5B8HA

Crystal structure of type iii pantothenate kinase (pank iii) from burkholderia cenocepacia complexed with pantothenate, imidodiphosphate, and amp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
256
structure length
256
Chain Sequence
SEPHLLIDAGNSRIKWALADARRTLVDTGAFGHTRDGGADPDWSRLPRPRGAWISNVAGADVAARIDALLDARWPGLPRTTIRSRPAQCGVTNGYTTPEQLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGCFTGGLIAPGWALMMRALGTHTAQLPTLTTDIASGLLAGAQAEPFQVDTPRSLSAGCLYAQAGLIERAWRDLVAAWQAPVRLVLAGGAADDVARALTIAHTRHDTLILSGLALIAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal Structure of Type III pantothenate kinase (PanK III) from Burkholderia cenocepacia complexed with pantothenate, imidodiphosphate, and AMP
rcsb
source organism Burkholderia cenocepacia (strain atcc baa-245 / dsm 16553 / lmg 16656 / nctc 132
molecule tags Transferase
total genus 74
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5b8hA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5b8hA02
2E2PA 3DJCA 4RTFD 1BU6O 4CBWA 1BA1A 5F0XA 3FZLA 2UYTA 3AAPA 1T6DA 5BN9A 1DEJA 3CHWA 4JN4A 4IXCA 1BA0A 5AQWA 2QM1A 3ZX2A 1GLFO 2P9SB 2QWOA 3FZKA 4FWNA 1NWKA 5F1XA 4CZJA 5JLHA 1HKGA 1WUAA 3L0QA 4K25A 1GLJO 4QS9A 3VENA 2ITMA 2P9PB 2HMPA 3L6QA 4B1UB 4BRFA 4FOEA 4H0OA 4Z94A 3R8EA 4L3QA 4EHUA 1KAZA 1ATSA 3MMVA 1Y64A 4PKHA 2J4RA 4H03B 2QXLA 1MWKA 5ADXA 4JHDB 3VERA 2Q36A 5BPMA 3DXMA 4BRLA 3VOVA 1NLVA 5AQTA 5AQJA 2W40A 3VF4A 4PL7A 3W0LA 3BF1A 3IUCA 5AQLA 4BVOA 3D2FB 1JCFA 2A5XA 4EAHD 3VPZA 1BO5O 2CGKA 5FPMA 5AQVA 3DXKB 5AQUA 4BRCA 2A6AA 4EFHA 4RWTA 2IVOA 2NRHA 5E26A 3IMXA 4BG8A 3CQXA 1KXPA 1SZ2A 3H3OB 4HWIA 3WQUA 3R6MA 4BR4A 4DB3A 3MK6A 4FWSA 1LCUA 3C7NA 4BVPA 4RCHA 1U2VA 3WUHA 2NZTA 2A40A 3DWLA 1HJOA 1NGAA 4JAXA 3SMSA 4M7XA 1QQNA 2FSNA 3FFKB 3O8MA 4B1WB 2QW9A 2P9IA 3BEXA 1WOQA 3A5MC 3FZMA 2E2OA 1XUPO 4WQ5A 1U6ZA 3G25A 2NLXA 3AARA 4WYBA 4BRHA 3J8AA 1MDUB 3QB0A 1V4SA 3HI0A 1QZ5A 2Q1NA 3BP8A 4GY2B 5BRDA 1S3XA 3JXUA 4E1JA 3H46O 5AQQA 3EN9A 3GOIA 3WXLA 3DXMB 3LDLA 4NB4A 2Q0UA 5EXWA 3CJ1A 4BRGA 5AR0A 2ASOA 3SLCA 3S41A 3QBWA 3LDNA 3LM2A 1E4FT 4WQ4C 5AQRA 4CZGA 3EKUA 3MCPA 4BR9A 4K43A 4H0VB 3CETA 3FGUA 1QHAA 2BUPA 1YVNA 4IJNA 1GLCG 4FWLA 1YUWA 4FPAA 3VEYA 3C7NB 2YHYA 4H0XB 3A5LC 5AQYA 4BGAA 1U2VB 3CJ9A 3QBXA 4ISGA 5BPLA 1TYQA 4BGBA 4BRNA 4PKIA 2FXUA 2VCPA 3QICA 1CZAN 5CE3A 5TKYA 4ISFA 5BREA 4JNEA 1BDGA 2P9IB 3BUZB 3KHYA 3O1WA 3IDHA 2KHOA 4XH1A 3P4IA 5ADXH 4CD1A 1KAXA 4K41A 2YHXA 1IG8A 4H5NA 4IO8A 4FWPA 4NO7A 4BG9A 1HUXA 2ASMA 5KQDA 3H3NO 4PKGA 3UKRA 3GE1A 4H5VA 3QFPA 4FL9A 5AQOA 4BREA 3TU5A 2Q31A 3VF6A 4BC3A 2A41A 4K42A 1IJJA 2F9TA 4H5RA 2ZF5O 4CZEA 4BRDA 3LDQA 1Z6RA 3CIPA 4BR2A 2ZWHA 3D7EO 2FF3B 4LC9B 1X9JA 4CBXA 5JLFA 1BUPA 5AQKA 3VESA 2GWJA 3UE5A 1HKCA 3CJ7A 5AZJA 3MDQA 5AQSA 3TPQA 3ZEUA 3ZX0A 4FO0A 2DPNA 4CJ7A 1RFQA 3MN7A 4FSVA 5KPTA 3U9DA 3LDPA 5ELZA 3ATVA 3WT0A 1ZXOA 1SAZA 1NGFA 1C0GA 2ZGYA 3FZHA 3VETA 4BRIA 1QQMA 2HF4A 4A61A 3C0BA 2YHWA 3RSEA 3F9MA 1KAYA 3WQTA 4BQZA 1YAGA 3VEZA 1GLEG 5BRFA 1DGKN 2Q0RA 5I9EB 2PAVA 5FPNA 2P9NA 3UKUA 4H0PA 2YCHA 1XC3A 2Q97A 1NMDA 3U8XA 4CZIA 3UKRB 3MN5A 3VEVA 1X3MA 4FWRA 2FSJA 1E4GT 2WUSA 4CZMA 5BR9A 3A5OC 1NGJA 1NGIA 4XH5A 5EVZA 2QWPA 3L4IA 3VEWA 4B1YB 3FZFA 3UB5A 5AQXA 1NM1A 1K8KA 5AQMA 4I6MA 1MWMA 5KPZA 4MO5A 4BRKA 3GBTA 3OHRA 3QMLA 2CGLA 2FF6A 3VGMA 4HTLA 1ESVA 1QZ6A 3GL1A 3FLCO 4AM6A 4XH4A 5AZJB 2H3GX 5KQ8A 2V52B 3WXJA 1T6CA 5BPNA 4C23A 3ZETA 4DQ8A 3U9ZA 2HOEA 2E8AA 3CJCA 3MN6A 2EWSA 2CH6A 2FSKA 4QS8A 2QWQA 4B1VA 1V4TA 1DKGD 5AQIA 2IIRA 3O1BA 4O5FA 2IVPA 4CZLA 1LOTB 1H1VA 3EKSA 1GLAG 3ID8A 2FLOA 4CZHA 3H45C 5AQGA 3RSEB 1S22A 2PBDA 4A62A 1NGDA 1X3NA 3FE1A 4FWQA 2I7PA 2P9LA 4JHDA 1NGBA 2P9NB 3ULEA 4BRPA 3H1QA 2GEMA 3AY9A 3GG4A 5EOYA 4CI6A 1ZBSA 2VYPA 3H1VX 3JS6A 3QDKA 4F9OA 4A2AA 3HSCA 1NGHA 1GLDG 3HM8A 1C0FA 3LDOA 2QWNA 3HBTA 1ATRA 4KBOA 4MO4A 3CERA 4B1XB 2E2NA 3W3DA 1BG3A 1MA9B 4MLHA 1K8KB 3SJHA 4GNIA 3U4LA 2AA4A 4I6MB 5AFUA 4H5TA 2E2QA 4WQ4A 3O4WA 1HPMA 1P8ZA 4YDUC 4CD3A 5BN8A 3HZ6A 4FOIA 4J8FA 4CZFA 3A0IX 4IZ9A 2ZGZA 2E1ZA 1Q18A 1BWFO 3ZETB 4BROA 4AM7A 4Y0WA 4IJAA 3ENOA 3EL2A 4MLEA 3WEEA 4EHTA 5AQPA 4A2BA 1NGGA 2GELA 4PL8A 4IWVA 2P9KA 1QQOA 5FPEA 3EO3A 4JD2A 1ATNA 1Z05A 2A42A 1G99A 2A3ZA 2I7NA 2IVNA 4B1ZA 3DAWA 5AQHA 1TYQB 1ZC6A 2Q2RA 1OKJA 2W41A 2E1YA 4FPBA 2P9LB 3WXIA 5JMVA 2D0OA 4M7YA 3R9PA 4BC2A 1RGIA 3ULEB 5AQFA 1D4XA 3H6EA 3EZWA 5AQZA 2HF3A 4H5WA 4WQ5C 4YDUA 4EIAA 3LL3A 5LY3A 1HLUA 2YI1A 4BR7A 2OANA 2F9WA 2GTDA 3A8YA 1XQSC 3KVGA 4XEIA 3IFRA 3VGLA 4DCHA 3BF3A 3VF2A 3ZX3A 1SQKA 2D1KA 2AP1A 2D0PA 2V51B 3KZBA 2P9UA 2BTFA 5AZIA 2ASPA 5E84A 3D2EA 4FWKA 5AQNA 4BC5A 4BRQA 5LJWA 4ISEA 2YJEA 3I33A 2CH5A 3SK3A 3O08A 4H0TB 3AAQA 1HKBA 3HTVA 3O6WA 2V7ZA 4CBUA 2E20A 1TUUA 2E88A 2V7YA 1TUYA 3CJAA 5EX5A 3WEEB 2QWRA 3VEOA 4FWMA 1EQYA 1J6ZA 1NGCA 3VGKA 3ZEUB 4DHYA 1BOTO 2P9KB 1GLLO 2GUPA 2P9SA 4BQLA 1HX1A 3CI5A 4JD2B 2D4WA 3LM9A 5JICA 4FWOA 4B9QA 2P9PA 5KPRA 3A5NC 3FR0A 3M3ZA 1NBWA 1RDWX 1JCGA 1YXQA 3CQYA 4O8KA 2YJFA 4QS7A 1GLBG 3QFUA 3ATUA 4CZKA 5AFUH 4BC4A 2GWKA 5FPDA 3B8AX 4M63C 1T44A 3MN9A 1R59O 3O5BA 5BRHA 3UKUB 2QWLA 3O80A 4BR0A 2P9UB 3I8BA 5B8HA 5F2RA 2CGJA 3CJBA 4BRAA 5AZIB 3D2FA 3WXKA 2QWMA 3D2EB 3GDQA 4BR5A 2VWBA 1JCEA 3SMPA 3DXKA 3M1FA 3ENHA 4H0YB 5LJVA 5EY4A 3M6GA 1NGEA 4BRMA 3VEXA
chains in the Genus database with same CATH superfamily
