA 4QFOA 3PPQA 4OEUA 3OSQA 3OD7A 1O63A 2Z22A 4PFYA 4X9TA 5TP9A 3H6UA 4GD5A 4YMAA 3KBZA 1Y4CA 2RC7A 4YAHX 1PB7A 4QRZA 4DZ1A 3H03A 4N6DA 3THIA 1NL5A 3BIGA 3HPIA 2XXWA 5DEXA 5ISUA 3PPRA 4JXIA 4MLQA 4DLDA 2DOJA 3F11A 4EDPA 1IMEA 3TQWA 2O68A 5ELVA 3MVYA 4NQ8A 4GWZA 1A99A 2G93A 4JDFA 3SEVA 3KN7A 1UIUA 3RLFE 4NEDA 3G3KA 5I58A 1N76A 4QBAA 5TPAB 3V83A 3A09A 3E9XA 2XXXA 3CRBA 1MY2A 1FBHA 4U2RA 3S9NC 2OLBA 1FJ9A 3G3FA 1DMBA 3BKIB 4EQ7A 3MP8A 3TDJA 3FJGA 1GTKA 4PAKA 2QFLA 4XKPA 2X7PA 2PVUA 4OQOA 1UTBB 3SKPA 4KD5A 2PYYA 3U93A 3PPOA 1B4HA 3CFLA 2DWAA 1FPGA 3IL1B 2AL5A 3IJOB 4LN5A 1B40A 1DPPA 4GFRA 2DP8A 4RK9A 3LSFB 3IORA 4OXVA 2O7UA 3KZGA 3G3JA 1B3GA 3T0JA 3PGFA 5EYGA 1XS5A 3LSXA 3MPKA 3C4MA 3O6IA 1LBWA 3IB1A 2QS2A 2DWJA 5I56A 3VVEA 1OIBA 2VOZA 3OELA 1D9YA 4ZZAA 4QSEA 4LATA 3TCGA 3KOSA 1IIWA 3Q28A 2UYFA 3H6VA 2QPQA 4PAIA 1JEUA 1A54A 2Y7KA 2O69A 1B3HA 3RTFB 1QULA 1LB9A 5K2XA 4GWSA 1XVXA 1FTMA 3CR9A 1LAFE 4BDOA 4NF6A 4LQ5A 4IB2A 3KSXA 5T3JA 3VDFA 1LGBC 2RCAA 3L6HA 2FNCA 2DVCA 3D4CA 4RPNA 4XXUA 5F7VA 1FPIA 1B7ZA 2GHBA 1FTLA 4PQJA 3HHGA 1B46A 1N84A 1YZ0A 3RUMA 1MDQA 3H3GA 3KBRA 2OZZA 2HZKA 3KJTA 3FXQA 2WBBA 4OVPA 1MH4A 2P3VA 4DE8A 3VLVA 1FQFA 2DVZA 1Y3PA 4R9FA 3MSTA 5B70A 4FAJA 3U72A 3K1MA 4GL8A 4XTCQ 4OYVA 4QSDA 2DXRA 4NF5A 3ODBA 4QFPA 1P1UA 2VT5A 4MCOA 2CZIA 1WVJA 2FIEA 2Z8EA 5IAIA 4LVQA 1B9JA 4X1DA 1D9VA 5CM6A 3FIRA 2R9JA 1Q1KA 1LFGA 4PFBA 2I49A 1OVBA 3MW0A 3OO8A 5I2NB 1UQWA 3FJMA 1FPFA 1IMBA 5I84A 3VXBA 4F1UA 4MAGA 2H5YA 4PF8A 1NUXA 1LEVA 2THIA 4LZ5A 3RNNA 5AA4B 4DCYA 5FBPA 3V89B 2XA5A 4FORA 3MVXA 1B05A 1PBPA 2GQ1A 2HQ0A 4N15A 1JVXA 1TWYA 4H8JA 2HCAA 3TQLA 1FQBA 3OO9A 3GLBA 3B50A 3OENA 4GIZA 5I59A 1URSA 3FZVA 2B3FA 4N8YA 3ECRA 4KHZE 1IQ7A 2I58A 1N0TA 3B6WA 3OMBA 3C36A 4X04A 2ZZXA 3I3VA 4KQPA 3H6WA 4N81A 1QKBA 4PDHA 1Z7ME 1NI9A 4XIGQ 3CSGA 4DXCA 5ET8A 2XWKA 1BIYA 4NWCA 3A3CA 4U1ZA 4R2BA 4G77A 2PBWA 1FCKA 1R9LA 3LUZA 4Z7EA 3UN6A 3SEXA 2ABHA 1I6QA 2XXRA 3C35A 3FVKA 1USYH 4F1VA 3EQ1A 3P7IA 4KI0E 4OVSA 5FTHA 1EYKA 3WAFA 2DE2A 5IM2A 2VD3A 1GGGA 1M5EA 1NV0A 2QSXA 4LONB 4F2OA 3TPAA 1PB8A 2X7QA 1GV8A 3QYTA 3B6TA 2ONKE 2F7AA 4R2FA 5ET5A 1II5A 3B8BA 4MBPA 4WEPA 4IY5A 5ESYA 3D4GA 1QGXA 3JYRA 3K00A 1XOCA 1EU8A 1B52A 4OFOA 3O28A 4MMPA 1EYIA 3FGSA 1LSTA 2DSFA 3ZSFA 5H8HB 1QUJA 4H8IA 3KGCA 1GVCA 4DI4B 2UVHA 3IK6B 3C9HA 3N6TA 4ZDMA 2DXYA 4FECA 1FPJA 3ILTB 4KXPA 1N3WA 2CZLA 1USYE 1AH5A 1MPBA 5CMMA 4JSOA 3IOWA 3EKIA 3IOUA 1MQJA 5HPQA 3TYHA 1ATGA 5LTCA 3FD3A 3O2AA 1MXUA 4RNSA 3RTWB 1FJ6A 4N07A 4PGNA 3U65A 4GWUA 5IGAA 4RXLA 5HM4B 4NF8A 2XXPA 4H6DA 1IMDA 4BDQA 1YCJA 1NV2A 5KDTA 5AE4A 3MUQA 1M5BA 4OVQA 1NV6A 1H45A 4OETA 3HSTA 2B4LA 4U4XA 1B7UA 2V3TA 1FBDA 5I5PA 4MX6A 1Y3NA 1O64A 3EHTA 5ET7A 1MRPA 4R6KA 4ZEKA 4DDDA 1LFIA 1TT1A 3SETA 4YICA 1SDXA 2V4CA 4P56A 3RPWA 4NAPA 3CVGA 3K2DA 4BDLA 3M3LA 4K3FA 2O1LA 3IB2A 3DP8A 3LC8A 4TLMB 3S9MC 1ELJA 3MZBA 4RK2A 1IXCA 3S9EA 4HXVA 1FTKA 1FPBA 3KSJA 4F29A 3CFZA 2IEEA 2XX8A 5KCJB 3V8XB 3ONMA 3QAXA 3TELA 4GQOA 3U8QA 5I57A 3K02A 2F3DA 2ZXTA 1CNQA 4ND9A 4P1EA 5BWJA 2XXYA 2WX9A 5JTYA 3T66A 3USDA 3SEWA 1VE4A 3FVGA 4MLVA 1EZ9A 2LAOA 4N6KA 4PP0A 2A5TA 1MY0A 3T1BA 4AB5A 2OWTA 1SYHA 1D4NA 1WODA 5ICTA 2H25A 5FTIA 1NH8A 3MAMA 5TP9B 2OCUA 4H67A 5CMCA 1SI1A 3ILUB 4I8CA 5J1DA 1H3DA 3UIFA 2R71A 4ZEDA 1A40A 1O7TA 1HSEA 2Z23A 2Q9TA 3H6TA 2YPNA 4OTEA 1NV7A 1N7WA 2RC8A 4PFIA 3IJXB 3Q26A 4KYSA 3TUSA 2OBGA 3LV0A 4NF4B 1QUKA 2HZLA 2OK2A 2Y5LA
chains in the Genus database with same CATH topology
4E0XA 4R73A 5CBRA 3VXCA 2AYSA 2Q88A 2RCBA 2XXTA 4IGTA 2E1SA 4O3BA 4JB7A 5I58B 3VE1B 4KR5A 5I2KA 4F2QA 4PFTA 1SW4A 2I6EA 5CC2A 1LAGE 2XHDA 4F1YA 1IZ1A 3BBRA 1M5CA 1IXIA 3TAJA 1US4A 2GH9A 1BP5A 1Y1ZA 3MQ9A 2QS1A 2DQVA 4WEDA 2NWJA 1M5DA 3VFJA 2RC9A 4G68C 1LBBA 2VGQA 1FQEA 2HAVA 3KG2A 5DVFA 4RA1A 1B4ZA 2HEUA 2QMXA 3C31A 1I6BA 4R72A 4GVOA 1AIVA 1Y3QA 4ZEFA 3QIMA 5F1QA 1SW5A 1FQDA 2H9BA 5HBCA 5I56B 1OLCA 2DS9A 3RGYA 2DE3A 2WKYA 4DCXA 1ZIUA 4RY1A 1ANFA 5CMKA 3S2VA 1XC1A 3K01A 1P1WA 3MPLA 3OEKA 4BDMA 4BLAA 5BUUA 4KFQA 3GZGA 5DT6A 2XX9A 4F18A 3M3KA 2P0SA 4JSDA 3E3KA 5H8FA 4NF6B 3LUYA 3OOAA 1SVXB 4TOZA 1LAHE 3QUFA 1BTJA 2Z8DA 1H76A 3FVOA 2F6PA 1Q35A 1MS7A 1PEBA 5AA2A 3VVDA 4EF2A 4C0RA 3L6GA 5H8QA 4IGRA 4RPOA 2ZNTA 3QSLA 1I69A 2XXVA 2OJTA 2H4IA 4R75A 1B5JA 2O7IA 4NF5B 3QK6A 1B5IA 3TTMA 4PFUA 3K6VA 4G2ZA 1PC3A 3H4ZA 2Y7WA 1A8EA 2DWHA 4ELOA 4OVJA 4YU0A 4YB7A 2D3IA 4ZE8A 3H7MA 2UVGA 4WXJA 3G3IA 4X1BA 3TTKA 3TTLA 3KN8A 2F97A 3T96B 1JW1A 3B7DA 3N6UA 3SDFA 3G7WA 2O84X 3H06B 3PPPA 3SEUA 4HS7A 1FTOA 3LR1A 3CG3A 3LSWA 5I59B 2BJJX 4TLLB 1IXHA 4ESXA 1Y4TA 1B0LA 3TFLA 4Q8RA 3N94A 4WKMA 5TU0A 3KN3A 3MVZA 4U22A 4XKNA 4GL0A 4QFNA 2B3BA 4ZZEA 4RJZA 5KZTA 1M5FA 4P11A 2Q2AA 4IO4A 1SW2A 3R6UA 2ZYMA 1DOTA 1LAXA 1ZBMA 5AA4A 4FATA 1CB6A 4BDRA 3OXNA 3R26A 1MXVA 4JWXA 4OEVA 2OWSA 2F5XA 1Y9UA 3PUVE 1NMUA 4C1TA 3HCQA 1H44A 3E13X 5JEIA 3IOVA 2NVUB 1R6ZA 1JEVA 3PUZE 4POXA 3PPNA 3MBPA 1LLSA 4POWA 3JZJA 3FASA 4FE8A 2AIXA 4ECFA 4F3SA 3T93B 3UK4A 3W9VA 3G3GA 3PD9A 1KWHA 4AQ4A 5A5XA 4EQBA 4GWOA 5EHMA 1D3KA 2CMOA 4DXBA 4YMBA 2GFEA 5K2YA 1JQFA 4QHQA 5B7DA 5LOMA 5L8DA 1IITA 3I6VA 2Y7IA 4ONYA 1JETA 2V25A 4NF8B 1LFHA 3T9UA 4GXAA 2XXQA 1NKXA 4FEBA 2Q8JA 4YKPA 2B65A 3IX1A 5KDTB 3C33A 1FQAA 5ITPA 1GR2A 1ZKBA 4O3AA 5EHSA 4EF1A 1POTA 1B1XA 1MXZA 2F78A 3N26A 3VLWA 1MXWA 2GHAA 3Q27A 1ZMGA 1JW5A 1NFTA 3IR1A 1TFAA 3AXFA 4RYAA 3GXAA 2AL4A 1MXYA 4YZZA 1B6HA 2H99A 3EN3A 1EZOA 1OMPA 5FHNA 3Q25A 1P1NA 2REGA 3E4RA 4GF8A 1N04A 3FUZA 4OERA 1A55A 1N3XA 2ZYOA 2DE4A 2VHAA 3CIJA 3RT8A 4HW8A 1L5TA 1MQIA 4LP2B 1MXXA 3QXMA 2IA4A 4LZ7A 5I57B 4YKIA 3O29A 1URDA 1XVYA 3MC2A 3PD8A 3UA8A 3O97A 3FV2A 4IO2A 4ESWA 3BFUA 3KJ7A 2RKMA 3TKDA 1OQHA 4H5GA 2A5TB 4OHNA 1XT8A 4G8MA 5H8SA 4OFJA 2ESNA 1MH3A 5DYHA 3DLNA 5H8NB 3FXUA 1MQHA 4H1XA 4OZ9A 1UTHA 3HHFA 3IOTA 5CMBA 2G29A 4YB6A 4GXSB 3Q29A 1MY1A 2P2AA 4XKQA 3MP6A 5L9SA 3OO6A 2HAUA 3T22A 1P1OA 4F22A 3PUWE 3ZKLA 1MY3A 2Q89A 3VV5A 4HCWA 1OQGA 1TFDA 3HN0A 3QUJA 1ZTYA 3N5LA 4G4PA 5KCJA 3HO7A 4G68A 3DELB 2PX1A 2NXOA 4KYDA 1B5HA 5DEXB 3KEIA 3KOTA 4MFIA 1R1NA 1YPNA 3PMVA 2I0BA 2O1MA 4PE5B 5I2KB 4IY6A 4IO6A 1B1HA 4X48A 1S9TA 3O6GA 2HXWA 3JV9A 4G8HA 4H5FA 3U92A 3I5OA 3K6XA 3PMWA 1AOVA 2RF1A 4MF3A 3TTNA 2W7YA 3K6UA 4OESA 2RINA 4OMBA 5CRYA 2QRYA 1B2HA 5AA1A 1SI0A 4QF9A 2HFBA 2PT1A 1IUDA 4MH5A 4LA9A 1AMFA 1RKMA 1A7LA 3LBSA 4R6HA 4ELRA 1N7XA 