4GKJK 1UAXA 3CCRN 4RTFD 1BU6O 4CF1A 3FZLA 3K5LA 2XRIA 1JJ2M 5AQWA 1J5EK 4FWNA 3N4QA 4OPHA 1TAUA 1NWKA 2ZJRL 4CZJA 1ZBFA 3L0QA 1YIJN 2ITMA 4X64K 1BI4B 3KWIA 1TAQA 1L5UA 4B1UB 1N34K 4FOEA 4Z94A 3CCQN 2NNWA 3CM5A 1NJWA 4NYNA 4ILGB 4EHUA 4N5SA 1RT4A 4DUZK 4NLBA 1LW2A 1KAZA 3AVAA 1ATSA 3MMVA 5J1EA 3SCXA 3NFAA 4JHDB 3VERA 1S1VA 1BCMA 4JRPA 2HHWA 2FBXA 3OYCA 4BRLA 1SKSA 4Z4HA 3VF4A 5JVGL 5AQLA 4BVOA 2HHSA 1XI1A 1XMQK 3PUFA 4RWTA 2IVOA 2NRHA 3THYB 3CQXA 5C2DA 1KXPA 1SZ2A 3TAMA 4CJUA 1O13A 3EEQA 4C1NI 1RDAA 3C7NA 3NDKA 3SAGA 3C6HA 2GV9A 3DLLL 3MECA 1BGXT 3LDSA 5TKWA 3MXMA 4YNQA 1HR0K 4B08A 4B1WB 3L4QA 2EHGA 3NH1A 3A5MC 3FZMA 4RG8A 1LW0A 1XUPO 3K5MA 5DM7L 4KI6A 2OA8A 4Z4FA 4QOZB 3J8AA 1MDUB 2HNZA 1YJWN 3HI0A 3BP8A 3QO9A 4FZXC 1S3XA 1JLEA 5AQQA 3GOIA 3WXLA 4DF8A 4GMJB 4NB4A 4BRGA 3CC2N 4B9TA 4CECA 4WQ4C 1SL2A 3SQ2A 3CETA 3AO5A 4CJWA 1Y97A 4IJNA 3K5NA 2HMIA 1HNIA 4FPAA 3C7NB 3CJ9A 5BPLA 1T03A 2HW3A 4PQUA 3HT3A 1ITGA 4N76A 3KLGA 4ILJA 3F73A 4OLAA 3CMAN 3RMDA 2FXUA 2VCPA 4KHYA 3QICA 3ZYYX 4M3RA 2UUCK 3CCVN 4M3YA 4KHNA 5BREA 3MWTA 3O3GA 2WC9A 4CD1A 1KAXA 1SL1A 2DTUA 4BG9A 4H5NA 5KQDA 3GE1A 3ZSZA 4H5VA 3QFPA 4AHSA 4FL9A 3TU5A 2I5JA 3VF6A 4J2AA 2A41A 5KTQA 4F2RA 4K42A 4CZEA 2GX9A 1KD1O 3D45A 3NBPA 4B8CA 2Q3SA 1WLJA 1CZBA 4LC9B 1BUPA 2G8HA 3LPTA 2AJQA 4DFKA 4FJMA 3ZEUA 4FO0A 4CJ7A 1RFQA 1VRTA 1NKBA 3MN7A 4FSVA 1SKRA 5KPTA 4B9VA 3U9DA 1RCHA 1WSEA 4JI0K 5ELZA 4RW4A 5HRNA 1ZXOA 1C0GA 3CYMA 3BY5A 2ZGYA 4DUYK 4AQYK 1QQMA 2HF4A 3C0BA 5AJ3K 3ENBA 3LAMA 2OZSA 3OS0A 4QCLA 1ZBHA 3BDPA 1KFSA 5FPNA 1VAZA 4H0PA 1WAFA 4CZIA 1M1KO 4CCHA 1L3SA 1E4GT 1NGJA 1WNSA 5I3UA 4CF8A 3L4IA 4H4MA 4LFAK 3UB5A 1L3TA 4CHNA 5AQXA 5AQMA 3RR7A 1MWMA 4WF9L 3GBTA 3QMLA 3VGMA 4B9LA 2PY5A 3HXMA 4AM6A 1FKOA 4DF4A 3OS1A 2H3GX 3LZIA 5KQ8A 1N36K 2F4VK 4NCAA 3P83D 3R1XA 3I56N 3ZETA 5DK5A 3CJCA 3MN6A 3P38A 1W0HA 5C12A 1DKGD 4A5AA 2IIRA 2OYQA 3QNNA 4O5FA 2HHQA 4O8UA 3OYFA 3NF7A 1TVRA 2FLOA 5HP1A 3AO4A 3H45C 1S22A 1SV5A 3G4SN 2NRZA 1RTDA 4FWQA 5C25A 3ULEA 3AY9A 3O9UA 2WONA 4WFAL 1R0AA 4FLTA 4DQIA 1EKEA 3HM8A 1JLFA 4FLUA 4MO4A 4YOVA 1BG3A 1WN7A 3SJHA 4B9UA 4JK9A 3TI0A 2UXCK 3P5JA 4WQ4A 1HPMA 3PX0A 4YDUC 4KO0A 4E3SA 3KK7A 5BN8A 4HTUA 3ID6A 4OPAA 5J2QA 2HB5A 2G8WA 3KKSA 2E1ZA 1NOYA 4B3OA 1NK0A 3ZETB 3KK3A 4AM7A 4IJAA 3B6OA 3I0SA 4MLEA 4EHTA 4DV4K 3OW2M 4CK2A 5HRSA 5HOOA 2A1RA 2DFFA 4ID1A 1Q82O 2P9KA 1HNVA 2QEXN 3TAGA 2HHXA 4CJTA 3VQCA 3MWPA 4B1ZA 3TTFA 3J80O 3L2WA 1TYQB 1ZC6A 4JKDA 1OKJA 1HNZK 4DTRA 4DQQA 3WXIA 1RBRA 5JMVA 4BC2A 4V19S 3ULEB 3H6EA 4EIAA 3OVNA 1JLAA 4CHQA 5C10A 3MEGA 1UOCA 2OANA 1YT3A 3LWLA 3KVGA 4XEIA 1VQKN 3IFRA 2FBVA 3BF3A 4DSIA 3ZX3A 2HHHK 3J7YP 4DU4A 2KW4A 2V51B 3KZBA 4CGHA 3UIQA 1UA0A 2PYLA 3BZKA 2UUAK 1S1TA 5LJWA 3ZSXA 4IOXA 1U49A 2JWKA 2YHAA 2DFHA 3AAQA 3HJFA 1HKBA 2FBTA 4CEDA 3CC7N 1XNRK 3HPOA 4IFEA 5EX5A 1TUUA 3HPGA 1KC8O 1D9FA 4GV9A 1N32K 3VTHA 1NK7A 2RE2A 2A1SA 1WB9A 4CHOA 4DTMA 1EQYA 4GVEA 3T1YK 3VGKA 1YHQN 3OJSA 4OLBA 2P9KB 3SNNA 3AGKA 4K8XA 3QIPA 4BQLA 3CG7A 3OS2A 1HX1A 4CW7B 3LM9A 5JICA 2ETJA 1HYZA 4HUFA 2P9PA 5KPRA 2BDPA 3KLHA 3FR0A 3M3ZA 1NBWA 4MDAA 1JCGA 2UXDK 3PO4A 3VQAA 1GLBG 3QFUA 2JWLA 1B9DA 5FPDA 3KK1A 3WNFA 4JS4A 2O8DA 3MN9A 1ZBUA 4ELVA 3V1QA 2VG6A 3UKUB 1F21A 4K8ZA 1NK8A 4FM0A 2OPRA 5KI6A 1T05A 1HJRA 3HO1A 4BRAA 2QWMA 3GDQA 3DXKA 4FM1A 3PX6A 5GIOA 3I55N 4KKOA 4GW6A 3M6GA 4OJRA 4WFNL 2YX6A 2IGIA 4F3OA 2E2PA 3LP2A 5GIPA 1RT6A 2RF2A 5BN9A 4M42A 4DG1A 3ITHA 2B4JA 1NJYA 4JKGA 2OTJN 1BA0A 4C8OA 1RTHA 4QS9A 3AO2A 2P9PB 3R8EA 3O4QA 4UY8O 4CHYA 4AHTA 2QKBA 4DV3K 4FJXA 3C95A 4CFAA 3EYZA 2J4RA 2O8DB 2Q36A 4CGIA 5CZ2A 5AQJA 3W0LA 4CIEA 2HNDA 3BF1A 4Z4GA 1WSGA 1K6YA 1JCFA 2CGKA 5FPMA 1BHLA 1NKCA 5AQUA 3DXKB 1FJGK 1VQPN 1IO2A 3IMXA 4CJVA 3CFPA 1EX4A 4RW6A 3WQUA 3AA4A 3P1GA 5M1NA 4FWSA 3T69A 2NRVA 4DKWA 3NGZA 1U48A 2NZTA 4JKGB 3JSMA 1X9MA 3AV9A 3CFRA 1HJOA 1NGAA 1RBVA 4KRFA 4M7XA 3BZCA 4NLCA 1QQNA 1D5AA 1Q9XA 3FFKB 4M3WA 1O1WA 2P9IA 2XHBA 2E2OA 3DOKA 1U6ZA 3TSUA 3G0ZA 3AARA 4WYBA 3NHGA 4KB1A 3V4IA 1V4SA 4JLHA 5BRDA 1RILA 2BH1A 2YNHA 4KH4A 2O8EA 3JXUA 1YTUA 5JVHL 1S72N 3LDLA 3TSQA 2Q0UA 1LV5A 4LF8K 3CJ1A 4DR5K 5AR0A 2ASOA 4CEAA 3S41A 3MXIA 3LDNA 3ZT0A 1E4FT 4B3SK 5HROA 5AQRA 3D6RA 2P51A 5CR4A 4E7JA 3TAQA 3ZSVA 3HPHA 4NXNK 1GLCG 3NF6A 1VSIA 2RHKA 1YUWA 5IT9O 4BGAA 4CGGA 3OBYA 1XHZA 3CPWM 4BRNA 5C0YA 4DTXA 1X9WA 1VQ6N 4FK2A 1IV0A 5CE3A 3AGRA 2P9IB 3BUZB 3PSIA 4W5QA 3SUNA 4K41A 1WSHA 5CYQA 1QSSA 1A5XA 1HUXA 2ASMA 3VN5A 1K9MO 3H3NO 4PKGA 2D0BA 4DTPA 2G8VA 3P39A 2Q31A 4BC3A 2O8EB 1EWRA 1IJJA 2F9TA 4H5RA 2G8UA 4BRDA 1J54A 2VWKA 3PIPL 1HMVA 2ZWHA 4I2PA 4DSEA 3D7EO 1X9JA 2HHTA 5AQKA 4LD0A 3UE5A 3NVKA 4CE9A 3CJ7A 3MDQA 1VQ8N 4FLYA 4JKEA 4CJ3A 3KD5E 3ZX0A 2RKIA 3KTQA 3MX5A 4YY3K 3ZSOA 3ATVA 3DMJA 1RNHA 3WT0A 3ZT3A 1XWLA 3MCAB 1SAZA 3VMFB 4DQPA 2B5JA 3L3VA 4BRIA 4BE1A 4I9QA 2B6AA 4L8RB 4CGJA 4DR3K 4BQZA 2F96A 1YAGA 1BIUA 2D0CA 3VEZA 1GLEG 2WBNA 5BRFA 4FXDA 1DGKN 1YF5L 2Q0RA 1LWFA 3SAHA 1DT9A 2PAVA 2P9NA 3CPEA 3HYFA 2YCHA 3MN5A 3VEVA 3SQ0A 2FSJA 2WUSA 3JYTA 3I0RA 3OYEA 1NGIA 3HP6A 3SUOA 2HBJA 2QWPA 1RDCA 3VEWA 3IRXA 1EP4A 3DLGA 4I6MA 2R7YA 4CGDA 4BRKA 2FF6A 4HTLA 1QZ6A 2FBYA 5DMRA 1QE1A 1HQEA 3FLCO 3MXJA 1IBMK 5FROA 3NF9A 4IDHA 1JLGA 3WXJA 4JI5K 2E8AA 5MLCQ 4B1VA 4CVNE 4YOXA 1V4TA 3KLFA 3M8SA 3THXA 1T8EA 2Z1JA 3O1BA 4CZLA 1GLAG 3ID8A 3ZSRA 3PLAA 3CCEN 4DFMA 2PBDA 3NF8A 4DV1K 4CJSA 5GAGP 4KV8A 3SV3A 4FLVA 1Q9YA 1XMOK 1NGBA 2P9NB 4BRPA 2GEMA 3GG4A 3O9SA 1C1AA 2E5LK 5SWMA 1ZBSA 2VYPA 3ALYA 3QDKA 4A2AA 1VQ4N 1I39A 3CCLN 4C1NK 4CHPA 3TARA 5LMUK 1C0FA 4DSKA 3HBTA 2BANA 1NJIO 1ATRA 1DLOA 1VQMN 4KBOA 4B1XB 4MFBA 4DFJA 4KHQA 3W3DA 4LSLA 4F2SA 3CM6A 4GNIA 2AA4A 4I6MB 1JL2A 4H5TA 1RTJA 3PO5A 2VWJA 3VQBA 4C8LA 4KHUA 1P8ZA 4CEBA 2VGNA 1SUQA 4FOIA 2DFEA 4LH4A 1NMNA 4JV5K 4W5RA 1VSDA 4B9MA 2BE2A 2PYJA 2QTDA 4BROA 1S6PA 3ENOA 3EL2A 3WEEA 3AVLA 4CEFA 4Z0UA 4NXMK 3PV8A 3THXB 4FJKA 4CF0A 4IWVA 1S1XA 1NNEA 4LY7A 1Q81O 4JD2A 1Z05A 2A42A 4CJEA 2A3ZA 5DM6L 2I7NA 5CYMA 2IVNA 4IOAL 3DAWA 3VQ9A 5EU7A 2XY6A 2Q2RA 3ZSQA 4Q5VA 3VQQA 5GAHP 1QHTA 3OTOK 4WQ5C 3AVBA 4M3TA 1IKYA 3LL3A 5LY3A 1GOAA 3LP0A 1S9GA 3I8DA 1W7AA 3QEXA 3PIOL 4FLXA 3VGLA 2DY4A 2QXFA 4KH6A 2HSTA 4R5PA 1QS4A 3WNGA 1JXBA 2P9UA 2W6LA 4EP5A 2KLAA 5AZIA 3VQ6A 3QINA 4FVMA 5SZTA 3HTVA 3T1AA 3O6WA 2V7ZA 1WBBA 4JK8A 1NK5A 4FW1A 2ZM6K 3SZ2A 3WEEB 4FZZA 3VA0A 4FWMA 1NJXA 4W5OA 4CJKA 3ZEUB 4DHYA 4LFCK 4K0KK 1BOTO 4DSLA 4N47A 2HBMA 1TK8A 4Y1CA 3CI5A 4JD2B 4HHTA 3RR8A 4MQ3A 3RMCA 4FWOA 4I9LA 4B9QA 4OKEA 1YITN 1P90A 4ICLA 3NGYA 1QQCA 3J7ZO 1YXQA 5HBMA 3CQYA 3ATUA 4CZKA 4BC4A 2NRTA 4I7FA 3SBGA 1NJZA 3LALA 2KZZA 3LANA 3O5BA 3QNOA 4CJQA 3VQ7A 2P9UB 3I8BA 3E01A 3RMBA 5AZIB 3D2FA 4M45A 4N41A 3L2QA 2VWBA 1JCEA 3CQ8A 3ENHA 3ZCMA 5EY4A 4CEOA 1NGEA 3RVCA 1NK6A 3ZT4A 4F8RA 3VEXA 4ELTA 4IEIA 4CBWA 1BIZA 4FJ9A 2HNYA 5F0XA 3QERA 3HK2A 2UYTA 1T6DA 4PA1A 2YNIA 1S1WA 1I94K 4BDPA 3PY8A 3DM2A 3ZX2A 5M1QA 1BISA 1GLFO 2QWOA 3FZKA 3QEPA 4I2QA 1OVYA 4JKFA 1HKGA 1WUAA 3VENA 4W5TA 1EO1A 4ZTJA 2HMPA 4BY9C 2LSNA 1L3VA 5CHIA 5J2NA 1UWBA 4C8MA 3OYNA 4BDZA 1KRPA 1Y64A 4PKHA 2KZMA 2QXLA 1NK4A 2QA4N 1ASVA 1MWKA 2P5OA 5BPMA 1KVCA 3ISNC 3VOVA 1YTAA 4N56A 4OKKA 1VSKA 3VQ5A 3D2FB 1BO5O 1KLMA 5AQVA 3V1OA 1BL3A 3L2RA 4FJNA 1VQ9N 3E9OA 1VSFA 4BG8A 4DQRA 2QI2A 3R6MA 4BR4A 3MK6A 3DRSA 4BVPA 4RCHA 1K73O 1U2VA 4JKHA 1W97L 2PFUA 1QSYA 2HHVA 2EX3A 1OVQA 2A40A 5C15A 3F5TA 5JS2A 3U3GA 4DFPA 3SMSA 3O8MA 3OYHA 1KVBA 3BEXA 1WOQA 3R3LA 1NKEA 4WQ5A 4H8KA 1ZBIA 4DTSA 4KHSA 3OYDA 3ZLJA 4KI4A 5M1KA 4RW7A 3ULDA 5FDLA 1QZ5A 2Q1NA 4IDKA 5C2FA 3LP3A 4E1JA 4E1NA 2IDOA 1KFDA 3NCIA 4DTNA 4TSXA 5EXWA 2WTUA 3SLCA 3QBWA 1RT7A 3LM2A 3K59A 1VQON 4QAGA 3U3YA 1HNXK 2F7TA 2VG5A 2ATQA 4BR9A 1SKWA 4K43A 4H0VB 1QHAA 2BUPA 4U7BA 3G71N 3V1RA 1YVNA 4OGEA 3NGIA 2YHYA 4DLGA 4H0XB 3A5LC 4A57A 1U2VB 3QBXA 4CFDA 1VSEA 4B3RK 1ILYA 4BGBA 1FW6A 2W6KA 1NK9A 4PKIA 3V9UA 2IAJA 3S3NA 2Y1IA 3PX4A 1CZAN 4JNEA 3KHYA 3IDHA 2KHOA 3OYIA 1A5WA 3OYGA 3HOTA 5HRPA 1NU0A 3NH2A 1IG8A 4IO8A 3UKRA 2E4LA 2X74A 1HNWK 4FK4A 4LF5K 4BREA 3VQPA 1OH7A 2WOMA 3OA9A 3Q7BA 1IH7A 4F4KA 2FF3B 2OZMA 4CBXA 3T3FA 1J53A 4CEEA 3VESA 5H1SQ 2GWJA 1QVGM 3IS9A 2Z1GA 4NYFA 3WNHA 3SYZA 3TABA 3L2VA 4M41A 4IOCL 2DPNA 3HVRA 2OCEA 4HUGA 1RBUA 4Q0BA 3OY9A 4EP4A 5LMNK 3V9XA 3AVJA 4CFBA 4DTOA 3KK2A 2HVIA 1NGFA 2P5GA 3VQEA 3FFIA 3FZHA 4UQGA 3VETA 1W9HA 4DU3A 1G15A 3RSEA 1KAYA 3WQTA 2RN2A 3VA3A 4DR7K 2KTQA 2KKZA 2G8IA 1J9AA 1XC3A 1RDUA 1EETA 2Q97A 3UKRB 4HUEA 4FWRA 4FJ8A 3HVTA 4CZMA 1RT1A 4XH5A 4DQSA 2OPQA 3CCMN 4B1YB 4DR1K 3FZFA 3O9TA 4F3TA 1NM1A 1K8KA 1S9EA 3SPZA 4DTUA 4DV0K 4Z4IA 1HPZA 3GL1A 4JI7K 3SQ4A 4XH4A 3QEVA 5CZ1A 3CXCM 5KGXA 1UA1A 2V52B 5GAEP 5BPNA 2XY7A 3HM9A 1LAVA 3HRGA 2HOEA 3U9ZA 1L3UA 2EWSA 2CH6A 2FSKA 4QS8A 2QWQA 5HLFA 5AQIA 3TAEA 4DR4K 4E7LA 1IG9A 2O8CA 1RT3A 2IVPA 1LOTB 1H1VA 4YFUA 2QKKA 3EKSA 1WBDA 1FXXA 4CZHA 3RSEB 1XHXA 3B6PA 4A62A 1NGDA 1RBSA 4E1MA 4JHDA 1REVA 4IKFA 1EXQA 4CIFA 3H1VX 1QSLA 3HSCA 4CHZA 1NGHA 4KB0A 4DR2K 1QTMA 4WFBL 2QWNA 4HCCA 4EZ6A 1WAJA 3CERA 3CFOA 2E2NA 3V9ZA 1A5VA 4B9SA 3C94A 1MA9B 1K8KB 3K0SA 3DYAA 4KHPK 3O4NA 3U4LA 3CD6N 3VQ8A 4AHVA 3TR8A 3EE8A 3RWUA 1BQMA 4X66K 3QESA 4DTJA 3WXMB 2OPSA 3E9PA 4IFYA 4CERA 1X9SA 3A0IX 4IZ9A 2ZGZA 1Q18A 1BWFO 4FJ7A 2Z1IA 4R79A 5AQPA 4A2BA 1HQUA 4DWIA 1VQ7N 3J7AP 4JI6K 4RW9A 3C6TA 3CF5L 1NGGA 2GELA 1RT5A 2O8CB 4PL8A 2XO7A 1QQOA 1RT2A 5FPEA 4O0IA 3P31A 3VQ4A 4CGFA 1ATNA 3SJJA 1G99A 4LF7K 3AVFA 1SL0A 4OPJA 1NG9A 1BCOA 2E1YA 2D0OA 4M7YA 5AQFA 4WE1A 1KSPA 1D4XA 3EZWA 2HF3A 4H5WA 3AO1A 4B3TK 3ZSWA 1VQLN 2W42A 3V81A 4CJ4A 3O9QA 2YKNA 4O5BA 4Z4EA 4AHCA 3VF2A 3OYBA 1SQKA 2D1KA 2AP1A 2D0PA 1D9DA 1JLQA 4JK7A 3QETA 4IO9L 3D2EA 4FWKA 3RTVA 1JKHA 4DSFA 5AQNA 3I33A 2CH5A 1N8RO 2NRWA 1NOZA 3T1HK 4NCBA 2D5RA 2V7YA 4WCEL 1TUYA 2KQ2A 1JLCA 4J2BA 4JKAA 3VEOA 1N5YA 3DLBA 1J6ZA 4IFVA 3WNEA 4CF2A 1MU2A 1KCFA 1GLLO 5E41A 1U4BA 1C1CA 3KWGA 2P9SA 1KVAA 3C6AA 2D4WA 4GV3A 4X65K 1RDWX 4CK1A 3OYJA 1KQSM 1OH8A 1VSHA 3DOLA 2Y1JA 4O8KA 5A2QO 3LZJA 4E7HA 2GWKA 2VGMA 1RDBA 4M63C 4ZHRA 1T44A 1RBTA 3K57A 1WSJA 2VG7A 5BRHA 3S3MA 3V9WA 4DV6K 4CF9A 3SUQA 3G6EN 3AVHA 4BR0A 4PUOA 4BE0A 5B8HA 2JGUA 5F2RA 4B9NA 2CGJA 1XNQK 3WXKA 3D2EB 1LAWA 3OYMA 3SMPA 3E66A 3CCSN 3M1FA 4FJJA 5LJVA 1B92A 3K5OA 1C6VA 3DRPA 4Y1DA 4BRMA 3TTCA 3K2PA 3DJCA 1BA1A 3AAPA 5FRNA 1DEJA 4PY5A 4C8KA 2HHUA 3AVMA 3AVGA 3CHWA 4JN4A 2BGGA 2UUBK 4W5NA 4IXCA 1ZYQA 2QM1A 1GOCA 2P9SB 3K58A 4NCGA 5F1XA 5JLHA 4K25A 1GLJO 1KLNA 1C1BA 4DLEA 1D8YA 1CXQA 4AHRA 3L6QA 4BRFA 3QIOA 4H0OA 4YOYA 4FLZA 4L3QA 4XIUA 1IKVA 1QVFM 3V6DA 3LAKA 4KFBA 2HBKA 3RRHA 4O4GA 4H03B 5ADXA 1JXEA 1U45A 1W2BM 4JKBA 3DXMA 4GVMA 1NLVA 3O9RA 3K9JA 4JEPA 5AQTA 2W40A 4PL7A 3TAFA 3IUCA 4ZTFA 3MEDA 5JS1A 1ASUA 5KGWA 2X78A 3ZT2A 1TGOA 2A5XA 3AVCA 3VPZA 4EAHD 5KRSA 3TANA 4ID5A 4BRCA 2A6AA 1Q86O 4EFHA 2PZSA 5E26A 4DB3A 3H3OB 4HWIA 3F9KA 1VRUA 3IG1A 3J81O 4HCBA 4CJFA 1LCUA 3MX2A 3OYKA 2OPPA 4JRQA 3T7ZA 3WUHA 5T7BA 5HRRA 4KAZA 3DWLA 3CCJN 4DMNA 4JAXA 1IBLK 4BWJA 2FSNA 1VQ5N 4JI4K 2QW9A 2G8FA 4AHUA 3SV4A 3AO3A 3QEIA 3G25A 4LF4K 2NLXA 1Q8IA 4PHTX 4CJ5A 4BRHA 1S1UA 3QB0A 1I3AA 4DR6K 4AF1A 4GY2B 2YNGA 1SS6A 4G1QA 3EZ5A 5FRMA 3C65A 3H46O 3EN9A 5J2PA 3DLHA 3DXMB 1KTQA 2F8TA 3S3OA 3DI6A 4YHHK 4M3ZA 1DTQA 3KIOA 1N33K 2IC3A 2ITGA 3E9LA 1RDDA 4MDBA 4OVLA 4CZGA 3O3FA 4CIGA 3EKUA 3MCPA 2G8KA 1S5JA 3FGUA 3KKRA 4LH5A 1J5OA 1C0TA 1X1PA 4FWLA 1B9FA 3EY1A 1Q7YO 3VEYA 4FM2A 3H08A 3OYAA 3OYLA 5AQYA 3EE9A 3N4PA 4LFBK 4ISGA 1TYQA 2YNFA 5GADP 4BE2A 2XY5A 1Z25A 5K14A 3ASMA 3L8BA 3SUPA 4FJ5A 5TKYA 4ISFA 3MEEA 4FJLA 4BWMA 1BDGA 3O1WA 4XH1A 3SPYA 4LSNA 3P4IA 5ADXH 4E0DA 1RTIA 2HVHA 1EWQA 4FVUA 3AVIA 2YHXA 4NO7A 4FWPA 1IBKK 4IG3A 4AH9A 3TAPA 2O8BA 1K8AO 3JAMO 5AQOA 2VQFK 2JLEA 4DS5A 5KRTA 2VQEK 2ZF5O 4FJHA 3M8QA 3ZSYA 3LDQA 1Z6RA 3CIPA 3M8PA 3V9SA 4BR2A 2ZJQL 2GUIA 3NAEA 5JLFA 1FKPA 1HKCA 4KREA 5AZJA 2WFBA 3TTDA 2P1JA 5AQSA 3TPQA 1VHXA 3VTIA 1TKXA 4H4OA 1OH5A 5CY4A 4IG0A 1TL3A 3A2FA 1M90O 2KFNA 1VSMA 4YOWA 5BR8K 3LDPA 4DV2K 5GINA 1S6QA 5C42A 2X6SA 4A59A 4AILC 1VSJA 1WSIA 4PWDA 2O4IA 5IWAK 4OKJA 2F8SA 4A61A 3NH0A 3K9KA 3OBWA 4CEZA 2YHWA 2ZE2A 3F9MA 4FK0A 3PSFA 4DV7K 4KTQA 2YV0X 3THWA 1CZ9A 1N6QA 4A5BA 3SAFA 5I9EB 4E19A 3UKUA 4LF6K 5M1PA 4O0JA 3LPUA 1NMDA 3U8XA 1GOBA 2O8BB 1X3MA 4KTWA 1IKXA 5BR9A 3LWMA 3A5OC 4OX9K 4CK3A 5EVZA 4J2EA 2IOCA 3L3UA 3KJVA 4FZYA 5FLXO 3E1YA 1YJNN 1TV6A 5KPZA 4MO5A 3OHRA 2OTLN 2CGLA 3AA2A 1ESVA 2XY8A 4OPKA 5AZJB 1TKDA 4B8AB 4DV5K 4DU1A 4J2DA 4FLWA 4OGCA 2O8FA 4DSJA 1T6CA 4C23A 4CJPA 4DQ8A 1TK5A 3C6UA 4IBNA 3M8RA 2NUBA 4O55A 3AVKA 4CFCA 1WSFA 3HP9A 3CC4N 3U6FA 1BQNA 4CESA 1TKTA 3BGRA 5AQGA 3L2UA 4KH5A 2UXBK 1TL1A 1X3NA 3MAQA 3FE1A 1IKWA 3THWB 2I7PA 2P9LA 3HOSA 3THVA 4GV6A 3CCUN 3H1QA 3F2KA 1XC9A 5EOYA 4CI6A 3JS6A 1U04A 3SBTA 1JLBA 4F9OA 4BACA 1GLDG 4LF9K 4YOTA 4G9ZA 5HL7L 3LDOA 5LL6Z 4JKCA 4C8NA 4CEQA 3TWHA 4JI3K 4MLHA 2ZQBA 2Z1HA 5AFUA 1LWEA 2E2QA 3IKMA 3DLKA 3O4WA 2X6NA 2ZJPL 4CD3A 3KD1E 3AVNA 3HZ6A 4OO1J 4J8FA 1Z26A 4CZFA 3SI6A 3TSPA 4M3UA 2KFZA 2O8FB 2RPIA 3Q7CA 4IEEA 1HYVA 4E89A 4Y0WA 1E3MA 5C24A 1YJ9N 4YORA 4FW2A 2E6MA 1FK9A 1T7PA 1VK0A 3EO3A 4DS4A 5J2MA 4M3XA 1ASWA 3HSTB 3AA3A 1CXUA 2YHBA 5AQHA 2W41A 4FPBA 2P9LB 4Z4CA 4FJIA 3R9PA 1RGIA 3HL8A 2YKMA 2E6LA 5AQZA 4U67L 4FYDA 4YDUA 4ILHA 4KTZA 4B3MK 3LP1A 1HLUA 2YI1A 4BR7A 3ZT1A 2F9WA 2GTDA 1CLQA 4HVJA 3A8YA 1XQSC 4ELUA 1TK0A 4DCHA 3O3HA 1DTTA 1HRHA 4YOUA 4JYAK 2BTFA 4JI2K 4GKKK 5M1FA 2ASPA 5E84A 1C0UA 3NE6A 3NVMA 4RW8A 4BC5A 4BRQA 4ISEA 2YJEA 3SK3A 4CJRA 3O08A 4H0TB 3IAYA 3RMAA 2QK9A 4CBUA 2E20A 3CJAA 2E88A 3S9HA 1OH6A 1U47A 1JL1A 2NRRA 2QWRA 4CJLA 1LWCA 2HBLA 1NGCA 1T3VA 4EZ9A 1C0MA 4E7IA 4X62K 1TKZA 2GUPA 3QLHA 1ZBLA 2D0AA 3VQDA 4E7KA 2UU9K 3SQ1A 4BDYA 4FJGA 5D3GA 1BI4A 3A5NC 3D0PA 1YVUA 3OJUA 4FCYA 3RRGA 1VQNN 3DLEA 2YJFA 4QS7A 4JS5A 4O44A 2GBZA 5AFUH 2IS3A 3B8AX 3QEWA 4JI8K 1VSLA 3CMEN 1R59O 4KHWA 2QWLA 4JI1K 3O80A 3DLRA 3KLIA 3M5RA 3NMUA 2FC0A 3DRRA 3T19A 2ZD1A 3CJBA 4BR5A 1HYSA 1YI2N 3AA5X 3KLEA 4H0YB 3THYA 5M1OA 5I42A 2O4GA 2NRXA 3G10A 4KPYA