4PFWA 1Z7NE 3VVFA 2XXIA 4NF4A 4F39A 1MDP1 1SD3A 4IO5A 1SQYA 3PU5A 3PUYE 2D21A 4ZS9A 2ZMBA 3K6WA 3CG1A 3MWBA 1YTVA 3EPEA 3GBBA 1B58A 4AB6A 5JK4A 2PT2A 4QFLA 4C1UA 1XHYA 3TCFA 3GBAA 1NNPA 3FATA 2UYEA 3VLUA 3W9WA 4E0WA 4KCDA 1H43A 4YKKA 1MY4A 2H98A 2ZYKA 2UXAA 5H8FB 4KYEA 5TPAA 4NWDA 2XXHA 1ZJLA 3FVNA 1S7YA 1VSOA 4GOTA 1B0HA 1UTBA 5AA3A 3MZ9A 5AA2B 2VP1A 2XXUA 2O51A 1URGA 5H8QB 3LSLA 2FYIA 2VD2A 4EXKA 1BKAA 3W15C 1OLAA 1DSNA 4DXUA 5ITOA 1JNFA 4PETA 3EF7A 2UVJA 4P0IA 2I3VA 2E0SA 3PMXA 3T9HB 1JVYA 1SW1A 4EXLA 4N6PA 1RYOA 2NOOA 1MQGA 2XD2A 3RT6B 3TODA 2V3UA 1HSLA 2I4BA 4NMYA 1US5A 1A8FA 1WDNA 5L9MA 4M1VA 3CSBA 2Y84A 1JW4A 2ANJA 1LCFA 4JBZA 1J1NA 4EUOA 3IO6A 4JWYA 1VFDA 4ELPA 5M2VA 3U94A 5CI5A 1T0KA 4FIMA 3ZS6A 4DIGA 3FJ7A 1QKAA 1LB8A 3EHSA 2DWIA 2D5WA 4U21A 3HV1A 3RQTA 4THIA 1B3FA 5FHMA 2NUVA 1P1QA 2V93A 1HSJA 3TZAA 4YB5A 3RY3A 3OO7A 1YAEA 4I62A 1POY1 1MPCA 1SYIA 1ZU0A 1NNTA 1LBCA 4ZEIA 2PMSA 1IXGA 2I4CA 4F3GA 3T9XB 3O6HA 1TXFA 3FXRA 2DYXA 2ONRA 3TCHA 4OWDA 2O6AA 4GRKA 4Q5TA 1SBPA 4NTLA 1MG1A 2R6GE 3O9PA 5I2NA 3EHUA 3TEPA 1MM7A 2ALUA 4FEDA 5L9OA 2A5SA 3DP6A 3UP9A 4EQ9A 3CI8A 4QSCA 1F9BA 1FW0A 4GLIA 2F6GA 4HTGA 4NE4A 5DVJA 4H0WA 3UGWA 3K4UA 2V84A 1NNKA 4H65A 1PDAA 5IKBA 5DTBA 4ZECA 4YKJA 5A5XB 5CBSA 4KCCA 3IO4A 4BDNA 1EZPA 1FTJA 4R74A 4I9DA 4R9GA 3PUXE 1DTGA 3M8UA 2QL3A 4XKRA 2ZNUA 4LZ8A 3V5AA 2XX7A 3T9VA 2UVIA 1DTZA 1RYXA 3DM0A 3FV1A 4IO7A 3C32A 3WAEA 4LUBA 3UORA 4UA8A 4O3CA 3ZKKA 1MM6A 1S50A 1CE2A 3G3HA 4F31B 3TMGA 2YLNA 1VFEA 3OEMA 1Y1MA 3OSRA 3MVWA 1B51A 2YJPA 3B6QA 4TQUQ 2F7BA 1B3EA 3K1PA 2REJA 4ISUA 4OFLA 2Z8FA 4OENA 2QS4A 4F3BA 1PB9A 3KFMA 5H8HA 1B32A 2ONSA 1QW0A 1IEJA 4L17A 1R9QA 1Y20A 3S9LC 1NH7A 3PV0E 1B7HA 4G8NA 4I1DA 1LCTA 2FA7A 1UIVA 5DVIA 4HCYA 2M8CA 4F3PA 4Q30B 2ZYNA 4M4GA 4UACA 1QUIA 3BFTA 3DP4A 3CFXA 2P1SA 5EYFA 4U4SA 5FHOA 2XD3A 5JTYB 3SERA 1NNFA 1VR5A 2I3WA 3SEYA 1UTHB 4U1OA 3S4UA 4JWOA 3R7XA 3IB0A 1QJMA 4N13A 2I0CA 2ZNSA 5AA2D 3MP1A 4U23A 1DPEA 2F8DA 1PBQA 4ELQA 4Q0CA 3M3FA 2F7CA 3U1OA 4ZE9A 2F34A 3K0VA 2Q2CA 3RN8A 1BLFA 2Y7PA 3MZ1A 1P99A 2I48A 2V3QA 1MPDA 2F36A 4G68B 1AL3A 2F35A 3TTRA 2QMWA 1B3LA 2GRVA 4Z0IA 3IAZA 4QFKA 3MJNA 5ICQA 4F19A 4P0GA 1QVSA 3K1NA 2Y7RA 3O66A 1I6AA 1MQDA 1FQCA 4KPTA 3A3UA 4IO3A 4R6YA 2X26A 2KLFA 1OVTA 3SESA 1EH3A 1ZLQA 4ZEBA 5H8NA 3C34A 4FJPA 4LQ2A 2QS3A 2QJEA 4QFOA 3PPQA 4OEUA 3OSQA 3OD7A 1O63A 2Z22A 4PFYA 4X9TA 5TP9A 3H6UA 4GD5A 4YMAA 1Y4CA 2RC7A 4YAHX 1PB7A 4QRZA 4DZ1A 3H03A 3THIA 1NL5A 3HPIA 2XXWA 5DEXA 5ISUA 3PPRA 4JXIA 4MLQA 4DLDA 2DOJA 3F11A 4EDPA 3TQWA 2O68A 5ELVA 3MVYA 1A99A 2G93A 4JDFA 3SEVA 3KN7A 1UIUA 3RLFE 4NEDA 3G3KA 5I58A 1N76A 5TPAB 3V83A 3A09A 3E9XA 2XXXA 3CRBA 1MY2A 4U2RA 3S9NC 2OLBA 3G3FA 1DMBA 3BKIB 4EQ7A 3MP8A 3TDJA 3FJGA 1GTKA 4XKPA 2X7PA 2PVUA 4OQOA 1UTBB 3SKPA 4KD5A 2PYYA 3U93A 3PPOA 1B4HA 3CFLA 2DWAA 3IL1B 2AL5A 3IJOB 1B40A 1DPPA 4GFRA 2DP8A 4RK9A 3LSFB 3IORA 4OXVA 2O7UA 3KZGA 3G3JA 1B3GA 3PGFA 1XS5A 3LSXA 3MPKA 3C4MA 3O6IA 3IB1A 2QS2A 2DWJA 5I56A 3VVEA 1OIBA 2VOZA 3OELA 1D9YA 4ZZAA 4QSEA 4LATA 3TCGA 3KOSA 1IIWA 3Q28A 2UYFA 3H6VA 2QPQA 1JEUA 1A54A 2Y7KA 2O69A 1B3HA 3RTFB 1QULA 1LB9A 5K2XA 1XVXA 1FTMA 3CR9A 1LAFE 4BDOA 4NF6A 4LQ5A 4IB2A 3KSXA 3VDFA 1LGBC 2RCAA 3L6HA 2FNCA 2DVCA 3D4CA 4RPNA 4XXUA 5F7VA 1B7ZA 2GHBA 1FTLA 4PQJA 3HHGA 1B46A 1N84A 3RUMA 1MDQA 3H3GA 3KBRA 2OZZA 2HZKA 3KJTA 3FXQA 1MH4A 4DE8A 3VLVA 1FQFA 2DVZA 1Y3PA 4R9FA 5B70A 4FAJA 3U72A 3K1MA 4GL8A 4XTCQ 4OYVA 4QSDA 2DXRA 4NF5A 3ODBA 4QFPA 1P1UA 1WVJA 2Z8EA 5IAIA 4LVQA 1B9JA 4X1DA 1D9VA 5CM6A 3FIRA 2R9JA 1Q1KA 1LFGA 2I49A 1OVBA 3MW0A 3OO8A 5I2NB 1UQWA 3FJMA 5I84A 3VXBA 4F1UA 2H5YA 2THIA 4LZ5A 3RNNA 5AA4B 4DCYA 3V89B 4FORA 3MVXA 1B05A 1PBPA 2HQ0A 1JVXA 1TWYA 4H8JA 2HCAA 3TQLA 1FQBA 3OO9A 3GLBA 3OENA 4GIZA 5I59A 1URSA 3FZVA 2B3FA 3ECRA 4KHZE 1IQ7A 2I58A 1N0TA 3B6WA 3OMBA 3C36A 3I3VA 4KQPA 3H6WA 1QKBA 1Z7ME 4XIGQ 3CSGA 4DXCA 1BIYA 4NWCA 3A3CA 4U1ZA 4R2BA 4G77A 2PBWA 1FCKA 1R9LA 4Z7EA 3UN6A 3SEXA 2ABHA 1I6QA 2XXRA 3C35A 3FVKA 1USYH 4F1VA 3EQ1A 3P7IA 4KI0E 5FTHA 3WAFA 2DE2A 2VD3A 1GGGA 1M5EA 2QSXA 4LONB 4F2OA 3TPAA 1PB8A 2X7QA 1GV8A 3QYTA 3B6TA 2ONKE 2F7AA 4R2FA 1II5A 4MBPA 4WEPA 4IY5A 3D4GA 3JYRA 3K00A 1XOCA 1EU8A 1B52A 4OFOA 3O28A 3FGSA 1LSTA 2DSFA 3ZSFA 5H8HB 1QUJA 4H8IA 3KGCA 1GVCA 2UVHA 3IK6B 3C9HA 3N6TA 4ZDMA 2DXYA 4FECA 3ILTB 1N3WA 2CZLA 1USYE 1AH5A 1MPBA 5CMMA 4JSOA 3IOWA 3IOUA 1MQJA 5HPQA 3TYHA 1ATGA 3FD3A 3O2AA 1MXUA 4RNSA 3RTWB 4N07A 4RXLA 5HM4B 4NF8A 2XXPA 4H6DA 4BDQA 1YCJA 5KDTA 5AE4A 3MUQA 1M5BA 1H45A 4OETA 3HSTA 4U4XA 1B7UA 2V3TA 1Y3NA 1O64A 3EHTA 1MRPA 4R6KA 4ZEKA 4DDDA 1LFIA 1TT1A 3SETA 4YICA 1SDXA 3RPWA 3CVGA 3K2DA 4BDLA 3M3LA 4K3FA 2O1LA 3IB2A 3DP8A 3LC8A 4TLMB 3S9MC 1ELJA 3MZBA 4RK2A 1IXCA 3S9EA 1FTKA 3KSJA 4F29A 3CFZA 2IEEA 2XX8A 5KCJB 3V8XB 3ONMA 3QAXA 3TELA 4GQOA 3U8QA 5I57A 3K02A 2ZXTA 4ND9A 5BWJA 2XXYA 5JTYA 3T66A 3USDA 3SEWA 1VE4A 3FVGA 4MLVA 1EZ9A 2LAOA 4PP0A 2A5TA 1MY0A 4AB5A 2OWTA 1SYHA 1D4NA 1WODA 5ICTA 2H25A 5FTIA 1NH8A 3MAMA 5TP9B 2OCUA 4H67A 5CMCA 1SI1A 3ILUB 4I8CA 5J1DA 1H3DA 3UIFA 2R71A 4ZEDA 1A40A 1O7TA 1HSEA 2Z23A 2Q9TA 3H6TA 2YPNA 4OTEA 1N7WA 2RC8A 3IJXB 3Q26A 4KYSA 3TUSA 2OBGA 4NF4B 1QUKA 2HZLA 2OK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0X A;  4R73 A;  5CBR A;  3VXC A;  2AYS A;  2Q88 A;  2RCB A;  2XXT A;  4IGT A;  2E1S A;  4O3B A;  4JB7 A;  5I58 B;  3VE1 B;  4KR5 A;  5I2K A;  4F2Q A;  4PFT A;  1SW4 A;  2I6E A;  5CC2 A;  1LAG E;  2XHD A;  4F1Y A;  1IZ1 A;  3BBR A;  1M5C A;  1IXI A;  3TAJ A;  1US4 A;  2GH9 A;  1BP5 A;  1Y1Z A;  3MQ9 A;  2QS1 A;  2DQV A;  4WED A;  2NWJ A;  1M5D A;  3VFJ A;  2RC9 A;  4G68 C;  1LBB A;  2VGQ A;  1FQE A;  2HAV A;  3KG2 A;  5DVF A;  4RA1 A;  1B4Z A;  2HEU A;  2QMX A;  3C31 A;  1I6B A;  4R72 A;  4GVO A;  1AIV A;  1Y3Q A;  4ZEF A;  3QIM A;  5F1Q A;  1SW5 A;  1FQD A;  2H9B A;  5HBC A;  5I56 B;  1OLC A;  2DS9 A;  3RGY A;  2DE3 A;  2WKY A;  4DCX A;  1ZIU A;  4RY1 A;  1ANF A;  5CMK A;  3S2V A;  1XC1 A;  3K01 A;  1P1W A;  3MPL A;  3OEK A;  4BDM A;  4BLA A;  5BUU A;  4KFQ A;  3GZG A;  5DT6 A;  2XX9 A;  4F18 A;  3M3K A;  2P0S A;  4JSD A;  3E3K A;  5H8F A;  4NF6 B;  3LUY A;  3OOA A;  1SVX B;  4TOZ A;  1LAH E;  3QUF A;  1BTJ A;  2Z8D A;  1H76 A;  3FVO A;  2F6P A;  1Q35 A;  1MS7 A;  1PEB A;  5AA2 A;  3VVD A;  4EF2 A;  4C0R A;  3L6G A;  5H8Q A;  4IGR A;  4RPO A;  2ZNT A;  