chains in the Genus database with same CATH topology
2E2PA 4IEIA 3DJCA 4RTFD 1BU6O 4CBWA 1BA1A 5F0XA 5GIPA 3CCRN 3FZLA 2UYTA 3AAPA 1T6DA 5BN9A 1DEJA 1JJ2M 3CHWA 4JN4A 4JKGA 4IXCA 2OTJN 1BA0A 5AQWA 2QM1A 3ZX2A 5M1QA 1GLFO 2P9SB 2QWOA 3FZKA 4FWNA 3N4QA 4OPHA 1NWKA 5F1XA 2ZJRL 1OVYA 4JKFA 4CZJA 5JLHA 1HKGA 1WUAA 3L0QA 4K25A 1GLJO 4QS9A 3VENA 1YIJN 1EO1A 2ITMA 2P9PB 3KWIA 2HMPA 3L6QA 4B1UB 4BY9C 4BRFA 4FOEA 4H0OA 4Z94A 5CHIA 3R8EA 4YOYA 3CCQN 4UY8O 3VEXA 4L3QA 2NNWA 4ILGB 4EHUA 1QVFM 4NLBA 1KAZA 2HBKA 1ATSA 3MMVA 1Y64A 4PKHA 2J4RA 4H03B 2QXLA 2QA4N 1MWKA 5ADXA 4JHDB 3VERA 1W2BM 4JKBA 2Q36A 5BPMA 3DXMA 4BRLA 3VOVA 1NLVA 3O9RA 3K9JA 4JEPA 5AQJA 5AQTA 2W40A 3VF4A 4PL7A 3W0LA 3BF1A 3IUCA 5JVGL 5AQLA 4BVOA 3D2FB 1JCFA 2A5XA 4EAHD 3VPZA 1BO5O 2CGKA 5FPMA 5AQVA 3DXKB 5AQUA 4BRCA 2A6AA 1Q86O 1VQPN 1VQ9N 4EFHA 4RWTA 2IVOA 2NRHA 3E9OA 5E26A 3IMXA 4BG8A 3CQXA 5C2DA 1KXPA 1SZ2A 3H3OB 4HWIA 2QI2A 3R6MA 3WQUA 4BR4A 4DB3A 1O13A 5M1NA 3MK6A 4C1NI 4FWSA 1LCUA 3C7NA 3T69A 2NRVA 3MX2A 4RCHA 4BVPA 4DKWA 3C6HA 3SAGA 1U2VA 4JKHA 1K73O 3T7ZA 3WUHA 3DLLL 1W97L 2PFUA 2NZTA 4JKGB 2A40A 3DWLA 1HJOA 3F5TA 5C15A 1NGAA 3CCJN 5TKWA 4JAXA 3SMSA 4M7XA 4NLCA 1QQNA 2FSNA 3FFKB 1VQ5N 3O8MA 4B1WB 2QW9A 3L4QA 2P9IA 3BEXA 1WOQA 3A5MC 3FZMA 2E2OA 3R3LA 1XUPO 4WQ5A 1U6ZA 3G25A 3TSUA 2NLXA 5DM7L 3AARA 4PHTX 4WYBA 4BRHA 5M1KA 3J8AA 1MDUB 3QB0A 1YJWN 1V4SA 3HI0A 1QZ5A 2Q1NA 3BP8A 4GY2B 4AF1A 5BRDA 1SS6A 5C2FA 1S3XA 2BH1A 4KH4A 3JXUA 5JVHL 4E1JA 3C65A 3H46O 5AQQA 3EN9A 1S72N 3GOIA 3WXLA 3DXMB 3LDLA 4NB4A 3TSQA 2Q0UA 5EXWA 3CJ1A 4BRGA 5AR0A 3CC2N 2ASOA 3SLCA 3S41A 3QBWA 3LDNA 3LM2A 4WFNL 3E9LA 1E4FT 4MDBA 4WQ4C 1VQON 5AQRA 3D6RA 4CZGA 5CR4A 2F7TA 3EKUA 3MCPA 4BR9A 4K43A 4H0VB 3CETA 3FGUA 1QHAA 2BUPA 4U7BA 3G71N 1YVNA 4IJNA 1GLCG 4FWLA 2RHKA 1Q7YO 1YUWA 4FPAA 3VEYA 3C7NB 2YHYA 4H0XB 3A5LC 5AQYA 4A57A 4BGAA 1U2VB 3EE9A 3CJ9A 3N4PA 3QBXA 4ISGA 5BPLA 1TYQA 3OBYA 1ILYA 4BGBA 3CPWM 4BRNA 5C0YA 4ILJA 5GADP 3CMAN 4PKIA 2FXUA 2VCPA 3QICA 1CZAN 3ZYYX 1VQ6N 3CCVN 5CE3A 5TKYA 4ISFA 5BREA 3MWTA 4JNEA 1BDGA 2P9IB 3AGRA 3BUZB 3KHYA 3IDHA 2KHOA 3O1WA 4XH1A 3HOTA 3P4IA 5ADXH 2WC9A 4CD1A 1KAXA 4K41A 4FVUA 2YHXA 1IG8A 4H5NA 4IO8A 4FWPA 4NO7A 4BG9A 1HUXA 2ASMA 5KQDA 1K9MO 3H3NO 4PKGA 3UKRA 1K8AO 3GE1A 4H5VA 3QFPA 4FL9A 5AQOA 4BREA 3P39A 3TU5A 2Q31A 3VF6A 4BC3A 2A41A 4K42A 1IJJA 2F9TA 2GX9A 2ZF5O 4H5RA 4CZEA 1KD1O 3OA9A 4BRDA 3LDQA 1Z6RA 3CIPA 3PIPL 4BR2A 2ZJQL 3Q7BA 2ZWHA 3D7EO 2FF3B 4LC9B 1X9JA 4CBXA 5JLFA 1BUPA 5AQKA 3VESA 5H1SQ 2GWJA 3UE5A 3NVKA 1HKCA 1QVGM 3CJ7A 5AZJA 2WFBA 3TTDA 3MDQA 1VQ8N 4JKEA 5AQSA 4IOCL 3TPQA 3VTIA 3ZEUA 3ZX0A 4FO0A 2DPNA 4CJ7A 1RFQA 3MN7A 4FSVA 3MX5A 5KPTA 1M90O 4YOWA 3U9DA 3LDPA 5GINA 5ELZA 3ATVA 4A59A 3WT0A 3MCAB 1ZXOA 1SAZA 1NGFA 3VMFB 1C0GA 2ZGYA 3FZHA 3VETA 4BRIA 1QQMA 2HF4A 4A61A 3C0BA 3ENBA 3K9KA 3OBWA 2YHWA 3RSEA 3F9MA 1KAYA 3WQTA 4BQZA 1YAGA 3VEZA 1GLEG 2WBNA 5BRFA 1DGKN 1YF5L 2Q0RA 4A5BA 5I9EB 3SAFA 3SAHA 1DT9A 2PAVA 5FPNA 2KKZA 1VAZA 2P9NA 3CPEA 3UKUA 4H0PA 2YCHA 5M1PA 1XC3A 1RDUA 2Q97A 1NMDA 3U8XA 4CZIA 1M1KO 3UKRB 3MN5A 3VEVA 1X3MA 4FWRA 2FSJA 1E4GT 2WUSA 4CZMA 5BR9A 3A5OC 1NGJA 1NGIA 4XH5A 2HBJA 5EVZA 2QWPA 3L4IA 3VEWA 3CCMN 4B1YB 3FZFA 3UB5A 3O9TA 5AQXA 1NM1A 3E1YA 1K8KA 5AQMA 4I6MA 1MWMA 1YJNN 5KPZA 4WF9L 4MO5A 4BRKA 3GBTA 3OHRA 2OTLN 3QMLA 2CGLA 2FF6A 3VGMA 4HTLA 1ESVA 1QZ6A 3GL1A 3FLCO 4AM6A 4XH4A 5AZJB 3CXCM 2H3GX 5KQ8A 2V52B 4IDHA 5GAEP 3WXJA 1T6CA 3R1XA 4C23A 3ZETA 4DQ8A 5BPNA 3I56N 3HRGA 2HOEA 3U9ZA 2E8AA 3CJCA 5MLCQ 3MN6A 2EWSA 2CH6A 2FSKA 3P38A 2QWQA 4QS8A 4B1VA 1V4TA 5C12A 4YOXA 1DKGD 5AQIA 4A5AA 2IIRA 3O1BA 4O5FA 2IVPA 4CZLA 1LOTB 1H1VA 4O8UA 3EKSA 1GLAG 3ID8A 2FLOA 3CC4N 3PLAA 3CCEN 4CZHA 3H45C 5AQGA 3RSEB 1S22A 2PBDA 4KH5A 4A62A 3G4SN 1NGDA 1X3NA 2NRZA 3FE1A 4FWQA 5GAGP 2I7PA 2P9LA 3HOSA 4GV6A 4JHDA 3CCUN 1NGBA 2P9NB 3ULEA 4BRPA 3H1QA 3F2KA 2GEMA 3AY9A 3O9UA 3GG4A 3O9SA 4WFAL 5EOYA 4CI6A 1ZBSA 2VYPA 3H1VX 3JS6A 3SBTA 3QDKA 4F9OA 4A2AA 3HSCA 1VQ4N 1NGHA 3CCLN 4C1NK 1GLDG 4YOTA 4G9ZA 3HM8A 1C0FA 4WFBL 5HL7L 3LDOA 2QWNA 3HBTA 1NJIO 1ATRA 1VQMN 4KBOA 4MO4A 3CERA 4B1XB 2E2NA 4JKCA 4YOVA 3W3DA 1BG3A 1MA9B 4MLHA 1K8KB 3SJHA 4GNIA 3U4LA 2AA4A 4I6MB 4JK9A 5AFUA 3CD6N 4H5TA 2E2QA 3IKMA 3EE8A 4WQ4A 3O4WA 1HPMA 1P8ZA 4YDUC 2ZJPL 4CD3A 3WXMB 3KK7A 5BN8A 2VGNA 3HZ6A 4OO1J 4FOIA 3ID6A 4J8FA 4CZFA 3TSPA 3E9PA 4OPAA 3A0IX 4IZ9A 2ZGZA 2E1ZA 1Q18A 3Q7CA 4IEEA 1BWFO 3ZETB 2QTDA 4AM7A 4Y0WA 4IJAA 3ENOA 4BROA 3EL2A 4MLEA 3WEEA 4EHTA 4R79A 3OW2M 5AQPA 4A2BA 1VQ7N 1YJ9N 4YORA 3CF5L 5HOOA 1NGGA 2GELA 4PL8A 1Q82O 4IWVA 2P9KA 1QQOA 5FPEA 3EO3A 1Q81O 3P31A 2QEXN 4JD2A 1ATNA 1Z05A 2A42A 1G99A 2A3ZA 5DM6L 2I7NA 3MWPA 2IVNA 4B1ZA 3TTFA 4IOAL 3DAWA 5AQHA 1TYQB 1ZC6A 2Q2RA 1OKJA 2W41A 4JKDA 2E1YA 4FPBA 2P9LB 3WXIA 5GAHP 5JMVA 2D0OA 4M7YA 3R9PA 4BC2A 1RGIA 3ULEB 5AQFA 1D4XA 3H6EA 3EZWA 5AQZA 2HF3A 4H5WA 4WQ5C 4ILHA 4YDUA 4EIAA 3LL3A 4U67L 5LY3A 1VQLN 1HLUA 2YI1A 5C10A 4BR7A 3O9QA 2OANA 2F9WA 2GTDA 3A8YA 1XQSC 3KVGA 4XEIA 3PIOL 1VQKN 3IFRA 3VGLA 4DCHA 4KH6A 2HSTA 3BF3A 3VF2A 3ZX3A 1SQKA 2D1KA 2AP1A 2D0PA 2V51B 3KZBA 2P9UA 4JK7A 4YOUA 2BTFA 2KLAA 4IO9L 5AZIA 5M1FA 2ASPA 5E84A 3D2EA 4FWKA 3NVMA 5AQNA 4BC5A 4BRQA 5LJWA 4ISEA 2YJEA 3I33A 2CH5A 3SK3A 4IOXA 3O08A 4H0TB 2JWKA 2NRWA 1N8RO 3AAQA 1HKBA 3CC7N 3HTVA 3O6WA 2V7ZA 4CBUA 4IFEA 2E20A 1TUUA 2E88A 2V7YA 1TUYA 3CJAA 4JK8A 5EX5A 4WCEL 1KC8O 4GV9A 3VTHA 3WEEB 2RE2A 2NRRA 4JKAA 2QWRA 3VEOA 4FWMA 2HBLA 1EQYA 1J6ZA 1NGCA 1T3VA 4GVEA 3VGKA 3ZEUB 4DHYA 1YHQN 1BOTO 2P9KB 1GLLO 2GUPA 3AGKA 3KWGA 2P9SA 4BQLA 1HX1A 2HBMA 3C6AA 3CI5A 4JD2B 2D4WA 3LM9A 5JICA 4FWOA 4B9QA 1YITN 4GV3A 2P9PA 1P90A 3A5NC 5KPRA 3FR0A 3M3ZA 1NBWA 1RDWX 4MDAA 3J7ZO 1JCGA 1VQNN 1YXQA 1KQSM 3CQYA 4O8KA 2YJFA 4QS7A 1GLBG 3QFUA 2JWLA 3ATUA 4CZKA 5AFUH 4BC4A 2GWKA 2VGMA 5FPDA 2NRTA 3B8AX 4M63C 1T44A 3MN9A 3SBGA 3CMEN 1R59O 3O5BA 5BRHA 3UKUB 2QWLA 3O80A 3M5RA 3NMUA 3G6EN 4BR0A 2P9UB 3I8BA 5B8HA 5F2RA 2CGJA 3CJBA 4BRAA 5AZIB 3D2FA 3WXKA 2QWMA 3D2EB 3GDQA 4BR5A 2VWBA 1JCEA 3SMPA 3DXKA 3E66A 1YI2N 3CCSN 3M1FA 5GIOA 3ENHA 4H0YB 3I55N 5LJVA 5M1OA 5EY4A 3M6GA 2NRXA 1NGEA 3RVCA 2YX6A 4BRMA 3TTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2P A;  3DJC A;  4RTF D;  1BU6 O;  4CBW A;  1BA1 A;  5F0X A;  3FZL A;  2UYT A;  3AAP A;  1T6D A;  5BN9 A;  1DEJ A;  3CHW A;  4JN4 A;  4IXC A;  1BA0 A;  5AQW A;  2QM1 A;  3ZX2 A;  1GLF O;  2P9S B;  2QWO A;  3FZK A;  4FWN A;  1NWK A;  5F1X A;  4CZJ A;  5JLH A;  1HKG A;  1WUA A;  3L0Q A;  4K25 A;  1GLJ O;  4QS9 A;  3VEN A;  2ITM A;  2P9P B;  2HMP A;  3L6Q A;  4B1U B;  4BRF A;  4FOE A;  4H0O A;  4Z94 A;  3R8E A;  4L3Q A;  4EHU A;  1KAZ A;  1ATS A;  3MMV A;  1Y64 A;  4PKH A;  2J4R A;  4H03 B;  2QXL A;  1MWK A;  5ADX A;  4JHD B;  3VER A;  2Q36 A;  5BPM A;  3DXM A;  4BRL A;  3VOV A;  1NLV A;  5AQT A;  5AQJ A;  2W40 A;  3VF4 A;  4PL7 A;  3W0L A;  3BF1 A;  3IUC A;  5AQL A;  4BVO A;  3D2F B;  1JCF A;  2A5X A;  4EAH D;  3VPZ A;  1BO5 O;  2CGK A;  5FPM A;  5AQV A;  3DXK B;  5AQU A;  4BRC A;  2A6A A;  4EFH A;  4RWT A;  2IVO A;  2NRH A;  5E26 A;  3IMX A;  4BG8 A;  3CQX A;  1KXP A;  1SZ2 A;  3H3O B;  4HWI A;  3WQU A;  3R6M A;  4BR4 A;  4DB3 A;  3MK6 A;  4FWS A;  1LCU A;  3C7N A;  4BVP A;  4RCH A;  1U2V A;  3WUH A;  2NZT A;  2A40 A;  3DWL A;  1HJO A;  1NGA A;  4JAX A;  3SMS A;  4M7X A;  1QQN A;  2FSN A;  3FFK B;  3O8M A;  4B1W B;  2QW9 A;  2P9I A;  3BEX A;  1WOQ A;  3A5M C;  3FZM A;  2E2O A;  1XUP O;  4WQ5 A;  1U6Z A;  3G25 A;  2NLX A;  3AAR A;  4WYB A;  4BRH A;  3J8A A;  1MDU B;  3QB0 A;  1V4S A;  3HI0 A;  1QZ5 A;  2Q1N A;  3BP8 A;  4GY2 B;  5BRD A;  1S3X A;  3JXU A;  4E1J A;  3H46 O;  5AQQ A;  3EN9 A;  3GOI A;  3WXL A;  3DXM B;  3LDL A;  4NB4 A;  2Q0U A;  5EXW A;  3CJ1 A;  4BRG A;  5AR0 A;  2ASO A;  3SLC A;  3S41 A;  3QBW A;  3LDN A;  3LM2 A;  1E4F T;  4WQ4 C;  5AQR A;  4CZG A;  3EKU A;  3MCP A;  4BR9 A;  4K43 A;  4H0V B;  3CET A;  3FGU A;  1QHA A;  2BUP A;  1YVN A;  4IJN A;  1GLC G;  4FWL A;  1YUW A;  4FPA A;  3VEY A;  3C7N B;  2YHY A;  4H0X B;  3A5L C;  5AQY A;  4BGA A;  1U2V B;  3CJ9 A;  3QBX A;  4ISG A;  5BPL A;  1TYQ A;  4BGB A;  4BRN A;  4PKI A;  2FXU A;  2VCP A;  3QIC A;  1CZA N;  5CE3 A;  5TKY A;  4ISF A;  5BRE A;  4JNE A;  1BDG A;  2P9I B;  3BUZ B;  3KHY A;  3O1W A;  3IDH A;  2KHO A;  4XH1 A;  3P4I A;  5ADX H;  4CD1 A;  1KAX A;  4K41 A;  2YHX A;  1IG8 A;  4H5N A;  4IO8 A;  4FWP A;  4NO7 A;  4BG9 A;  1HUX A;  2ASM A;  5KQD A;  3H3N O;  4PKG A;  3UKR A;  3GE1 A;  4H5V A;  3QFP A;  4FL9 A;  5AQO A;  4BRE A;  3TU5 A;  2Q31 A;  3VF6 A;  4BC3 A;  2A41 A;  4K42 A;  1IJJ A;  2F9T A;  4H5R A;  2ZF5 O;  4CZE A;  4BRD A;  3LDQ A;  1Z6R A;  3CIP A;  4BR2 A;  2ZWH A;  3D7E O;  2FF3 B;  4LC9 B;  1X9J A;  4CBX A;  5JLF A;  1BUP A;  5AQK A;  3VES A;  2GWJ A;  3UE5 A;  1HKC A;  3CJ7 A;  5AZJ A;  3MDQ A;  5AQS A;  3TPQ A;  3ZEU A;  3ZX0 A;  4FO0 A;  2DPN A;  4CJ7 A;  1RFQ A;  3MN7 A;  4FSV A;  5KPT A;  3U9D A;  3LDP A;  5ELZ A;  3ATV A;  3WT0 A;  1ZXO A;  1SAZ A;  1NGF A;  1C0G A;  2ZGY A;  3FZH A;  3VET A;  4BRI A;  1QQM A;  2HF4 A;  4A61 A;  3C0B A;  2YHW A;  3RSE A;  3F9M A;  1KAY A;  3WQT A;  4BQZ A;  1YAG A;  3VEZ A;  1GLE G;  5BRF A;  1DGK N;  2Q0R A;  5I9E B;  2PAV A;  5FPN A;  2P9N A;  3UKU A;  4H0P A;  2YCH A;  1XC3 A;  2Q97 A;  1NMD A;  3U8X A;  4CZI A;  3UKR B;  3MN5 A;  3VEV A;  1X3M A;  4FWR A;  2FSJ A;  1E4G T;  2WUS A;  4CZM A;  5BR9 A;  3A5O C;  1NGJ A;  1NGI A;  4XH5 A;  5EVZ A;  2QWP A;  3L4I A;  3VEW A;  4B1Y B;  3FZF A;  3UB5 A;  5AQX A;  1NM1 A;  1K8K A;  5AQM A;  4I6M A;  1MWM A;  5KPZ A;  4MO5 A;  4BRK A;  3GBT A;  3OHR A;  3QML A;  2CGL A;  2FF6 A;  3VGM A;  4HTL A;  1ESV A;  1QZ6 A;  3GL1 A;  3FLC O;  4AM6 A;  4XH4 A;  5AZJ B;  2H3G X;  5KQ8 A;  2V52 B;  3WXJ A;  1T6C A;  5BPN A;  4C23 A;  3ZET A;  4DQ8 A;  3U9Z A;  2HOE A;  2E8A A;  3CJC A;  3MN6 A;  2EWS A;  2CH6 A;  2FSK A;  4QS8 A;  2QWQ A;  4B1V A;  1V4T A;  1DKG D;  5AQI A;  2IIR A;  3O1B A;  4O5F A;  2IVP A;  4CZL A;  1LOT B;  1H1V A;  3EKS A;  1GLA G;  3ID8 A;  2FLO A;  4CZH A;  3H45 C;  5AQG A;  3RSE B;  1S22 A;  2PBD A;  4A62 A;  1NGD A;  1X3N A;  3FE1 A;  4FWQ A;  2I7P A;  2P9L A;  4JHD A;  1NGB A;  2P9N B;  3ULE A;  4BRP A;  3H1Q A;  2GEM A;  3AY9 A;  3GG4 A;  5EOY A;  4CI6 A;  1ZBS A;  2VYP A;  3H1V X;  3JS6 A;  3QDK A;  4F9O A;  4A2A A;  3HSC A;  1NGH A;  1GLD G;  3HM8 A;  1C0F A;  3LDO A;  2QWN A;  3HBT A;  1ATR A;  4KBO A;  4MO4 A;  3CER A;  4B1X B;  2E2N A;  3W3D A;  1BG3 A;  1MA9 B;  4MLH A;  1K8K B;  3SJH A;  4GNI A;  3U4L A;  2AA4 A;  4I6M B;  5AFU A;  4H5T A;  2E2Q A;  4WQ4 A;  3O4W A;  1HPM A;  1P8Z A;  4YDU C;  4CD3 A;  5BN8 A;  3HZ6 A;  4FOI A;  4J8F A;  4CZF A;  3A0I X;  4IZ9 A;  2ZGZ A;  2E1Z A;  1Q18 A;  1BWF O;  3ZET B;  4BRO A;  4AM7 A;  4Y0W A;  4IJA A;  3ENO A;  3EL2 A;  4MLE A;  3WEE A;  4EHT A;  5AQP A;  4A2B A;  1NGG A;  2GEL A;  4PL8 A;  4IWV A;  2P9K A;  1QQO A;  5FPE A;  3EO3 A;  4JD2 A;  1ATN A;  1Z05 A;  2A42 A;  1G99 A;  2A3Z A;  2I7N A;  2IVN A;  4B1Z A;  3DAW A;  5AQH A;  1TYQ B;  1ZC6 A;  2Q2R A;  1OKJ A;  2W41 A;  2E1Y A;  4FPB A;  2P9L B;  3WXI A;  5JMV A;  2D0O A;  4M7Y A;  3R9P A;  4BC2 A;  1RGI A;  3ULE B;  5AQF A;  1D4X A;  3H6E A;  3EZW A;  5AQZ A;  2HF3 A;  4H5W A;  4WQ5 C;  4YDU A;  4EIA A;  3LL3 A;  5LY3 A;  1HLU A;  2YI1 A;  4BR7 A;  2OAN A;  2F9W A;  2GTD A;  3A8Y A;  1XQS C;  3KVG A;  4XEI A;  3IFR A;  3VGL A;  4DCH A;  3BF3 A;  3VF2 A;  3ZX3 A;  1SQK A;  2D1K A;  2AP1 A;  2D0P A;  2V51 B;  3KZB A;  2P9U A;  2BTF A;  5AZI A;  2ASP A;  5E84 A;  3D2E A;  4FWK A;  5AQN A;  4BC5 A;  4BRQ A;  5LJW A;  4ISE A;  2YJE A;  3I33 A;  2CH5 A;  3SK3 A;  3O08 A;  4H0T B;  3AAQ A;  1HKB A;  3HTV A;  3O6W A;  2V7Z A;  4CBU A;  2E20 A;  1TUU A;  2E88 A;  2V7Y A;  1TUY A;  3CJA A;  5EX5 A;  3WEE B;  2QWR A;  3VEO A;  4FWM A;  1EQY A;  1J6Z A;  1NGC A;  3VGK A;  3ZEU B;  4DHY A;  1BOT O;  2P9K B;  1GLL O;  2GUP A;  2P9S A;  4BQL A;  1HX1 A;  3CI5 A;  4JD2 B;  2D4W A;  3LM9 A;  5JIC A;  4FWO A;  4B9Q A;  2P9P A;  5KPR A;  3A5N C;  3FR0 A;  3M3Z A;  1NBW A;  1RDW X;  1JCG A;  1YXQ A;  3CQY A;  4O8K A;  2YJF A;  4QS7 A;  1GLB G;  3QFU A;  3ATU A;  4CZK A;  5AFU H;  4BC4 A;  2GWK A;  5FPD A;  3B8A X;  4M63 C;  1T44 A;  3MN9 A;  1R59 O;  3O5B A;  5BRH A;  3UKU B;  2QWL A;  3O80 A;  4BR0 A;  2P9U B;  3I8B A;  5B8H A;  5F2R A;  2CGJ A;  3CJB A;  4BRA A;  5AZI B;  3D2F A;  3WXK A;  2QWM A;  3D2E B;  3GDQ A;  4BR5 A;  2VWB A;  1JCE A;  3SMP A;  3DXK A;  3M1F A;  3ENH A;  4H0Y B;  5LJV A;  5EY4 A;  3M6G A;  1NGE A;  4BRM A;  3VEX A; 