3QSL A;  1I69 A;  2XXV A;  2OJT A;  2H4I A;  4R75 A;  1B5J A;  2O7I A;  4NF5 B;  3QK6 A;  1B5I A;  3TTM A;  4PFU A;  3K6V A;  4G2Z A;  1PC3 A;  3H4Z A;  2Y7W A;  1A8E A;  2DWH A;  4ELO A;  4OVJ A;  4YU0 A;  4YB7 A;  2D3I A;  4ZE8 A;  3H7M A;  2UVG A;  4WXJ A;  3G3I A;  4X1B A;  3TTK A;  3TTL A;  3KN8 A;  2F97 A;  3T96 B;  1JW1 A;  3B7D A;  3N6U A;  3SDF A;  3G7W A;  2O84 X;  3H06 B;  3PPP A;  3SEU A;  4HS7 A;  1FTO A;  3LR1 A;  3CG3 A;  3LSW A;  5I59 B;  2BJJ X;  4TLL B;  1IXH A;  4ESX A;  1Y4T A;  1B0L A;  3TFL A;  4Q8R A;  3N94 A;  4WKM A;  5TU0 A;  3KN3 A;  3MVZ A;  4U22 A;  4XKN A;  4GL0 A;  4QFN A;  2B3B A;  4ZZE A;  4RJZ A;  5KZT A;  1M5F A;  4P11 A;  2Q2A A;  4IO4 A;  1SW2 A;  3R6U A;  2ZYM A;  1DOT A;  1LAX A;  1ZBM A;  5AA4 A;  4FAT A;  1CB6 A;  4BDR A;  3OXN A;  3R26 A;  1MXV A;  4JWX A;  4OEV A;  2OWS A;  2F5X A;  1Y9U A;  3PUV E;  1NMU A;  4C1T A;  3HCQ A;  1H44 A;  3E13 X;  5JEI A;  3IOV A;  2NVU B;  1R6Z A;  1JEV A;  3PUZ E;  4POX A;  3PPN A;  3MBP A;  1LLS A;  4POW A;  3JZJ A;  3FAS A;  4FE8 A;  2AIX A;  4ECF A;  4F3S A;  3T93 B;  3UK4 A;  3W9V A;  3G3G A;  3PD9 A;  1KWH A;  4AQ4 A;  5A5X A;  4EQB A;  4GWO A;  5EHM A;  1D3K A;  2CMO A;  4DXB A;  4YMB A;  2GFE A;  5K2Y A;  1JQF A;  4QHQ A;  5B7D A;  5LOM A;  5L8D A;  1IIT A;  3I6V A;  2Y7I A;  4ONY A;  1JET A;  2V25 A;  4NF8 B;  1LFH A;  3T9U A;  4GXA A;  2XXQ A;  1NKX A;  4FEB A;  2Q8J A;  4YKP A;  2B65 A;  3IX1 A;  5KDT B;  3C33 A;  1FQA A;  5ITP A;  1GR2 A;  1ZKB A;  4O3A A;  5EHS A;  4EF1 A;  1POT A;  1B1X A;  1MXZ A;  2F78 A;  3N26 A;  3VLW A;  1MXW A;  2GHA A;  3Q27 A;  1ZMG A;  1JW5 A;  1NFT A;  3IR1 A;  1TFA A;  3AXF A;  4RYA A;  3GXA A;  2AL4 A;  1MXY A;  4YZZ A;  1B6H A;  2H99 A;  3EN3 A;  1EZO A;  1OMP A;  5FHN A;  3Q25 A;  1P1N A;  2REG A;  3E4R A;  4GF8 A;  1N04 A;  3FUZ A;  4OER A;  1A55 A;  1N3X A;  2ZYO A;  2DE4 A;  2VHA A;  3CIJ A;  3RT8 A;  4HW8 A;  1L5T A;  1MQI A;  4LP2 B;  1MXX A;  3QXM A;  2IA4 A;  4LZ7 A;  5I57 B;  4YKI A;  3O29 A;  1URD A;  1XVY A;  3MC2 A;  3PD8 A;  3UA8 A;  3O97 A;  3FV2 A;  4IO2 A;  4ESW A;  3BFU A;  3KJ7 A;  2RKM A;  3TKD A;  1OQH A;  4H5G A;  2A5T B;  4OHN A;  1XT8 A;  4G8M A;  5H8S A;  4OFJ A;  2ESN A;  1MH3 A;  5DYH A;  3DLN A;  5H8N B;  3FXU A;  1MQH A;  4H1X A;  4OZ9 A;  1UTH A;  3HHF A;  3IOT A;  5CMB A;  2G29 A;  4YB6 A;  4GXS B;  3Q29 A;  1MY1 A;  2P2A A;  4XKQ A;  3MP6 A;  5L9S A;  3OO6 A;  2HAU A;  3T22 A;  1P1O A;  4F22 A;  3PUW E;  3ZKL A;  1MY3 A;  2Q89 A;  3VV5 A;  4HCW A;  1OQG A;  1TFD A;  3HN0 A;  3QUJ A;  1ZTY A;  3N5L A;  4G4P A;  5KCJ A;  3HO7 A;  4G68 A;  3DEL B;  2PX1 A;  2NXO A;  4KYD A;  1B5H A;  5DEX B;  3KEI A;  3KOT A;  4MFI A;  1R1N A;  1YPN A;  3PMV A;  2I0B A;  2O1M A;  4PE5 B;  5I2K B;  4IY6 A;  4IO6 A;  1B1H A;  4X48 A;  1S9T A;  3O6G A;  2HXW A;  3JV9 A;  4G8H A;  4H5F A;  3U92 A;  3I5O A;  3K6X A;  3PMW A;  1AOV A;  2RF1 A;  4MF3 A;  3TTN A;  2W7Y A;  3K6U A;  4OES A;  2RIN A;  4OMB A;  5CRY A;  2QRY A;  1B2H A;  5AA1 A;  1SI0 A;  4QF9 A;  2HFB A;  2PT1 A;  1IUD A;  4MH5 A;  4LA9 A;  1AMF A;  1RKM A;  1A7L A;  3LBS A;  4R6H A;  4ELR A;  1N7X A;  4PFW A;  1Z7N E;  3VVF A;  2XXI A;  4NF4 A;  4F39 A;  1MDP 1;  1SD3 A;  4IO5 A;  1SQY A;  3PU5 A;  3PUY E;  2D21 A;  4ZS9 A;  2ZMB A;  3K6W A;  3CG1 A;  3MWB A;  1YTV A;  3EPE A;  3GBB A;  1B58 A;  4AB6 A;  5JK4 A;  2PT2 A;  4QFL A;  4C1U A;  1XHY A;  3TCF A;  3GBA A;  1NNP A;  3FAT A;  2UYE A;  3VLU A;  3W9W A;  4E0W A;  4KCD A;  1H43 A;  4YKK A;  1MY4 A;  2H98 A;  2ZYK A;  2UXA A;  5H8F B;  4KYE A;  5TPA A;  4NWD A;  2XXH A;  1ZJL A;  3FVN A;  1S7Y A;  1VSO A;  4GOT A;  1B0H A;  1UTB A;  5AA3 A;  3MZ9 A;  5AA2 B;  2VP1 A;  2XXU A;  2O51 A;  1URG A;  5H8Q B;  3LSL A;  2FYI A;  2VD2 A;  4EXK A;  1BKA A;  3W15 C;  1OLA A;  1DSN A;  4DXU A;  5ITO A;  1JNF A;  4PET A;  3EF7 A;  2UVJ A;  4P0I A;  2I3V A;  2E0S A;  3PMX A;  3T9H B;  1JVY A;  1SW1 A;  4EXL A;  4N6P A;  1RYO A;  2NOO A;  1MQG A;  2XD2 A;  3RT6 B;  3TOD A;  2V3U A;  1HSL A;  2I4B A;  4NMY A;  1US5 A;  1A8F A;  1WDN A;  5L9M A;  4M1V A;  3CSB A;  2Y84 A;  1JW4 A;  2ANJ A;  1LCF A;  4JBZ A;  1J1N A;  4EUO A;  3IO6 A;  4JWY A;  1VFD A;  4ELP A;  5M2V A;  3U94 A;  5CI5 A;  1T0K A;  4FIM A;  3ZS6 A;  4DIG A;  3FJ7 A;  1QKA A;  1LB8 A;  3EHS A;  2DWI A;  2D5W A;  4U21 A;  3HV1 A;  3RQT A;  4THI A;  1B3F A;  5FHM A;  2NUV A;  1P1Q A;  2V93 A;  1HSJ A;  3TZA A;  4YB5 A;  3RY3 A;  3OO7 A;  1YAE A;  4I62 A;  1POY 1;  1MPC A;  1SYI A;  1ZU0 A;  1NNT A;  1LBC A;  4ZEI A;  2PMS A;  1IXG A;  2I4C A;  4F3G A;  3T9X B;  3O6H A;  1TXF A;  3FXR A;  2DYX A;  2ONR A;  3TCH A;  4OWD A;  2O6A A;  4GRK A;  4Q5T A;  1SBP A;  4NTL A;  1MG1 A;  2R6G E;  3O9P A;  5I2N A;  3EHU A;  3TEP A;  1MM7 A;  2ALU A;  4FED A;  5L9O A;  2A5S A;  3DP6 A;  3UP9 A;  4EQ9 A;  3CI8 A;  4QSC A;  1F9B A;  1FW0 A;  4GLI A;  2F6G A;  4HTG A;  4NE4 A;  5DVJ A;  4H0W A;  3UGW A;  3K4U A;  2V84 A;  1NNK A;  4H65 A;  1PDA A;  5IKB A;  5DTB A;  4ZEC A;  4YKJ A;  5A5X B;  5CBS A;  4KCC A;  3IO4 A;  4BDN A;  1EZP A;  1FTJ A;  4R74 A;  4I9D A;  4R9G A;  3PUX E;  1DTG A;  3M8U A;  2QL3 A;  4XKR A;  2ZNU A;  4LZ8 A;  3V5A A;  2XX7 A;  3T9V A;  2UVI A;  1DTZ A;  1RYX A;  3DM0 A;  3FV1 A;  4IO7 A;  3C32 A;  3WAE A;  4LUB A;  3UOR A;  4UA8 A;  4O3C A;  3ZKK A;  1MM6 A;  1S50 A;  1CE2 A;  3G3H A;  4F31 B;  3TMG A;  2YLN A;  1VFE A;  3OEM A;  1Y1M A;  3OSR A;  3MVW A;  1B51 A;  2YJP A;  3B6Q A;  4TQU Q;  2F7B A;  1B3E A;  3K1P A;  2REJ A;  4ISU A;  4OFL A;  2Z8F A;  4OEN A;  2QS4 A;  4F3B A;  1PB9 A;  3KFM A;  5H8H A;  1B32 A;  2ONS A;  1QW0 A;  1IEJ A;  4L17 A;  1R9Q A;  1Y20 A;  3S9L C;  1NH7 A;  3PV0 E;  1B7H A;  4G8N A;  4I1D A;  1LCT A;  2FA7 A;  1UIV A;  5DVI A;  4HCY A;  2M8C A;  4F3P A;  4Q30 B;  2ZYN A;  4M4G A;  4UAC A;  1QUI A;  3BFT A;  3DP4 A;  3CFX A;  2P1S A;  5EYF A;  4U4S A;  5FHO A;  2XD3 A;  5JTY B;  3SER A;  1NNF A;  1VR5 A;  2I3W A;  3SEY A;  1UTH B;  4U1O A;  3S4U A;  4JWO A;  3R7X A;  3IB0 A;  1QJM A;  4N13 A;  2I0C A;  2ZNS A;  5AA2 D;  3MP1 A;  4U23 A;  1DPE A;  2F8D A;  1PBQ A;  4ELQ A;  4Q0C A;  3M3F A;  2F7C A;  3U1O A;  4ZE9 A;  2F34 A;  3K0V A;  2Q2C A;  3RN8 A;  1BLF A;  2Y7P A;  3MZ1 A;  1P99 A;  2I48 A;  2V3Q A;  1MPD A;  2F36 A;  4G68 B;  1AL3 