#chains in the Genus database with same CATH topology
 4GKJ K;  1UAX A;  3CCR N;  4RTF D;  1BU6 O;  4CF1 A;  3FZL A;  3K5L A;  2XRI A;  1JJ2 M;  5AQW A;  1J5E K;  4FWN A;  3N4Q A;  4OPH A;  1TAU A;  1NWK A;  2ZJR L;  4CZJ A;  1ZBF A;  3L0Q A;  1YIJ N;  2ITM A;  4X64 K;  1BI4 B;  3KWI A;  1TAQ A;  1L5U A;  4B1U B;  1N34 K;  4FOE A;  4Z94 A;  3CCQ N;  2NNW A;  3CM5 A;  1NJW A;  4NYN A;  4ILG B;  4EHU A;  4N5S A;  1RT4 A;  4DUZ K;  4NLB A;  1LW2 A;  1KAZ A;  3AVA A;  1ATS A;  3MMV A;  5J1E A;  3SCX A;  3NFA A;  4JHD B;  3VER A;  1S1V A;  1BCM A;  4JRP A;  2HHW A;  2FBX A;  3OYC A;  4BRL A;  1SKS A;  4Z4H A;  3VF4 A;  5JVG L;  5AQL A;  4BVO A;  2HHS A;  1XI1 A;  1XMQ K;  3PUF A;  4RWT A;  2IVO A;  2NRH A;  3THY B;  3CQX A;  5C2D A;  1KXP A;  1SZ2 A;  3TAM A;  4CJU A;  1O13 A;  3EEQ A;  4C1N I;  1RDA A;  3C7N A;  3NDK A;  3SAG A;  3C6H A;  2GV9 A;  3DLL L;  3MEC A;  1BGX T;  3LDS A;  5TKW A;  3MXM A;  4YNQ A;  1HR0 K;  4B08 A;  4B1W B;  3L4Q A;  2EHG A;  3NH1 A;  3A5M C;  3FZM A;  4RG8 A;  1LW0 A;  1XUP O;  3K5M A;  5DM7 L;  4KI6 A;  2OA8 A;  4Z4F A;  4QOZ B;  3J8A A;  1MDU B;  2HNZ A;  1YJW N;  3HI0 A;  3BP8 A;  3QO9 A;  4FZX C;  1S3X A;  1JLE A;  5AQQ A;  3GOI A;  3WXL A;  4DF8 A;  4GMJ B;  4NB4 A;  4BRG A;  3CC2 N;  4B9T A;  4CEC A;  4WQ4 C;  1SL2 A;  3SQ2 A;  3CET A;  3AO5 A;  4CJW A;  1Y97 A;  4IJN A;  3K5N A;  2HMI A;  1HNI A;  4FPA A;  3C7N B;  3CJ9 A;  5BPL A;  1T03 A;  2HW3 A;  4PQU A;  3HT3 A;  1ITG A;  4N76 A;  3KLG A;  4ILJ A;  3F73 A;  4OLA A;  3CMA N;  3RMD A;  2FXU A;  2VCP A;  4KHY A;  3QIC A;  3ZYY X;  4M3R A;  2UUC K;  3CCV N;  4M3Y A;  4KHN A;  5BRE A;  3MWT A;  3O3G A;  2WC9 A;  4CD1 A;  1KAX A;  1SL1 A;  2DTU A;  4BG9 A;  4H5N A;  5KQD A;  3GE1 A;  3ZSZ A;  4H5V A;  3QFP A;  4AHS A;  4FL9 A;  3TU5 A;  2I5J A;  3VF6 A;  4J2A A;  2A41 A;  5KTQ A;  4F2R A;  4K42 A;  4CZE A;  2GX9 A;  1KD1 O;  3D45 A;  3NBP A;  4B8C A;  2Q3S A;  1WLJ A;  1CZB A;  4LC9 B;  1BUP A;  2G8H A;  3LPT A;  2AJQ A;  4DFK A;  4FJM A;  3ZEU A;  4FO0 A;  4CJ7 A;  1RFQ A;  1VRT A;  1NKB A;  3MN7 A;  4FSV A;  1SKR A;  5KPT A;  4B9V A;  3U9D A;  1RCH A;  1WSE A;  4JI0 K;  5ELZ A;  4RW4 A;  5HRN A;  1ZXO A;  1C0G A;  3CYM A;  3BY5 A;  2ZGY A;  4DUY K;  4AQY K;  1QQM A;  2HF4 A;  3C0B A;  5AJ3 K;  3ENB A;  3LAM A;  2OZS A;  3OS0 A;  4QCL A;  1ZBH A;  3BDP A;  1KFS A;  5FPN A;  1VAZ A;  4H0P A;  1WAF A;  4CZI A;  1M1K O;  4CCH A;  1L3S A;  1E4G T;  1NGJ A;  1WNS A;  5I3U A;  4CF8 A;  3L4I A;  4H4M A;  4LFA K;  3UB5 A;  1L3T A;  4CHN A;  5AQX A;  5AQM A;  3RR7 A;  1MWM A;  4WF9 L;  3GBT A;  3QML A;  3VGM A;  4B9L A;  2PY5 A;  3HXM A;  4AM6 A;  1FKO A;  4DF4 A;  3OS1 A;  2H3G X;  3LZI A;  5KQ8 A;  1N36 K;  2F4V K;  4NCA A;  3P83 D;  3R1X A;  3I56 N;  3ZET A;  5DK5 A;  3CJC A;  3MN6 A;  3P38 A;  1W0H A;  5C12 A;  1DKG D;  4A5A A;  2IIR A;  2OYQ A;  3QNN A;  4O5F A;  2HHQ A;  4O8U A;  3OYF A;  3NF7 A;  1TVR A;  2FLO A;  5HP1 A;  3AO4 A;  3H45 C;  1S22 A;  1SV5 A;  3G4S N;  2NRZ A;  1RTD A;  4FWQ A;  5C25 A;  3ULE A;  3AY9 A;  3O9U A;  2WON A;  4WFA L;  1R0A A;  4FLT A;  4DQI A;  1EKE A;  3HM8 A;  1JLF A;  4FLU A;  4MO4 A;  4YOV A;  1BG3 A;  1WN7 A;  3SJH A;  4B9U A;  4JK9 A;  3TI0 A;  2UXC K;  3P5J A;  4WQ4 A;  1HPM A;  3PX0 A;  4YDU C;  4KO0 A;  4E3S A;  3KK7 A;  5BN8 A;  4HTU A;  3ID6 A;  4OPA A;  5J2Q A;  2HB5 A;  2G8W A;  3KKS A;  2E1Z A;  1NOY A;  4B3O A;  1NK0 A;  3ZET B;  3KK3 A;  4AM7 A;  4IJA A;  3B6O A;  3I0S A;  4MLE A;  4EHT A;  4DV4 K;  3OW2 M;  4CK2 A;  5HRS A;  5HOO A;  2A1R A;  2DFF A;  4ID1 A;  1Q82 O;  2P9K A;  1HNV A;  2QEX N;  3TAG A;  2HHX A;  4CJT A;  3VQC A;  3MWP A;  4B1Z A;  3TTF A;  3J80 O;  3L2W A;  1TYQ B;  1ZC6 A;  4JKD A;  1OKJ A;  1HNZ K;  4DTR A;  4DQQ A;  3WXI A;  1RBR A;  5JMV A;  4BC2 A;  4V19 S;  3ULE B;  3H6E A;  4EIA A;  3OVN A;  1JLA A;  4CHQ A;  5C10 A;  3MEG A;  1UOC A;  2OAN A;  1YT3 A;  3LWL A;  3KVG A;  4XEI A;  1VQK N;  3IFR A;  2FBV A;  3BF3 A;  4DSI A;  3ZX3 A;  2HHH K;  3J7Y P;  4DU4 A;  2KW4 A;  2V51 B;  3KZB A;  4CGH A;  3UIQ A;  1UA0 A;  2PYL A;  3BZK A;  2UUA K;  1S1T A;  5LJW A;  3ZSX A;  4IOX A;  1U49 A;  2JWK A;  2YHA A;  2DFH A;  3AAQ A;  3HJF A;  1HKB A;  2FBT A;  4CED A;  3CC7 N;  1XNR K;  3HPO A;  4IFE A;  5EX5 A;  1TUU A;  3HPG A;  1KC8 O;  1D9F A;  4GV9 A;  1N32 K;  3VTH A;  1NK7 A;  2RE2 A;  2A1S A;  1WB9 A;  4CHO A;  4DTM A;  1EQY A;  4GVE A;  3T1Y K;  3VGK A;  1YHQ N;  3OJS A;  4OLB A;  2P9K B;  3SNN A;  3AGK A;  4K8X A;  3QIP A;  4BQL A;  3CG7 A;  3OS2 A;  1HX1 A;  4CW7 B;  3LM9 A;  5JIC A;  2ETJ A;  1HYZ A;  4HUF A;  2P9P A;  5KPR A;  2BDP A;  3KLH A;  3FR0 A;  3M3Z A;  1NBW A;  4MDA A;  1JCG A;  2UXD K;  3PO4 A;  3VQA A;  1GLB G;  3QFU A;  2JWL A;  1B9D A;  5FPD A;  3KK1 A;  3WNF A;  4JS4 A;  2O8D A;  3MN9 A;  1ZBU A;  4ELV A;  3V1Q A;  2VG6 A;  3UKU B;  1F21 A;  4K8Z A;  1NK8 A;  4FM0 A;  2OPR A;  5KI6 A;  1T05 A;  1HJR A;  3HO1 A;  4BRA A;  2QWM A;  3GDQ A;  3DXK A;  4FM1 A;  3PX6 A;  5GIO A;  3I55 N;  4KKO A;  4GW6 A;  3M6G A;  4OJR A;  4WFN L;  2YX6 A;  2IGI A;  4F3O A;  2E2P A;  3LP2 A;  5GIP A;  1RT6 A;  2RF2 A;  5BN9 A;  4M42 A;  4DG1 A;  3ITH A;  2B4J A;  1NJY A;  4JKG A;  2OTJ N;  1BA0 A;  4C8O A;  1RTH A;  4QS9 A;  3AO2 A;  2P9P B;  3R8E A;  3O4Q A;  4UY8 O;  4CHY A;  4AHT A;  2QKB A;  4DV3 K;  4FJX A;  3C95 A;  4CFA A;  3EYZ A;  2J4R A;  2O8D B;  2Q36 A;  4CGI A;  5CZ2 A;  5AQJ A;  3W0L A;  4CIE A;  2HND A;  3BF1 A;  4Z4G A;  1WSG A;  1K6Y A;  1JCF A;  2CGK A;  5FPM A;  1BHL A;  1NKC A;  5AQU A;  3DXK B;  1FJG K;  1VQP N;  1IO2 A;  3IMX A;  4CJV A;  3CFP A;  1EX4 A;  4RW6 A;  3WQU A;  3AA4 A;  3P1G A;  5M1N A;  4FWS A;  3T69 A;  2NRV A;  4DKW A;  3NGZ A;  1U48 A;  2NZT A;  4JKG B;  3JSM A;  1X9M A;  3AV9 A;  3CFR A;  1HJO A;  1NGA A;  1RBV A;  4KRF A;  4M7X A;  3BZC A;  4NLC A;  1QQN A;  1D5A A;  1Q9X A;  3FFK B;  4M3W A;  1O1W A;  2P9I A;  2XHB A;  2E2O A;  3DOK A;  1U6Z A;  3TSU A;  3G0Z A;  3AAR A;  4WYB A;  3NHG A;  4KB1 A;  3V4I A;  1V4S A;  4JLH A;  5BRD A;  1RIL A;  2BH1 A;  2YNH A;  4KH4 A;  2O8E A;  3JXU A;  1YTU A;  5JVH L;  1S72 N;  3LDL A;  3TSQ A;  2Q0U A;  1LV5 A;  4LF8 K;  3CJ1 A;  4DR5 K;  5AR0 A;  2ASO A;  4CEA A;  3S41 A;  3MXI A;  3LDN A;  3ZT0 A;  1E4F T;  4B3S K;  5HRO A;  5AQR A;  3D6R A;  2P51 A;  5CR4 A;  4E7J A;  3TAQ A;  3ZSV A;  3HPH A;  4NXN K;  1GLC G;  3NF6 A;  1VSI A;  2RHK A;  1YUW A;  5IT9 O;  4BGA A;  4CGG A;  3OBY A;  1XHZ A;  3CPW M;  4BRN A;  5C0Y A;  4DTX A;  1X9W A;  1VQ6 N;  4FK2 A;  1IV0 A;  5CE3 A;  3AGR A;  2P9I B;  3BUZ B;  3PSI A;  4W5Q A;  3SUN A;  4K41 A;  1WSH A;  5CYQ A;  1QSS A;  1A5X A;  1HUX A;  2ASM A;  3VN5 A;  1K9M O;  3H3N O;  4PKG A;  2D0B A;  4DTP A;  2G8V A;  3P39 A;  2Q31 A;  4BC3 A;  2O8E B;  1EWR A;  1IJJ A;  2F9T A;  4H5R A;  2G8U A;  4BRD A;  1J54 A;  2VWK A;  3PIP L;  1HMV A;  2ZWH A;  4I2P A;  4DSE A;  3D7E O;  1X9J A;  2HHT A;  5AQK A;  4LD0 A;  3UE5 A;  3NVK A;  4CE9 A;  3CJ7 A;  3MDQ A;  1VQ8 N;  4FLY A;  4JKE A;  4CJ3 A;  3KD5 E;  3ZX0 A;  2RKI A;  3KTQ A;  3MX5 A;  4YY3 K;  3ZSO A;  3ATV A;  3DMJ A;  1RNH A;  3WT0 A;  3ZT3 A;  1XWL A;  3MCA B;  1SAZ A;  3VMF B;  4DQP A;  2B5J A;  3L3V A;  4BRI A;  4BE1 A;  4I9Q A;  2B6A A;  4L8R B;  4CGJ A;  4DR3 K;  4BQZ A;  2F96 A;  1YAG A;  1BIU A;  2D0C A;  3VEZ A;  1GLE G;  2WBN A;  5BRF A;  4FXD A;  1DGK N;  1YF5 L;  2Q0R A;  1LWF A;  3SAH A;  1DT9 A;  2PAV A;  2P9N A;  3CPE A;  3HYF A;  2YCH A;  3MN5 A;  3VEV A;  3SQ0 A;  2FSJ A;  2WUS A;  3JYT A;  3I0R A;  3OYE A;  1NGI A;  3HP6 A;  3SUO A;  2HBJ A;  2QWP A;  1RDC A;  3VEW A;  3IRX A;  1EP4 A;  3DLG A;  4I6M A;  2R7Y A;  4CGD A;  4BRK A;  2FF6 A;  4HTL A;  1QZ6 A;  2FBY A;  5DMR A;  1QE1 A;  1HQE A;  3FLC O;  3MXJ A;  1IBM K;  5FRO A;  3NF9 A;  4IDH A;  1JLG A;  3WXJ A;  4JI5 K;  2E8A A;  5MLC Q;  4B1V A;  4CVN E;  4YOX A;  1V4T A;  3KLF A;  3M8S A;  3THX A;  1T8E A;  2Z1J A;  3O1B A;  4CZL A;  1GLA G;  3ID8 A;  3ZSR A;  3PLA A;  3CCE N;  4DFM A;  2PBD A;  3NF8 A;  4DV1 K;  4CJS A;  5GAG P;  4KV8 A;  3SV3 A;  4FLV A;  1Q9Y A;  1XMO K;  1NGB A;  2P9N B;  4BRP A;  2GEM A;  3GG4 A;  3O9S A;  1C1A A;  2E5L K;  5SWM A;  1ZBS A;  2VYP A;  3ALY A;  3QDK A;  4A2A A;  1VQ4 N;  1I39 A;  3CCL N;  4C1N K;  4CHP A;  3TAR A;  5LMU K;  1C0F A;  4DSK A;  3HBT A;  2BAN A;  1NJI O;  1ATR A;  1DLO A;  1VQM N;  4KBO A;  4B1X B;  4MFB A;  4DFJ A;  4KHQ A;  3W3D A;  4LSL A;  4F2S A;  3CM6 A;  4GNI A;  2AA4 A;  4I6M B;  1JL2 A;  4H5T A;  1RTJ A;  3PO5 A;  2VWJ A;  3VQB A;  4C8L A;  4KHU A;  1P8Z A;  4CEB A;  2VGN A;  1SUQ A;  4FOI A;  2DFE A;  4LH4 A;  1NMN A;  4JV5 K;  4W5R A;  1VSD A;  4B9M A;  2BE2 A;  2PYJ A;  2QTD A;  4BRO A;  1S6P A;  3ENO A;  3EL2 A;  3WEE A;  3AVL A;  4CEF A;  4Z0U A;  4NXM K;  3PV8 A;  3THX B;  4FJK A;  4CF0 A;  4IWV A;  1S1X A;  1NNE A;  4LY7 A;  1Q81 O;  4JD2 A;  1Z05 A;  2A42 A;  4CJE A;  2A3Z A;  5DM6 L;  2I7N A;  5CYM A;  2IVN A;  4IOA L;  3DAW A;  3VQ9 A;  5EU7 A;  2XY6 A;  2Q2R A;  3ZSQ A;  4Q5V A;  3VQQ A;  5GAH P;  1QHT A;  3OTO K;  4WQ5 C;  3AVB A;  4M3T A;  1IKY A;  3LL3 A;  5LY3 A;  1GOA A;  3LP0 A;  1S9G A;  3I8D A;  1W7A A;  3QEX A;  3PIO L;  4FLX A;  3VGL A;  2DY4 A;  2QXF A;  4KH6 A;  2HST A;  4R5P A;  1QS4 A;  3WNG A;  1JXB A;  2P9U A;  2W6L A;  4EP5 A;  2KLA A;  5AZI A;  3VQ6 A;  3QIN A;  4FVM A;  5SZT A;  3HTV A;  3T1A A;  3O6W A;  2V7Z A;  1WBB A;  4JK8 A;  1NK5 A;  4FW1 A;  2ZM6 K;  3SZ2 A;  3WEE B;  4FZZ A;  3VA0 A;  4FWM A;  1NJX A;  4W5O A;  4CJK A;  3ZEU B;  4DHY A;  4LFC K;  4K0K K;  1BOT O;  4DSL A;  4N47 A;  2HBM A;  1TK8 A;  4Y1C A;  3CI5 A;  4JD2 B;  4HHT A;  3RR8 A;  4MQ3 A;  3RMC A;  4FWO A;  4I9L A;  4B9Q A;  4OKE A;  1YIT N;  1P90 A;  4ICL A;  3NGY A;  1QQC A;  3J7Z O;  1YXQ A;  5HBM A;  3CQY A;  3ATU A;  4CZK A;  4BC4 A;  2NRT A;  4I7F A;  3SBG A;  1NJZ A;  3LAL A;  2KZZ A;  3LAN A;  3O5B A;  3QNO A;  4CJQ A;  3VQ7 A;  2P9U B;  3I8B A;  3E01 A;  3RMB A;  5AZI B;  3D2F A;  4M45 A;  4N41 A;  3L2Q A;  2VWB A;  1JCE A;  3CQ8 A;  3ENH A;  3ZCM A;  5EY4 A;  4CEO A;  1NGE A;  3RVC A;  1NK6 A;  3ZT4 A;  4F8R A;  3VEX A;  4ELT A;  4IEI A;  4CBW A;  1BIZ A;  4FJ9 A;  2HNY A;  5F0X A;  3QER A;  3HK2 A;  2UYT A;  1T6D A;  4PA1 A;  2YNI A;  1S1W A;  1I94 K;  4BDP A;  3PY8 A;  3DM2 A;  3ZX2 A;  5M1Q A;  1BIS A;  1GLF O;  2QWO A;  3FZK A;  3QEP A;  4I2Q A;  1OVY A;  4JKF A;  1HKG A;  1WUA A;  3VEN A;  4W5T A;  1EO1 A;  4ZTJ A;  2HMP A;  4BY9 C;  2LSN A;  1L3V A;  5CHI A;  5J2N A;  1UWB A;  4C8M A;  3OYN A;  4BDZ A;  1KRP A;  1Y64 A;  4PKH A;  2KZM A;  2QXL A;  1NK4 A;  2QA4 N;  1ASV A;  1MWK A;  2P5O A;  5BPM A;  1KVC A;  3ISN C;  3VOV A;  1YTA A;  4N56 A;  4OKK A;  1VSK A;  3VQ5 A;  3D2F B;  1BO5 O;  1KLM A;  5AQV A;  3V1O A;  1BL3 A;  3L2R A;  4FJN A;  1VQ9 N;  3E9O A;  1VSF A;  4BG8 A;  4DQR A;  2QI2 A;  3R6M A;  4BR4 A;  3MK6 A;  3DRS A;  4BVP A;  4RCH A;  1K73 O;  1U2V A;  4JKH A;  1W97 L;  2PFU A;  1QSY A;  2HHV A;  2EX3 A;  1OVQ A;  2A40 A;  5C15 A;  3F5T A;  5JS2 A;  3U3G A;  4DFP A;  3SMS A;  3O8M A;  3OYH A;  1KVB A;  3BEX A;  1WOQ A;  3R3L A;  1NKE A;  4WQ5 A;  4H8K A;  1ZBI A;  4DTS A;  4KHS A;  3OYD A;  3ZLJ A;  4KI4 A;  5M1K A;  4RW7 A;  3ULD A;  5FDL A;  1QZ5 A;  2Q1N A;  4IDK A;  5C2F A;  3LP3 A;  4E1J A;  4E1N A;  2IDO A;  1KFD A;  3NCI A;  4DTN A;  4TSX A;  5EXW A;  2WTU A;  3SLC A;  3QBW A;  1RT7 A;  3LM2 A;  3K59 A;  1VQO N;  4QAG A;  3U3Y A;  1HNX K;  2F7T A;  2VG5 A;  2ATQ A;  4BR9 A;  1SKW A;  4K43 A;  4H0V B;  1QHA A;  2BUP A;  4U7B A;  3G71 N;  3V1R A;  1YVN A;  4OGE A;  3NGI A;  2YHY A;  4DLG A;  4H0X B;  3A5L C;  4A57 A;  1U2V B;  3QBX A;  4CFD A;  1VSE A;  4B3R K;  1ILY A;  4BGB A;  1FW6 A;  2W6K A;  1NK9 A;  4PKI A;  3V9U A;  2IAJ A;  3S3N A;  2Y1I A;  3PX4 A;  1CZA N;  4JNE A;  3KHY A;  3IDH A;  2KHO A;  3OYI A;  1A5W A;  3OYG A;  3HOT A;  5HRP A;  1NU0 A;  3NH2 A;  