A;  2F35 A;  3TTR A;  2QMW A;  1B3L A;  2GRV A;  4Z0I A;  3IAZ A;  4QFK A;  3MJN A;  5ICQ A;  4F19 A;  4P0G A;  1QVS A;  3K1N A;  2Y7R A;  3O66 A;  1I6A A;  1MQD A;  1FQC A;  4KPT A;  3A3U A;  4IO3 A;  4R6Y A;  2X26 A;  2KLF A;  1OVT A;  3SES A;  1EH3 A;  1ZLQ A;  4ZEB A;  5H8N A;  3C34 A;  4FJP A;  4LQ2 A;  2QS3 A;  2QJE A;  4QFO A;  3PPQ A;  4OEU A;  3OSQ A;  3OD7 A;  1O63 A;  2Z22 A;  4PFY A;  4X9T A;  5TP9 A;  3H6U A;  4GD5 A;  4YMA A;  1Y4C A;  2RC7 A;  4YAH X;  1PB7 A;  4QRZ A;  4DZ1 A;  3H03 A;  3THI A;  1NL5 A;  3HPI A;  2XXW A;  5DEX A;  5ISU A;  3PPR A;  4JXI A;  4MLQ A;  4DLD A;  2DOJ A;  3F11 A;  4EDP A;  3TQW A;  2O68 A;  5ELV A;  3MVY A;  1A99 A;  2G93 A;  4JDF A;  3SEV A;  3KN7 A;  1UIU A;  3RLF E;  4NED A;  3G3K A;  5I58 A;  1N76 A;  5TPA B;  3V83 A;  3A09 A;  3E9X A;  2XXX A;  3CRB A;  1MY2 A;  4U2R A;  3S9N C;  2OLB A;  3G3F A;  1DMB A;  3BKI B;  4EQ7 A;  3MP8 A;  3TDJ A;  3FJG A;  1GTK A;  4XKP A;  2X7P A;  2PVU A;  4OQO A;  1UTB B;  3SKP A;  4KD5 A;  2PYY A;  3U93 A;  3PPO A;  1B4H A;  3CFL A;  2DWA A;  3IL1 B;  2AL5 A;  3IJO B;  1B40 A;  1DPP A;  4GFR A;  2DP8 A;  4RK9 A;  3LSF B;  3IOR A;  4OXV A;  2O7U A;  3KZG A;  3G3J A;  1B3G A;  3PGF A;  1XS5 A;  3LSX A;  3MPK A;  3C4M A;  3O6I A;  3IB1 A;  2QS2 A;  2DWJ A;  5I56 A;  3VVE A;  1OIB A;  2VOZ A;  3OEL A;  1D9Y A;  4ZZA A;  4QSE A;  4LAT A;  3TCG A;  3KOS A;  1IIW A;  3Q28 A;  2UYF A;  3H6V A;  2QPQ A;  1JEU A;  1A54 A;  2Y7K A;  2O69 A;  1B3H A;  3RTF B;  1QUL A;  1LB9 A;  5K2X A;  1XVX A;  1FTM A;  3CR9 A;  1LAF E;  4BDO A;  4NF6 A;  4LQ5 A;  4IB2 A;  3KSX A;  3VDF A;  1LGB C;  2RCA A;  3L6H A;  2FNC A;  2DVC A;  3D4C A;  4RPN A;  4XXU A;  5F7V A;  1B7Z A;  2GHB A;  1FTL A;  4PQJ A;  3HHG A;  1B46 A;  1N84 A;  3RUM A;  1MDQ A;  3H3G A;  3KBR A;  2OZZ A;  2HZK A;  3KJT A;  3FXQ A;  1MH4 A;  4DE8 A;  3VLV A;  1FQF A;  2DVZ A;  1Y3P A;  4R9F A;  5B70 A;  4FAJ A;  3U72 A;  3K1M A;  4GL8 A;  4XTC Q;  4OYV A;  4QSD A;  2DXR A;  4NF5 A;  3ODB A;  4QFP A;  1P1U A;  1WVJ A;  2Z8E A;  5IAI A;  4LVQ A;  1B9J A;  4X1D A;  1D9V A;  5CM6 A;  3FIR A;  2R9J A;  1Q1K A;  1LFG A;  2I49 A;  1OVB A;  3MW0 A;  3OO8 A;  5I2N B;  1UQW A;  3FJM A;  5I84 A;  3VXB A;  4F1U A;  2H5Y A;  2THI A;  4LZ5 A;  3RNN A;  5AA4 B;  4DCY A;  3V89 B;  4FOR A;  3MVX A;  1B05 A;  1PBP A;  2HQ0 A;  1JVX A;  1TWY A;  4H8J A;  2HCA A;  3TQL A;  1FQB A;  3OO9 A;  3GLB A;  3OEN A;  4GIZ A;  5I59 A;  1URS A;  3FZV A;  2B3F A;  3ECR A;  4KHZ E;  1IQ7 A;  2I58 A;  1N0T A;  3B6W A;  3OMB A;  3C36 A;  3I3V A;  4KQP A;  3H6W A;  1QKB A;  1Z7M E;  4XIG Q;  3CSG A;  4DXC A;  1BIY A;  4NWC A;  3A3C A;  4U1Z A;  4R2B A;  4G77 A;  2PBW A;  1FCK A;  1R9L A;  4Z7E A;  3UN6 A;  3SEX A;  2ABH A;  1I6Q A;  2XXR A;  3C35 A;  3FVK A;  1USY H;  4F1V A;  3EQ1 A;  3P7I A;  4KI0 E;  5FTH A;  3WAF A;  2DE2 A;  2VD3 A;  1GGG A;  1M5E A;  2QSX A;  4LON B;  4F2O A;  3TPA A;  1PB8 A;  2X7Q A;  1GV8 A;  3QYT A;  3B6T A;  2ONK E;  2F7A A;  4R2F A;  1II5 A;  4MBP A;  4WEP A;  4IY5 A;  3D4G A;  3JYR A;  3K00 A;  1XOC A;  1EU8 A;  1B52 A;  4OFO A;  3O28 A;  3FGS A;  1LST A;  2DSF A;  3ZSF A;  5H8H B;  1QUJ A;  4H8I A;  3KGC A;  1GVC A;  2UVH A;  3IK6 B;  3C9H A;  3N6T A;  4ZDM A;  2DXY A;  4FEC A;  3ILT B;  1N3W A;  2CZL A;  1USY E;  1AH5 A;  1MPB A;  5CMM A;  4JSO A;  3IOW A;  3IOU A;  1MQJ A;  5HPQ A;  3TYH A;  1ATG A;  3FD3 A;  3O2A A;  1MXU A;  4RNS A;  3RTW B;  4N07 A;  4RXL A;  5HM4 B;  4NF8 A;  2XXP A;  4H6D A;  4BDQ A;  1YCJ A;  5KDT A;  5AE4 A;  3MUQ A;  1M5B A;  1H45 A;  4OET A;  3HST A;  4U4X A;  1B7U A;  2V3T A;  1Y3N A;  1O64 A;  3EHT A;  1MRP A;  4R6K A;  4ZEK A;  4DDD A;  1LFI A;  1TT1 A;  3SET A;  4YIC A;  1SDX A;  3RPW A;  3CVG A;  3K2D A;  4BDL A;  3M3L A;  4K3F A;  2O1L A;  3IB2 A;  3DP8 A;  3LC8 A;  4TLM B;  3S9M C;  1ELJ A;  3MZB A;  4RK2 A;  1IXC A;  3S9E A;  1FTK A;  3KSJ A;  4F29 A;  3CFZ A;  2IEE A;  2XX8 A;  5KCJ B;  3V8X B;  3ONM A;  3QAX A;  3TEL A;  4GQO A;  3U8Q A;  5I57 A;  3K02 A;  2ZXT A;  4ND9 A;  5BWJ A;  2XXY A;  5JTY A;  3T66 A;  3USD A;  3SEW A;  1VE4 A;  3FVG A;  4MLV A;  1EZ9 A;  2LAO A;  4PP0 A;  2A5T A;  1MY0 A;  4AB5 A;  2OWT A;  1SYH A;  1D4N A;  1WOD A;  5ICT A;  2H25 A;  5FTI A;  1NH8 A;  3MAM A;  5TP9 B;  2OCU A;  4H67 A;  5CMC A;  1SI1 A;  3ILU B;  4I8C A;  5J1D A;  1H3D A;  3UIF A;  2R71 A;  4ZED A;  1A40 A;  1O7T A;  1HSE A;  2Z23 A;  2Q9T A;  3H6T A;  2YPN A;  4OTE A;  1N7W A;  2RC8 A;  3IJX B;  3Q26 A;  4KYS A;  3TUS A;  2OBG A;  4NF4 B;  1QUK A;  2HZL A;  2OK2 A; 
#chains in the Genus database with same CATH topology
 1LBV A;  4E0X A;  4R73 A;  4NG7 A;  5CBR A;  3VXC A;  2AYS A;  2Q88 A;  2RCB A;  2XXT A;  4IGT A;  2E1S A;  4O3B A;  4JB7 A;  4N8G A;  5I58 B;  3VE1 B;  4KR5 A;  4P3L A;  5I2K A;  4F2Q A;  4PFT A;  1SW4 A;  2I6E A;  5CC2 A;  1LAG E;  2XHD A;  4F1Y A;  1IZ1 A;  3BBR A;  1M5C A;  4UAB A;  1IXI A;  3TAJ A;  1US4 A;  2GH9 A;  1BP5 A;  1Y1Z A;  3MQ9 A;  2QS1 A;  5EQ7 A;  2DQV A;  4WED A;  1AWB A;  2NWJ A;  1VDW A;  1M5D A;  2HHM A;  3VFJ A;  2RC9 A;  4G68 C;  1LBB A;  2VGQ A;  1FQE A;  2B4M A;  2HAV A;  4H46 A;  3KG2 A;  5DVF A;  4RA1 A;  1B4Z A;  2HEU A;  2QMX A;  4NF0 A;  1FTA A;  3C31 A;  1I6B A;  4R72 A;  4GVO A;  1AIV A;  1Y3Q A;  4ZEF A;  3QIM A;  5F1Q A;  5EQ9 A;  1SW5 A;  1FQD A;  2H9B A;  1FBE A;  5HBC A;  5I56 B;  1OLC A;  2DS9 A;  3RGY A;  2DE3 A;  2WKY A;  4DCX A;  1ZIU A;  1IMC A;  4RY1 A;  1ANF A;  5CMK A;  3S2V A;  1XC1 A;  3K01 A;  1P1W A;  3MPL A;  3OEK A;  4BDM A;  4BLA A;  4XEQ A;  5BUU A;  4KFQ A;  3GZG A;  5DT6 A;  2XX9 A;  4F18 A;  3D1R A;  3M3K A;  2P0S A;  4JSD A;  4MJO A;  3E3K A;  5IZ3 A;  5H8F A;  4NF6 B;  3LUY A;  3OOA A;  1SVX B;  4TOZ A;  1LAH E;  3QUF A;  1BTJ A;  2Z8D A;  1H76 A;  3FVO A;  2F6P A;  4HE2 A;  1Q35 A;  1MS7 A;  1PEB A;  4I3Y A;  5AA2 A;  3VVD A;  4EF2 A;  4C0R A;  3L6G A;  5H8Q A;  4IGR A;  1RDX A;  4RPO A;  2ZNT A;  2Y5K A;  3QSL A;  1I69 A;  2XXV A;  2OJT A;  2H4I A;  4R75 A;  1B5J A;  2O7I A;  4N17 A;  4NF5 B;  3QK6 A;  1B5I A;  3TTM A;  4PFU A;  4MEV A;  3K6V A;  4G2Z A;  1PC3 A;  3H4Z A;  2Y7W A;  1A8E A;  2DWH A;  4NX1 A;  4MIJ A;  2XWO A;  4ELO A;  1NV1 A;  4OVJ A;  5IZ1 A;  4YU0 A;  4YB7 A;  2D3I A;  4ZE8 A;  3H7M A;  2UVG A;  4WXJ A;  3G3I A;  4X1B A;  3TTK A;  3TTL A;  3KN8 A;  2F97 A;  4I3E A;  3T96 B;  1JW1 A;  3B7D A;  1NV5 A;  3N6U A;  3SDF A;  3G7W A;  2O84 X;  2F3B A;  1KA0 A;  3H06 B;  3PPP A;  3SEU A;  4HS7 A;  2PFZ A;  1FTO A;  1D9Q A;  3LR1 A;  1FPL A;  3CG3 A;  3LSW A;  5I59 B;  2BJJ X;  4TLL B;  4HE1 A;  1NV3 A;  1IXH A;  4ESX A;  1Y4T A;  1B0L A;  2JJK A;  3TFL A;  4Q8R A;  3N94 A;  4WKM A;  5TU0 A;  3KN3 A;  3MVZ A;  4U22 A;  4PE3 A;  2P3N A;  1LBY A;  4XKN A;  4GL0 A;  1KZ8 A;  4QFN A;  2B3B A;  3IFC A;  4ZZE A;  4RJZ A;  5KZT A;  1M5F A;  3HFU A;  1INP A;  4P11 A;  4G61 A;  2Q2A A;  4IO4 A;  1SW2 A;  3R6U A;  2ZYM A;  1DOT A;  1LAX A;  1ZBM A;  5AA4 A;  4FAT A;  1CB6 A;  4BDR A;  3OXN A;  3R26 A;  1MXV A;  4JWX A;  4OEV A;  2OWS A;  2F5X A;  1Y9U A;  3PUV E;  1NMU A;  4C1T A;  5ET6 A;  3HCQ A;  1LBZ A;  1H44 A;  3E13 X;  4PGP A;  5JEI A;  3IOV A;  2NVU B;  3FBP A;  4OA4 A;  1R6Z A;  1JEV A;  4MHF A;  3PUZ E;  4POX A;  4OAN A;  3PPN A;  3MBP A;  1LLS A;  3QMF A;  4POW A;  3JZJ A;  3FAS A;  4FE8 A;  4PC9 A;  2OWZ A;  1FBG A;  2AIX A;  4ECF A;  1FBP A;  4F3S A;  3T93 B;  3UK4 A;  3W9V A;  3G3G A;  3PD9 A;  1KWH A;  4AQ4 A;  5A5X A;  4EQB A;  2DDK A;  4GWO A;  5EHM A;  1D3K A;  2CMO A;  1NUY A;  4DXB A;  1FSA A;  4YMB A;  2GFE A;  5K2Y A;  1JQF A;  4QHQ A;  5B7D A;  5LOM A;  5L8D A;  1IIT A;  3I6V A;  2Y7I A;  4ONY A;  1JET A;  2V25 A;  4NF8 B;  1LFH A;  3T9U A;  4GXA A;  2XXQ A;  1NKX A;  4FEB A;  2Q8J A;  4YKP A;  2B65 A;  3BIH A;  1SPI A;  3IX1 A;  1KA1 A;  5KDT B;  3C33 A;  4NHB A;  1FQA A;  5ITP A;  1GR2 A;  1ZKB A;  3KC0 A;  4O3A A;  2OX3 A;  1Q9D A;  4GWW A;  5EHS A;  4EF1 A;  3NOH A;  5IZZ A;  1POT A;  4O8M A;  1B1X A;  4IR8 A;  1MXZ A;  2CEY A;  2F78 A;  3N26 A;  3VLW A;  1MXW A;  2GHA A;  3Q27 A;  1ZMG A;  1JW5 A;  1NFT A;  3IR1 A;  1TFA A;  3AXF A;  4RYA A;  3GXA A;  2AL4 A;  1MXY A;  4YZZ A;  1B6H A;  2H99 A;  3EN3 A;  1EZO A;  1OMP A;  4N4U A;  5FHN A;  3Q25 A;  1P1N A;  2REG A;  3E4R A;  4GF8 A;  1N04 A;  3FUZ A;  4OER A;  3E78 A;  1A55 A;  1N3X A;  2ZYO A;  4OVT A;  2DE4 A;  2VHA A;  5LDZ A;  2WEF A;  3CIJ A;  3RT8 A;  4HW8 A;  1L5T A;  1MQI A;  4LP2 B;  1MXX A;  3QXM A;  2IA4 A;  4LZ7 A;  5I57 B;  4YKI A;  3O29 A;  1URD A;  1XVY A;  3MC2 A;  3PD8 A;  4O7M A;  3O97 A;  3UA8 A;  3FV2 A;  4IO2 A;  4P1L A;  4ESW A;  4PF6 A;  3BFU A;  1JP4 A;  4OVR A;  3KJ7 A;  2RKM A;  4PTK A;  3TKD A;  1OQH A;  4H5G A;  2A5T B;  4OHN A;  1XT8 A;  2MKZ A;  4G8M A;  5H8S A;  4OFJ A;  2ESN A;  1MH3 A;  3ISP A;  5DYH A;  3DLN A;  5H8N B;  3FXU A;  1MQH A;  4H1X A;  4OZ9 A;  1UTH A;  4PCD A;  3HHF A;  3IOT A;  5CMB A;  2G29 A;  4YB6 A;  4GXS B;  3Q29 A;  1MY1 A;  2P2A A;  4XKQ A;  3MP6 A;  5L9S A;  3OO6 A;  2HAU A;  3T22 A;  1P1O A;  3RPL A;  4F22 A;  3PUW E;  3ZKL A;  1MY3 A;  4H45 A;  3FXB A;  1FPK A;  2Q89 A;  3VV5 A;  4HCW A;  1OQG A;  1TFD A;  3HN0 A;  3QUJ A;  1ZTY A;  3N5L A;  5J16 A;  4G4P A;  5KCJ A;  4PDD A;  3HO7 A;  4G68 A;  3DEL B;  4O94 A;  2PX1 A;  2NXO A;  4KYD A;  1B5H A;  5DEX B;  3KEI A;  2FHY A;  3KOT A;  4MFI A;  2FIX A;  1R1N A;  2CZH A;  1YPN A;  3PMV A;  2I0B A;  2O1M A;  2WBD A;  4PE5 B;  5I2K B;  4IY6 A;  3CHG A;  4IO6 A;  1B1H A;  4X48 A;  1S9T A;  3O6G A;  2HXW A;  4JVI A;  4GX6 A;  3JV9 A;  4G8H A;  4H5F A;  3U92 A;  3I5O A;  3K6X A;  3PMW A;  1NUZ A;  4NN3 A;  1AOV A;  2RF1 A;  4MF3 A;  3TTN A;  2W7Y A;  3K6U A;  4OES A;  2RIN A;  4OMB A;  5CRY A;  2QRY A;  1B2H A;  5AA1 A;  1SI0 A;  4QF9 A;  2HFB A;  1FBC A;  2KR0 A;  1LBX A;  4GWY A;  2PT1 A;  1IUD A;  4MH5 A;  4LA9 A;  1AMF A;  1RKM A;  1A7L A;  3LBS A;  4R6H A;  4ELR A;  1N7X A;  4PFW A;  1Z7N E;  3VVF A;  2XXI A;  4NF4 A;  4F39 A;  1MDP 1;  1SD3 A;  4IO5 A;  2PFY A;  1SQY A;  2XWI A;  3PU5 A;  3PUY E;  5I7I A;  2QVU A;  2D21 A;  4ZS9 A;  2ZMB A;  3K6W A;  3CG1 A;  3MWB A;  1YTV A;  3EPE A;  3GBB A;  1B58 A;  4AB6 A;  5JK4 A;  2PT2 A;  4QFL A;  4C1U A;  1XHY A;  3TCF A;  3GBA A;  1NNP A;  3FAT A;  5EYH A;  2UYE A;  3RYD A;  3VLU A;  3W9W A;  4E0W A;  2ZZW A;  4KCD A;  1H43 A;  3PTY A;  4YKK A;  4JVD A;  2QVV A;  2R8T A;  1MY4 A;  2H98 A;  2ZYK A;  2UXA A;  5IZ3 B;  5H8F B;  4KYE A;  4MNP A;  5TPA A;  4NWD A;  2XXH A;  1ZJL A;  3FVN A;  1S7Y A;  1VSO A;  4GOT A;  1B0H A;  1UTB A;  5AA3 A;  3MZ9 A;  5AA2 B;  2VP1 A;  2XXU A;  2O51 A;  1URG A;  5H8Q B;  3E79 A;  5I3S A;  3LSL A;  1FPD A;  2FYI A;  2VD2 A;  4EXK A;  1BKA A;  3W15 C;  1OLA A;  1DSN A;  5EQA A;  4DXU A;  5ITO A;  1NUW A;  1JNF A;  2FVZ A;  4PET A;  4P47 A;  3EF7 A;  2UVJ A;  4P0I A;  2I3V A;  2E0S A;  3PMX A;  3T9H B;  4P9K A;  1JVY A;  2HXR A;  1YYZ A;  1SW1 A;  4EXL A;  4N6P A;  1RYO A;  2NOO A;  1MQG A;  2XD2 A;  3RT6 B;  3TOD A;  2V3U A;  1HSL A;  2I4B A;  3SZP A;  4NMY A;  1US5 A;  1A8F A;  1WDN A;  3ROJ A;  5L9M A;  4M1V A;  3CSB A;  4I40 A;  2Y84 A;  4PFR A;  1JW4 A;  2ANJ A;  1LCF A;  4JBZ A;  1J1N A;  4EUO A;  3IO6 A;  4JWY A;  1VFD A;  1IMA A;  4ELP A;  2L5V A;  5M2V A;  5CI5 A;  3U94 A;  1T0K A;  4FIM A;  3ZS6 A;  4DIG A;  3FJ7 A;  1QKA A;  1LB8 A;  3EHS A;  2DWI A;  2D5W A;  4U21 A;  3HV1 A;  3RQT A;  4THI A;  4XF5 A;  4PBQ A;  1FBF A;  1B3F A;  5FHM A;  2CEX A;  2NUV A;  3A29 A;  1FRP A;  1K9Z A;  2ZZV A;  1P1Q A;  2V93 A;  1HSJ A;  3TZA A;  4PAF A;  4YB5 A;  3RY3 A;  1XI6 A;  2WYP A;  3OO7 A;  1YAE A;  4I62 A;  2BJI A;  1POY 1;  5A5L A;  1MPC A;  1SYI A;  1ZU0 A;  2VPN A;  1NNT A;  1LBC A;  4ZEI A;  2PMS A;  2FBP A;  4X8R A;  2VPO A;  1IXG A;  2I4C A;  4F3G A;  2CZK A;  4MNC A;  4GX4 A;  3T9X B;  3O6H A;  1RDY A;  2PCR A;  1TXF A;  3FXR A;  2DYX A;  2ONR A;  3TCH A;  4OWD A;  2O6A A;  4XFE A;  4GRK A;  4Q5T A;  1SBP A;  4NTL A;  1MG1 A;  2R6G E;  3O9P A;  5I2N A;  2KQZ A;  3EHU A;  3TEP A;  1YXI A;  4JVC A;  1MM7 A;  2ALU A;  4FED A;  5L9O A;  2A5S A;  2WYK A;  1NV4 A;  3GYY A;  4N91 A;  3DP6 A;  3UP9 A;  4GX3 A;  4EQ9 A;  3CI8 A;  4QSC A;  1F9B A;  1FW0 A;  4GLI A;  2F6G A;  4HTG A;  4NE4 A;  1G0I A;  5DVJ A;  4H0W A;  3UGW A;  1G0H A;  3K4U A;  2V84 A;  1RDZ A;  1NNK A;  4H65 A;  1PDA A;  5IKB A;  5DTB A;  4ZEC A;  1K9Y A;  4YKJ A;  5A5X B;  4MNI A;  5CBS A;  4KCC A;  3IO4 A;  4BDN A;  2XWV A;  1EZP A;  1FTJ A;  1FPE A;  4R74 A;  4I9D A;  4R9G A;  4GBW A;  3PUX E;  1DTG A;  3M8U A;  2QL3 A;  4XKR A;  2ZNU A;  4LZ8 A;  3V5A A;  2XX7 A;  3T9V A;  2UVI A;  1DTZ A;  1RYX A;  4DI3 D;  3DM0 A;  5EQ8 A;  3FV1 A;  4IO7 A;  3C32 A;  3WAE A;  4LUB A;  3UOR A;  4UA8 A;  4O3C A;  3ZKK A;  1MM6 A;  1S50 A;  1CE2 A;  3G3H A;  4F31 B;  3TMG A;  2YLN A;  1VFE A;  3OEM A;  1DBZ A;  1Y1M A;  3OSR A;  3MVW A;  1B51 A;  2YJP A;  3B6Q A;  4TQU Q;  2F7B A;  1B3E A;  3K1P A;  2REJ A;  4ISU A;  3MYU A;  4OFL A;  2Z8F A;  4HE0 A;  4OEN A;  2QS4 A;  4F3B A;  1PB9 A;  3KFM A;  5H8H A;  3KC1 A;  1B32 A;  4PBH A;  2ONS A;  1QW0 A;  1IEJ A;  4L17 A;  1R9Q A;  1Y20 A;  3S9L C;  1NH7 A;  1DCU A;  5DW8 A;  3PV0 E;  1B7H A;  4G8N A;  4I1D A;  1LCT A;  2FA7 A;  4GBV A;  1UIV A;  1IMF A;  5DVI A;  4HCY A;  2HPG A;  2M8C A;  4O7I A;  4F3P A;  4Q30 B;  2ZYN A;  4M4G A;  5F24 A;  4UAC A;  1QUI A;  3BFT A;  2Q8M A;  3DP4 A;  3CFX A;  4GWX A;  4AS4 A;  2P1S A;  5EYF A;  4U4S A;  5FHO A;  2XD3 A;  1DK4 A;  4AS5 A;  5JTY B;  3SER A;  1NNF A;  1VR5 A;  4P8B A;  2I3W A;  3SEY A;  1UTH B;  4U1O A;  3S4U A;  4JWO A;  3IFA A;  3R7X A;  3IB0 A;  1QJM A;  4N13 A;  2I0C A;  2ZNS A;  5AA2 D;  3MP1 A;  4U23 A;  1DPE A;  3RPL B;  2F8D A;  1PBQ A;  4ELQ A;  4Q0C A;  4QXD A;  3M3F A;  2F7C A;  3U1O A;  4ZE9 A;  2F34 A;  3K0V A;  2Q2C A;  3RN8 A;  1BLF A;  2Y7P A;  3MZ1 A;  1P99 A;  2I48 A;  2V3Q A;  1MPD A;  2F36 A;  4G68 B;  1AL3 A;  2F35 A;  3TTR A;  2QMW A;  1B3L A;  2GRV A;  4Z0I A;  3IAZ A;  2XXK A;  4FBP A;  4QFK A;  2QVR A;  3MJN A;  5ICQ A;  4F19 A;  4P0G A;  1QVS A;  1BK4 A;  3K1N A;  2Y7R A;  3O66 A;  1I6A A;  1MQD A;  1FQC A;  4KPT A;  3A3U A;  4IO3 A;  1EYJ A;  4R6Y A;  2X26 A;  2KLF A;  2Q74 A;  1OVT A;  3SES A;  1EH3 A;  1ZLQ A;  4ZEB A;  5H8N A;  3C34 A;  4FJP A;  4NGU A;  4LQ2 A;  2QS3 A;  2QJE A;  4QFO A;  3PPQ A;  4OEU A;  3OSQ A;  3OD7 A;  1O63 A;  2Z22 A;  4PFY A;  4X9T A;  5TP9 A;  3H6U A;  4GD5 A;  4YMA A;  3KBZ A;  1Y4C A;  2RC7 A;  4YAH X;  1PB7 A;  4QRZ A;  4DZ1 A;  3H03 A;  4N6D A;  3THI A;  1NL5 A;  3BIG A;  3HPI A;  2XXW A;  5DEX A;  5ISU A;  3PPR A;  4JXI A;  4MLQ A;  4DLD A;  2DOJ A;  3F11 A;  4EDP A;  1IME A;  3TQW A;  2O68 A;  5ELV A;  3MVY A;  4NQ8 A;  4GWZ A;  1A99 A;  2G93 A;  4JDF A;  3SEV A;  3KN7 A;  1UIU A;  3RLF E;  4NED A;  3G3K A;  5I58 A;  1N76 A;  4QBA A;  5TPA B;  3V83 A;  3A09 A;  3E9X A;  2XXX A;  3CRB A;  1MY2 A;  1FBH A;  4U2R A;  3S9N C;  2OLB A;  1FJ9 A;  3G3F A;  1DMB A;  3BKI B;  4EQ7 A;  3MP8 A;  3TDJ A;  3FJG A;  1GTK A;  4PAK A;  2QFL A;  4XKP A;  2X7P A;  2PVU A;  4OQO A;  1UTB B;  3SKP A;  4KD5 A;  2PYY A;  3U93 A;  3PPO A;  1B4H A;  3CFL A;  2DWA A;  1FPG A;  3IL1 B;  2AL5 A;  3IJO B;  4LN5 A;  1B40 A;  1DPP A;  4GFR A;  2DP8 A;  4RK9 A;  3LSF B;  3IOR A;  4OXV A;  2O7U A;  3KZG A;  3G3J A;  1B3G A;  3T0J A;  3PGF A;  5EYG A;  1XS5 A;  3LSX A;  3MPK A;  3C4M A;  3O6I A;  1LBW A;  3IB1 A;  2QS2 A;  2DWJ A;  5I56 A;  3VVE A;  1OIB A;  2VOZ A;  3OEL A;  1D9Y A;  4ZZA A;  4QSE A;  4LAT A;  3TCG A;  3KOS A;  1IIW A;  3Q28 A;  2UYF A;  3H6V A;  2QPQ A;  4PAI A;  1JEU A;  1A54 A;  2Y7K A;  2O69 A;  1B3H A;  3RTF B;  1QUL A;  1LB9 A;  5K2X A;  4GWS A;  1XVX A;  1FTM A;  3CR9 A;  1LAF E;  4BDO A;  4NF6 A;  4LQ5 A;  4IB2 A;  3KSX A;  5T3J A;  3VDF A;  1LGB C;  2RCA A;  3L6H A;  2FNC A;  2DVC A;  3D4C A;  4RPN A;  4XXU A;  5F7V A;  1FPI A;  1B7Z A;  2GHB A;  1FTL A;  4PQJ A;  3HHG A;  1B46 A;  1N84 A;  1YZ0 A;  3RUM A;  1MDQ A;  3H3G A;  3KBR A;  2OZZ A;  2HZK A;  3KJT A;  3FXQ A;  2WBB A;  4OVP A;  1MH4 A;  2P3V A;  4DE8 A;  3VLV A;  1FQF A;  2DVZ A;  1Y3P A;  4R9F A;  3MST A;  5B70 A;  4FAJ A;  3U72 A;  3K1M A;  4GL8 A;  4XTC Q;  4OYV A;  4QSD A;  2DXR A;  4NF5 A;  3ODB A;  4QFP A;  1P1U A;  2VT5 A;  4MCO A;  2CZI A;  1WVJ A;  2FIE A;  2Z8E A;  5IAI A;  4LVQ A;  1B9J A;  4X1D A;  1D9V A;  5CM6 A;  3FIR A;  2R9J A;  1Q1K A;  1LFG A;  4PFB A;  2I49 A;  1OVB A;  3MW0 A;  3OO8 A;  5I2N B;  1UQW A;  3FJM A;  1FPF A;  1IMB A;  5I84 A;  3VXB A;  4F1U A;  4MAG A;  2H5Y A;  4PF8 A;  1NUX A;  1LEV A;  2THI A;  4LZ5 A;  3RNN A;  5AA4 B;  4DCY A;  5FBP A;  3V89 B;  2XA5 A;  4FOR A;  3MVX A;  1B05 A;  1PBP A;  2GQ1 A;  2HQ0 A;  4N15 A;  1JVX A;  1TWY A;  4H8J A;  2HCA A;  3TQL A;  1FQB A;  3OO9 A;  3GLB A;  3B50 A;  3OEN A;  4GIZ A;  5I59 A;  1URS A;  3FZV A;  2B3F A;  4N8Y A;  3ECR A;  4KHZ E;  1IQ7 A;  2I58 A;  1N0T A;  3B6W A;  3OMB A;  3C36 A;  4X04 A;  2ZZX A;  3I3V A;  4KQP A;  3H6W A;  4N81 A;  1QKB A;  4PDH A;  1Z7M E;  1NI9 A;  4XIG Q;  3CSG A;  4DXC A;  5ET8 A;  2XWK A;  1BIY A;  4NWC A;  3A3C A;  4U1Z A;  4R2B A;  4G77 A;  2PBW A;  1FCK A;  1R9L A;  3LUZ A;  4Z7E A;  3UN6 A;  3SEX A;  2ABH A;  1I6Q A;  2XXR A;  3C35 A;  3FVK A;  1USY H;  4F1V A;  3EQ1 A;  3P7I A;  4KI0 E;  4OVS A;  5FTH A;  1EYK A;  3WAF A;  2DE2 A;  5IM2 A;  2VD3 A;  1GGG A;  1M5E A;  1NV0 A;  2QSX A;  4LON B;  4F2O A;  3TPA A;  1PB8 A;  2X7Q A;  1GV8 A;  3QYT A;  3B6T A;  2ONK E;  2F7A A;  4R2F A;  5ET5 A;  1II5 A;  3B8B A;  4MBP A;  4WEP A;  4IY5 A;  5ESY A;  3D4G A;  1QGX A;  3JYR A;  3K00 A;  1XOC A;  1EU8 A;  1B52 A;  4OFO A;  3O28 A;  4MMP A;  1EYI A;  3FGS A;  1LST A;  2DSF A;  3ZSF A;  5H8H B;  1QUJ A;  4H8I A;  3KGC A;  1GVC A;  4DI4 B;  2UVH A;  3IK6 B;  3C9H A;  3N6T A;  4ZDM A;  2DXY A;  4FEC A;  1FPJ A;  3ILT B;  4KXP A;  1N3W A;  2CZL A;  1USY E;  1AH5 A;  1MPB A;  5CMM A;  4JSO A;  3IOW A;  3EKI A;  3IOU A;  1MQJ A;  5HPQ A;  3TYH A;  1ATG A;  5LTC A;  3FD3 A;  3O2A A;  1MXU A;  4RNS A;  3RTW B;  1FJ6 A;  4N07 A;  4PGN A;  3U65 A;  4GWU A;  5IGA A;  4RXL A;  5HM4 B;  4NF8 A;  2XXP A;  4H6D A;  1IMD A;  4BDQ A;  1YCJ A;  1NV2 A;  5KDT A;  5AE4 A;  3MUQ A;  1M5B A;  4OVQ A;  1NV6 A;  1H45 A;  4OET A;  3HST A;  2B4L A;  4U4X A;  1B7U A;  2V3T A;  1FBD A;  5I5P A;  4MX6 A;  1Y3N A;  1O64 A;  3EHT A;  5ET7 A;  1MRP A;  4R6K A;  4ZEK A;  4DDD A;  1LFI A;  1TT1 A;  3SET A;  4YIC A;  1SDX A;  2V4C A;  4P56 A;  3RPW A;  4NAP A;  3CVG A;  3K2D A;  4BDL A;  3M3L A;  4K3F A;  2O1L A;  3IB2 A;  3DP8 A;  3LC8 A;  4TLM B;  3S9M C;  1ELJ A;  3MZB A;  4RK2 A;  1IXC A;  3S9E A;  4HXV A;  1FTK A;  1FPB A;  3KSJ A;  4F29 A;  3CFZ A;  2IEE A;  2XX8 A;  5KCJ B;  3V8X B;  3ONM A;  3QAX A;  3TEL A;  4GQO A;  3U8Q A;  5I57 A;  3K02 A;  2F3D A;  2ZXT A;  1CNQ A;  4ND9 A;  4P1E A;  5BWJ A;  2XXY A;  2WX9 A;  5JTY A;  3T66 A;  3USD A;  3SEW A;  1VE4 A;  3FVG A;  4MLV A;  1EZ9 A;  2LAO A;  4N6K A;  4PP0 A;  2A5T A;  1MY0 A;  3T1B A;  4AB5 A;  2OWT A;  1SYH A;  1D4N A;  1WOD A;  5ICT A;  2H25 A;  5FTI A;  1NH8 A;  3MAM A;  5TP9 B;  2OCU A;  4H67 A;  5CMC A;  1SI1 A;  3ILU B;  4I8C A;  5J1D A;  1H3D A;  3UIF A;  2R71 A;  4ZED A;  1A40 A;  1O7T A;  1HSE A;  2Z23 A;  2Q9T A;  3H6T A;  2YPN A;  4OTE A;  1NV7 A;  1N7W A;  2RC8 A;  4PFI A;  3IJX B;  3Q26 A;  4KYS A;  3TUS A;  2OBG A;  3LV0 A;  4NF4 B;  1QUK A;  2HZL A;  2OK2 A;  2Y5L A; 
#chains in the Genus database with same CATH homology
 4E0X A;  4R73 A;  5CBR A;  3VXC A;  2AYS A;  2Q88 A;  2RCB A;  2XXT A;  4IGT A;  2E1S A;  4O3B A;  4JB7 A;  5I58 B;  3VE1 B;  4KR5 A;  5I2K A;  4F2Q A;  4PFT A;  1SW4 A;  2I6E A;  5CC2 A;  1LAG E;  2XHD A;  4F1Y A;  1IZ1 A;  3BBR A;  1M5C A;  1IXI A;  3TAJ A;  1US4 A;  2GH9 A;  1BP5 A;  1Y1Z A;  3MQ9 A;  2QS1 A;  2DQV A;  4WED A;  2NWJ A;  1M5D A;  3VFJ A;  2RC9 A;  4G68 C;  1LBB A;  2VGQ A;  1FQE A;  2HAV A;  3KG2 A;  5DVF A;  4RA1 A;  1B4Z A;  2HEU A;  2QMX A;  3C31 A;  1I6B A;  4R72 A;  4GVO A;  1AIV A;  1Y3Q A;  4ZEF A;  3QIM A;  5F1Q A;  1SW5 A;  1FQD A;  2H9B A;  5HBC A;  5I56 B;  1OLC A;  2DS9 A;  3RGY A;  2DE3 A;  2WKY A;  4DCX A;  1ZIU A;  4RY1 A;  1ANF A;  5CMK A;  3S2V A;  1XC1 A;  3K01 A;  1P1W A;  3MPL A;  3OEK A;  4BDM A;  4BLA A;  5BUU A;  4KFQ A;  3GZG A;  5DT6 A;  2XX9 A;  4F18 A;  3M3K A;  2P0S A;  4JSD A;  3E3K A;  5H8F A;  4NF6 B;  3LUY A;  3OOA A;  1SVX B;  4TOZ A;  1LAH E;  3QUF A;  1BTJ A;  2Z8D A;  1H76 A;  3FVO A;  2F6P A;  1Q35 A;  1MS7 A;  1PEB A;  5AA2 A;  3VVD A;  4EF2 A;  4C0R A;  3L6G A;  5H8Q A;  4IGR A;  4RPO A;  2ZNT A;  3QSL A;  1I69 A;  2XXV A;  2OJT A;  2H4I A;  4R75 A;  1B5J A;  2O7I A;  4NF5 B;  3QK6 A;  1B5I A;  3TTM A;  4PFU A;  3K6V A;  4G2Z A;  1PC3 A;  3H4Z A;  2Y7W A;  1A8E A;  2DWH A;  4ELO A;  4OVJ A;  4YU0 A;  4YB7 A;  2D3I A;  4ZE8 A;  3H7M A;  2UVG A;  4WXJ A;  3G3I A;  4X1B A;  3TTK A;  3TTL A;  3KN8 A;  2F97 A;  3T96 B;  1JW1 A;  3B7D A;  3N6U A;  3SDF A;  3G7W A;  2O84 X;  3H06 B;  3PPP A;  3SEU A;  4HS7 A;  1FTO A;  3LR1 A;  3CG3 A;  3LSW A;  5I59 B;  2BJJ X;  4TLL B;  1IXH A;  4ESX A;  1Y4T A;  1B0L A;  3TFL A;  4Q8R A;  3N94 A;  4WKM A;  5TU0 A;  3KN3 A;  3MVZ A;  4U22 A;  4XKN A;  4GL0 A;  4QFN A;  2B3B A;  4ZZE A;  4RJZ A;  5KZT A;  1M5F A;  4P11 A;  2Q2A A;  4IO4 A;  1SW2 A;  3R6U A;  2ZYM A;  1DOT A;  1LAX A;  1ZBM A;  5AA4 A;  4FAT A;  1CB6 A;  4BDR A;  3OXN A;  3R26 A;  1MXV A;  4JWX A;  4OEV A;  2OWS A;  2F5X A;  1Y9U A;  3PUV E;  1NMU A;  4C1T A;  3HCQ A;  1H44 A;  3E13 X;  5JEI A;  3IOV A;  2NVU B;  1R6Z A;  1JEV A;  3PUZ E;  4POX A;  3PPN A;  3MBP A;  1LLS A;  4POW A;  3JZJ A;  3FAS A;  4FE8 A;  2AIX A;  4ECF A;  4F3S A;  3T93 B;  3UK4 A;  3W9V A;  3G3G A;  3PD9 A;  1KWH A;  4AQ4 A;  5A5X A;  4EQB A;  4GWO A;  5EHM A;  1D3K A;  2CMO A;  4DXB A;  4YMB A;  2GFE A;  5K2Y A;  1JQF A;  4QHQ A;  5B7D A;  5LOM A;  5L8D A;  1IIT A;  3I6V A;  2Y7I A;  4ONY A;  1JET A;  2V25 A;  4NF8 B;  1LFH A;  3T9U A;  4GXA A;  2XXQ A;  1NKX A;  4FEB A;  2Q8J A;  4YKP A;  2B65 A;  3IX1 A;  5KDT B;  3C33 A;  1FQA A;  5ITP A;  1GR2 A;  1ZKB A;  4O3A A;  5EHS A;  4EF1 A;  1POT A;  1B1X A;  1MXZ A;  2F78 A;  3N26 A;  3VLW A;  1MXW A;  2GHA A;  3Q27 A;  1ZMG A;  1JW5 A;  1NFT A;  3IR1 A;  1TFA A;  3AXF A;  4RYA A;  3GXA A;  2AL4 A;  1MXY A;  4YZZ A;  1B6H A;  2H99 A;  3EN3 A;  1EZO A;  1OMP A;  5FHN A;  3Q25 A;  1P1N A;  2REG A;  3E4R A;  4GF8 A;  1N04 A;  3FUZ A;  4OER A;  1A55 A;  1N3X A;  2ZYO A;  2DE4 A;  2VHA A;  3CIJ A;  3RT8 A;  4HW8 A;  1L5T A;  1MQI A;  4LP2 B;  1MXX A;  3QXM A;  2IA4 A;  4LZ7 A;  5I57 B;  4YKI A;  3O29 A;  1URD A;  1XVY A;  3MC2 A;  3PD8 A;  3UA8 A;  3O97 A;  3FV2 A;  4IO2 A;  4ESW A;  3BFU A;  3KJ7 A;  2RKM A;  3TKD A;  1OQH A;  4H5G A;  2A5T B;  4OHN A;  1XT8 A;  4G8M A;  5H8S A;  4OFJ A;  2ESN A;  1MH3 A;  5DYH A;  3DLN A;  5H8N B;  3FXU A;  1MQH A;  4H1X A;  4OZ9 A;  1UTH A;  3HHF A;  3IOT A;  5CMB A;  2G29 A;  4YB6 A;  4GXS B;  3Q29 A;  1MY1 A;  2P2A A;  4XKQ A;  3MP6 A;  5L9S A;  3OO6 A;  2HAU A;  3T22 A;  1P1O A;  4F22 A;  3PUW E;  3ZKL A;  1MY3 A;  2Q89 A;  3VV5 A;  4HCW A;  1OQG A;  1TFD A;  3HN0 A;  3QUJ A;  1ZTY A;  3N5L A;  4G4P A;  5KCJ A;  3HO7 A;  4G68 A;  3DEL B;  2PX1 A;  2NXO A;  4KYD A;  1B5H A;  5DEX B;  3KEI A;  3KOT A;  4MFI A;  1R1N A;  1YPN A;  3PMV A;  2I0B A;  2O1M A;  4PE5 B;  5I2K B;  4IY6 A;  4IO6 A;  1B1H A;  4X48 A;  1S9T A;  3O6G A;  2HXW A;  3JV9 A;  4G8H A;  4H5F A;  3U92 A;  3I5O A;  3K6X A;  3PMW A;  1AOV A;  2RF1 A;  4MF3 A;  3TTN A;  2W7Y A;  3K6U A;  4OES A;  2RIN A;  4OMB A;  5CRY A;  2QRY A;  1B2H A;  5AA1 A;  1SI0 A;  4QF9 A;  2HFB A;  2PT1 A;  1IUD A;  4MH5 A;  4LA9 A;  1AMF A;  1RKM A;  1A7L A;  3LBS A;  4R6H A;  4ELR A;  1N7X A;  4PFW A;  1Z7N E;  3VVF A;  2XXI A;  4NF4 A;  4F39 A;  1MDP 1;  1SD3 A;  4IO5 A;  1SQY A;  3PU5 A;  3PUY E;  2D21 A;  4ZS9 A;  2ZMB A;  3K6W A;  3CG1 A;  3MWB A;  1YTV A;  3EPE A;  3GBB A;  1B58 A;  4AB6 A;  5JK4 A;  2PT2 A;  4QFL A;  4C1U A;  1XHY A;  3TCF A;  3GBA A;  1NNP A;  3FAT A;  2UYE A;  3VLU A;  3W9W A;  4E0W A;  4KCD A;  1H43 A;  4YKK A;  1MY4 A;  2H98 A;  2ZYK A;  2UXA A;  5H8F B;  4KYE A;  5TPA A;  4NWD A;  2XXH A;  1ZJL A;  3FVN A;  1S7Y A;  1VSO A;  4GOT A;  1B0H A;  1UTB A;  5AA3 A;  3MZ9 A;  5AA2 B;  2VP1 A;  2XXU A;  2O51 A;  1URG A;  5H8Q B;  3LSL A;  2FYI A;  2VD2 A;  4EXK A;  1BKA A;  3W15 C;  1OLA A;  1DSN A;  4DXU A;  5ITO A;  1JNF A;  4PET A;  3EF7 A;  2UVJ A;  4P0I A;  2I3V A;  2E0S A;  3PMX A;  3T9H B;  1JVY A;  1SW1 A;  4EXL A;  4N6P A;  1RYO A;  2NOO A;  1MQG A;  2XD2 A;  3RT6 B;  3TOD A;  2V3U A;  1HSL A;  2I4B A;  4NMY A;  1US5 A;  1A8F A;  1WDN A;  5L9M A;  4M1V A;  3CSB A;  2Y84 A;  1JW4 A;  2ANJ A;  1LCF A;  4JBZ A;  1J1N A;  4EUO A;  3IO6 A;  4JWY A;  1VFD A;  4ELP A;  5M2V A;  3U94 A;  5CI5 A;  1T0K A;  4FIM A;  3ZS6 A;  4DIG A;  3FJ7 A;  1QKA A;  1LB8 A;  3EHS A;  2DWI A;  2D5W A;  4U21 A;  3HV1 A;  3RQT A;  4THI A;  1B3F A;  5FHM A;  2NUV A;  1P1Q A;  2V93 A;  1HSJ A;  3TZA A;  4YB5 A;  3RY3 A;  3OO7 A;  1YAE A;  4I62 A;  1POY 1;  1MPC A;  1SYI A;  1ZU0 A;  1NNT A;  1LBC A;  4ZEI A;  2PMS A;  1IXG A;  2I4C A;  4F3G A;  3T9X B;  3O6H A;  1TXF A;  3FXR A;  2DYX A;  2ONR A;  3TCH A;  4OWD A;  2O6A A;  4GRK A;  4Q5T A;  1SBP A;  4NTL A;  1MG1 A;  2R6G E;  3O9P A;  5I2N A;  3EHU A;  3TEP A;  1MM7 A;  2ALU A;  4FED A;  5L9O A;  2A5S A;  3DP6 A;  3UP9 A;  4EQ9 A;  3CI8 A;  4QSC A;  1F9B A;  1FW0 A;  4GLI A;  2F6G A;  4HTG A;  4NE4 A;  5DVJ A;  4H0W A;  3UGW A;  3K4U A;  2V84 A;  1NNK A;  4H65 A;  1PDA A;  5IKB A;  5DTB A;  4ZEC A;  4YKJ A;  5A5X B;  5CBS A;  4KCC A;  3IO4 A;  4BDN A;  1EZP A;  1FTJ A;  4R74 A;  4I9D A;  4R9G A;  3PUX E;  1DTG A;  3M8U A;  2QL3 A;  4XKR A;  2ZNU A;  4LZ8 A;  3V5A A;  2XX7 A;  3T9V A;  2UVI A;  1DTZ A;  1RYX A;  3DM0 A;  3FV1 A;  4IO7 A;  3C32 A;  3WAE A;  4LUB A;  3UOR A;  4UA8 A;  4O3C A;  3ZKK A;  1MM6 A;  1S50 A;  1CE2 A;  3G3H A;  4F31 B;  3TMG A;  2YLN A;  1VFE A;  3OEM A;  1Y1M A;  3OSR A;  3MVW A;  1B51 A;  2YJP A;  3B6Q A;  4TQU Q;  2F7B A;  1B3E A;  3K1P A;  2REJ A;  4ISU A;  4OFL A;  2Z8F A;  4OEN A;  2QS4 A;  4F3B A;  1PB9 A;  3KFM A;  5H8H A;  1B32 A;  2ONS A;  1QW0 A;  1IEJ A;  4L17 A;  1R9Q A;  1Y20 A;  3S9L C;  1NH7 A;  3PV0 E;  1B7H A;  4G8N A;  4I1D A;  1LCT A;  2FA7 A;  1UIV A;  5DVI A;  4HCY A;  2M8C A;  4F3P A;  4Q30 B;  2ZYN A;  4M4G A;  4UAC A;  1QUI A;  3BFT A;  3DP4 A;  3CFX A;  2P1S A;  5EYF A;  4U4S A;  5FHO A;  2XD3 A;  5JTY B;  3SER A;  1NNF A;  1VR5 A;  2I3W A;  3SEY A;  1UTH B;  4U1O A;  3S4U A;  4JWO A;  3R7X A;  3IB0 A;  1QJM A;  4N13 A;  2I0C A;  2ZNS A;  5AA2 D;  3MP1 A;  4U23 A;  1DPE A;  2F8D A;  1PBQ A;  4ELQ A;  4Q0C A;  3M3F A;  2F7C A;  3U1O A;  4ZE9 A;  2F34 A;  3K0V A;  2Q2C A;  3RN8 A;  1BLF A;  2Y7P A;  3MZ1 A;  1P99 A;  2I48 A;  2V3Q A;  1MPD A;  2F36 A;  4G68 B;  1AL3 A;  2F35 A;  3TTR A;  2QMW A;  1B3L A;  2GRV A;  4Z0I A;  3IAZ A;  4QFK A;  3MJN A;  5ICQ A;  4F19 A;  4P0G A;  1QVS A;  3K1N A;  2Y7R A;  3O66 A;  1I6A A;  1MQD A;  1FQC A;  4KPT A;  3A3U A;  4IO3 A;  4R6Y A;  2X26 A;  2KLF A;  1OVT A;  3SES A;  1EH3 A;  1ZLQ A;  4ZEB A;  5H8N A;  3C34 A;  4FJP A;  4LQ2 A;  2QS3 A;  2QJE A;  4QFO A;  3PPQ A;  4OEU A;  3OSQ A;  3OD7 A;  1O63 A;  2Z22 A;  4PFY A;  4X9T A;  5TP9 A;  3H6U A;  4GD5 A;  4YMA A;  1Y4C A;  2RC7 A;  4YAH X;  1PB7 A;  4QRZ A;  4DZ1 A;  3H03 A;  3THI A;  1NL5 A;  3HPI A;  2XXW A;  5DEX A;  5ISU A;  3PPR A;  4JXI A;  4MLQ A;  4DLD A;  2DOJ A;  3F11 A;  4EDP A;  3TQW A;  2O68 A;  5ELV A;  3MVY A;  1A99 A;  2G93 A;  4JDF A;  3SEV A;  3KN7 A;  1UIU A;  3RLF E;  4NED A;  3G3K A;  5I58 A;  1N76 A;  5TPA B;  3V83 A;  3A09 A;  3E9X A;  2XXX A;  3CRB A;  1MY2 A;  4U2R A;  3S9N C;  2OLB A;  3G3F A;  1DMB A;  3BKI B;  4EQ7 A;  3MP8 A;  3TDJ A;  3FJG A;  1GTK A;  4XKP A;  2X7P A;  2PVU A;  4OQO A;  1UTB B;  3SKP A;  4KD5 A;  2PYY A;  3U93 A;  3PPO A;  1B4H A;  3CFL A;  2DWA A;  3IL1 B;  2AL5 A;  3IJO B;  1B40 A;  1DPP A;  4GFR A;  2DP8 A;  4RK9 A;  3LSF B;  3IOR A;  4OXV A;  2O7U A;  3KZG A;  3G3J A;  1B3G A;  3PGF A;  1XS5 A;  3LSX A;  3MPK A;  3C4M A;  3O6I A;  3IB1 A;  2QS2 A;  2DWJ A;  5I56 A;  3VVE A;  1OIB A;  2VOZ A;  3OEL A;  1D9Y A;  4ZZA A;  4QSE A;  4LAT A;  3TCG A;  3KOS A;  1IIW A;  3Q28 A;  2UYF A;  3H6V A;  2QPQ A;  1JEU A;  1A54 A;  2Y7K A;  2O69 A;  1B3H A;  3RTF B;  1QUL A;  1LB9 A;  5K2X A;  1XVX A;  1FTM A;  3CR9 A;  1LAF E;  4BDO A;  4NF6 A;  4LQ5 A;  4IB2 A;  3KSX A;  3VDF A;  1LGB C;  2RCA A;  3L6H A;  2FNC A;  2DVC A;  3D4C A;  4RPN A;  4XXU A;  5F7V A;  1B7Z A;  2GHB A;  1FTL A;  4PQJ A;  3HHG A;  1B46 A;  1N84 A;  3RUM A;  1MDQ A;  3H3G A;  3KBR A;  2OZZ A;  2HZK A;  3KJT A;  3FXQ A;  1MH4 A;  4DE8 A;  3VLV A;  1FQF A;  2DVZ A;  1Y3P A;  4R9F A;  5B70 A;  4FAJ A;  3U72 A;  3K1M A;  4GL8 A;  4XTC Q;  4OYV A;  4QSD A;  2DXR A;  4NF5 A;  3ODB A;  4QFP A;  1P1U A;  1WVJ A;  2Z8E A;  5IAI A;  4LVQ A;  1B9J A;  4X1D A;  1D9V A;  5CM6 A;  3FIR A;  2R9J A;  1Q1K A;  1LFG A;  2I49 A;  1OVB A;  3MW0 A;  3OO8 A;  5I2N B;  1UQW A;  3FJM A;  5I84 A;  3VXB A;  4F1U A;  2H5Y A;  2THI A;  4LZ5 A;  3RNN A;  5AA4 B;  4DCY A;  3V89 B;  4FOR A;  3MVX A;  1B05 A;  1PBP A;  2HQ0 A;  1JVX A;  1TWY A;  4H8J A;  2HCA A;  3TQL A;  1FQB A;  3OO9 A;  3GLB A;  3OEN A;  4GIZ A;  5I59 A;  1URS A;  3FZV A;  2B3F A;  3ECR A;  4KHZ E;  1IQ7 A;  2I58 A;  1N0T A;  3B6W A;  3OMB A;  3C36 A;  3I3V A;  4KQP A;  3H6W A;  1QKB A;  1Z7M E;  4XIG Q;  3CSG A;  4DXC A;  1BIY A;  4NWC A;  3A3C A;  4U1Z A;  4R2B A;  4G77 A;  2PBW A;  1FCK A;  1R9L A;  4Z7E A;  3UN6 A;  3SEX A;  2ABH A;  1I6Q A;  2XXR A;  3C35 A;  3FVK A;  1USY H;  4F1V A;  3EQ1 A;  3P7I A;  4KI0 E;  5FTH A;  3WAF A;  2DE2 A;  2VD3 A;  1GGG A;  1M5E A;  2QSX A;  4LON B;  4F2O A;  3TPA A;  1PB8 A;  2X7Q A;  1GV8 A;  3QYT A;  3B6T A;  2ONK E;  2F7A A;  4R2F A;  1II5 A;  4MBP A;  4WEP A;  4IY5 A;  3D4G A;  3JYR A;  3K00 A;  1XOC A;  1EU8 A;  1B52 A;  4OFO A;  3O28 A;  3FGS A;  1LST A;  2DSF A;  3ZSF A;  5H8H B;  1QUJ A;  4H8I A;  3KGC A;  1GVC A;  2UVH A;  3IK6 B;  3C9H A;  3N6T A;  4ZDM A;  2DXY A;  4FEC A;  3ILT B;  1N3W A;  2CZL A;  1USY E;  1AH5 A;  1MPB A;  5CMM A;  4JSO A;  3IOW A;  3IOU A;  1MQJ A;  5HPQ A;  3TYH A;  1ATG A;  3FD3 A;  3O2A A;  1MXU A;  4RNS A;  3RTW B;  4N07 A;  4RXL A;  5HM4 B;  4NF8 A;  2XXP A;  4H6D A;  4BDQ A;  1YCJ A;  5KDT A;  5AE4 A;  3MUQ A;  1M5B A;  1H45 A;  4OET A;  3HST A;  4U4X A;  1B7U A;  2V3T A;  1Y3N A;  1O64 A;  3EHT A;  1MRP A;  4R6K A;  4ZEK A;  4DDD A;  1LFI A;  1TT1 A;  3SET A;  4YIC A;  1SDX A;  3RPW A;  3CVG A;  3K2D A;  4BDL A;  3M3L A;  4K3F A;  2O1L A;  3IB2 A;  3DP8 A;  3LC8 A;  4TLM B;  3S9M C;  1ELJ A;  3MZB A;  4RK2 A;  1IXC A;  3S9E A;  1FTK A;  3KSJ A;  4F29 A;  3CFZ A;  2IEE A;  2XX8 A;  5KCJ B;  3V8X B;  3ONM A;  3QAX A;  3TEL A;  4GQO A;  3U8Q A;  5I57 A;  3K02 A;  2ZXT A;  4ND9 A;  5BWJ A;  2XXY A;  5JTY A;  3T66 A;  3USD A;  3SEW A;  1VE4 A;  3FVG A;  4MLV A;  1EZ9 A;  2LAO A;  4PP0 A;  2A5T A;  1MY0 A;  4AB5 A;  2OWT A;  1SYH A;  1D4N A;  1WOD A;  5ICT A;  2H25 A;  5FTI A;  1NH8 A;  3MAM A;  5TP9 B;  2OCU A;  4H67 A;  5CMC A;  1SI1 A;  3ILU B;  4I8C A;  5J1D A;  1H3D A;  3UIF A;  2R71 A;  4ZED A;  1A40 A;  1O7T A;  1HSE A;  2Z23 A;  2Q9T A;  3H6T A;  2YPN A;  4OTE A;  1N7W A;  2RC8 A;  3IJX B;  3Q26 A;  4KYS A;  3TUS A;  2OBG A;  4NF4 B;  1QUK A;  2HZL A;  2OK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...