1IG8 A;  4IO8 A;  3UKR A;  2E4L A;  2X74 A;  1HNW K;  4FK4 A;  4LF5 K;  4BRE A;  3VQP A;  1OH7 A;  2WOM A;  3OA9 A;  3Q7B A;  1IH7 A;  4F4K A;  2FF3 B;  2OZM A;  4CBX A;  3T3F A;  1J53 A;  4CEE A;  3VES A;  5H1S Q;  2GWJ A;  1QVG M;  3IS9 A;  2Z1G A;  4NYF A;  3WNH A;  3SYZ A;  3TAB A;  3L2V A;  4M41 A;  4IOC L;  2DPN A;  3HVR A;  2OCE A;  4HUG A;  1RBU A;  4Q0B A;  3OY9 A;  4EP4 A;  5LMN K;  3V9X A;  3AVJ A;  4CFB A;  4DTO A;  3KK2 A;  2HVI A;  1NGF A;  2P5G A;  3VQE A;  3FFI A;  3FZH A;  4UQG A;  3VET A;  1W9H A;  4DU3 A;  1G15 A;  3RSE A;  1KAY A;  3WQT A;  2RN2 A;  3VA3 A;  4DR7 K;  2KTQ A;  2KKZ A;  2G8I A;  1J9A A;  1XC3 A;  1RDU A;  1EET A;  2Q97 A;  3UKR B;  4HUE A;  4FWR A;  4FJ8 A;  3HVT A;  4CZM A;  1RT1 A;  4XH5 A;  4DQS A;  2OPQ A;  3CCM N;  4B1Y B;  4DR1 K;  3FZF A;  3O9T A;  4F3T A;  1NM1 A;  1K8K A;  1S9E A;  3SPZ A;  4DTU A;  4DV0 K;  4Z4I A;  1HPZ A;  3GL1 A;  4JI7 K;  3SQ4 A;  4XH4 A;  3QEV A;  5CZ1 A;  3CXC M;  5KGX A;  1UA1 A;  2V52 B;  5GAE P;  5BPN A;  2XY7 A;  3HM9 A;  1LAV A;  3HRG A;  2HOE A;  3U9Z A;  1L3U A;  2EWS A;  2CH6 A;  2FSK A;  4QS8 A;  2QWQ A;  5HLF A;  5AQI A;  3TAE A;  4DR4 K;  4E7L A;  1IG9 A;  2O8C A;  1RT3 A;  2IVP A;  1LOT B;  1H1V A;  4YFU A;  2QKK A;  3EKS A;  1WBD A;  1FXX A;  4CZH A;  3RSE B;  1XHX A;  3B6P A;  4A62 A;  1NGD A;  1RBS A;  4E1M A;  4JHD A;  1REV A;  4IKF A;  1EXQ A;  4CIF A;  3H1V X;  1QSL A;  3HSC A;  4CHZ A;  1NGH A;  4KB0 A;  4DR2 K;  1QTM A;  4WFB L;  2QWN A;  4HCC A;  4EZ6 A;  1WAJ A;  3CER A;  3CFO A;  2E2N A;  3V9Z A;  1A5V A;  4B9S A;  3C94 A;  1MA9 B;  1K8K B;  3K0S A;  3DYA A;  4KHP K;  3O4N A;  3U4L A;  3CD6 N;  3VQ8 A;  4AHV A;  3TR8 A;  3EE8 A;  3RWU A;  1BQM A;  4X66 K;  3QES A;  4DTJ A;  3WXM B;  2OPS A;  3E9P A;  4IFY A;  4CER A;  1X9S A;  3A0I X;  4IZ9 A;  2ZGZ A;  1Q18 A;  1BWF O;  4FJ7 A;  2Z1I A;  4R79 A;  5AQP A;  4A2B A;  1HQU A;  4DWI A;  1VQ7 N;  3J7A P;  4JI6 K;  4RW9 A;  3C6T A;  3CF5 L;  1NGG A;  2GEL A;  1RT5 A;  2O8C B;  4PL8 A;  2XO7 A;  1QQO A;  1RT2 A;  5FPE A;  4O0I A;  3P31 A;  3VQ4 A;  4CGF A;  1ATN A;  3SJJ A;  1G99 A;  4LF7 K;  3AVF A;  1SL0 A;  4OPJ A;  1NG9 A;  1BCO A;  2E1Y A;  2D0O A;  4M7Y A;  5AQF A;  4WE1 A;  1KSP A;  1D4X A;  3EZW A;  2HF3 A;  4H5W A;  3AO1 A;  4B3T K;  3ZSW A;  1VQL N;  2W42 A;  3V81 A;  4CJ4 A;  3O9Q A;  2YKN A;  4O5B A;  4Z4E A;  4AHC A;  3VF2 A;  3OYB A;  1SQK A;  2D1K A;  2AP1 A;  2D0P A;  1D9D A;  1JLQ A;  4JK7 A;  3QET A;  4IO9 L;  3D2E A;  4FWK A;  3RTV A;  1JKH A;  4DSF A;  5AQN A;  3I33 A;  2CH5 A;  1N8R O;  2NRW A;  1NOZ A;  3T1H K;  4NCB A;  2D5R A;  2V7Y A;  4WCE L;  1TUY A;  2KQ2 A;  1JLC A;  4J2B A;  4JKA A;  3VEO A;  1N5Y A;  3DLB A;  1J6Z A;  4IFV A;  3WNE A;  4CF2 A;  1MU2 A;  1KCF A;  1GLL O;  5E41 A;  1U4B A;  1C1C A;  3KWG A;  2P9S A;  1KVA A;  3C6A A;  2D4W A;  4GV3 A;  4X65 K;  1RDW X;  4CK1 A;  3OYJ A;  1KQS M;  1OH8 A;  1VSH A;  3DOL A;  2Y1J A;  4O8K A;  5A2Q O;  3LZJ A;  4E7H A;  2GWK A;  2VGM A;  1RDB A;  4M63 C;  4ZHR A;  1T44 A;  1RBT A;  3K57 A;  1WSJ A;  2VG7 A;  5BRH A;  3S3M A;  3V9W A;  4DV6 K;  4CF9 A;  3SUQ A;  3G6E N;  3AVH A;  4BR0 A;  4PUO A;  4BE0 A;  5B8H A;  2JGU A;  5F2R A;  4B9N A;  2CGJ A;  1XNQ K;  3WXK A;  3D2E B;  1LAW A;  3OYM A;  3SMP A;  3E66 A;  3CCS N;  3M1F A;  4FJJ A;  5LJV A;  1B92 A;  3K5O A;  1C6V A;  3DRP A;  4Y1D A;  4BRM A;  3TTC A;  3K2P A;  3DJC A;  1BA1 A;  3AAP A;  5FRN A;  1DEJ A;  4PY5 A;  4C8K A;  2HHU A;  3AVM A;  3AVG A;  3CHW A;  4JN4 A;  2BGG A;  2UUB K;  4W5N A;  4IXC A;  1ZYQ A;  2QM1 A;  1GOC A;  2P9S B;  3K58 A;  4NCG A;  5F1X A;  5JLH A;  4K25 A;  1GLJ O;  1KLN A;  1C1B A;  4DLE A;  1D8Y A;  1CXQ A;  4AHR A;  3L6Q A;  4BRF A;  3QIO A;  4H0O A;  4YOY A;  4FLZ A;  4L3Q A;  4XIU A;  1IKV A;  1QVF M;  3V6D A;  3LAK A;  4KFB A;  2HBK A;  3RRH A;  4O4G A;  4H03 B;  5ADX A;  1JXE A;  1U45 A;  1W2B M;  4JKB A;  3DXM A;  4GVM A;  1NLV A;  3O9R A;  3K9J A;  4JEP A;  5AQT A;  2W40 A;  4PL7 A;  3TAF A;  3IUC A;  4ZTF A;  3MED A;  5JS1 A;  1ASU A;  5KGW A;  2X78 A;  3ZT2 A;  1TGO A;  2A5X A;  3AVC A;  3VPZ A;  4EAH D;  5KRS A;  3TAN A;  4ID5 A;  4BRC A;  2A6A A;  1Q86 O;  4EFH A;  2PZS A;  5E26 A;  4DB3 A;  3H3O B;  4HWI A;  3F9K A;  1VRU A;  3IG1 A;  3J81 O;  4HCB A;  4CJF A;  1LCU A;  3MX2 A;  3OYK A;  2OPP A;  4JRQ A;  3T7Z A;  3WUH A;  5T7B A;  5HRR A;  4KAZ A;  3DWL A;  3CCJ N;  4DMN A;  4JAX A;  1IBL K;  4BWJ A;  2FSN A;  1VQ5 N;  4JI4 K;  2QW9 A;  2G8F A;  4AHU A;  3SV4 A;  3AO3 A;  3QEI A;  3G25 A;  4LF4 K;  2NLX A;  1Q8I A;  4PHT X;  4CJ5 A;  4BRH A;  1S1U A;  3QB0 A;  1I3A A;  4DR6 K;  4AF1 A;  4GY2 B;  2YNG A;  1SS6 A;  4G1Q A;  3EZ5 A;  5FRM A;  3C65 A;  3H46 O;  3EN9 A;  5J2P A;  3DLH A;  3DXM B;  1KTQ A;  2F8T A;  3S3O A;  3DI6 A;  4YHH K;  4M3Z A;  1DTQ A;  3KIO A;  1N33 K;  2IC3 A;  2ITG A;  3E9L A;  1RDD A;  4MDB A;  4OVL A;  4CZG A;  3O3F A;  4CIG A;  3EKU A;  3MCP A;  2G8K A;  1S5J A;  3FGU A;  3KKR A;  4LH5 A;  1J5O A;  1C0T A;  1X1P A;  4FWL A;  1B9F A;  3EY1 A;  1Q7Y O;  3VEY A;  4FM2 A;  3H08 A;  3OYA A;  3OYL A;  5AQY A;  3EE9 A;  3N4P A;  4LFB K;  4ISG A;  1TYQ A;  2YNF A;  5GAD P;  4BE2 A;  2XY5 A;  1Z25 A;  5K14 A;  3ASM A;  3L8B A;  3SUP A;  4FJ5 A;  5TKY A;  4ISF A;  3MEE A;  4FJL A;  4BWM A;  1BDG A;  3O1W A;  4XH1 A;  3SPY A;  4LSN A;  3P4I A;  5ADX H;  4E0D A;  1RTI A;  2HVH A;  1EWQ A;  4FVU A;  3AVI A;  2YHX A;  4NO7 A;  4FWP A;  1IBK K;  4IG3 A;  4AH9 A;  3TAP A;  2O8B A;  1K8A O;  3JAM O;  5AQO A;  2VQF K;  2JLE A;  4DS5 A;  5KRT A;  2VQE K;  2ZF5 O;  4FJH A;  3M8Q A;  3ZSY A;  3LDQ A;  1Z6R A;  3CIP A;  3M8P A;  3V9S A;  4BR2 A;  2ZJQ L;  2GUI A;  3NAE A;  5JLF A;  1FKP A;  1HKC A;  4KRE A;  5AZJ A;  2WFB A;  3TTD A;  2P1J A;  5AQS A;  3TPQ A;  1VHX A;  3VTI A;  1TKX A;  4H4O A;  1OH5 A;  5CY4 A;  4IG0 A;  1TL3 A;  3A2F A;  1M90 O;  2KFN A;  1VSM A;  4YOW A;  5BR8 K;  3LDP A;  4DV2 K;  5GIN A;  1S6Q A;  5C42 A;  2X6S A;  4A59 A;  4AIL C;  1VSJ A;  1WSI A;  4PWD A;  2O4I A;  5IWA K;  4OKJ A;  2F8S A;  4A61 A;  3NH0 A;  3K9K A;  3OBW A;  4CEZ A;  2YHW A;  2ZE2 A;  3F9M A;  4FK0 A;  3PSF A;  4DV7 K;  4KTQ A;  2YV0 X;  3THW A;  1CZ9 A;  1N6Q A;  4A5B A;  3SAF A;  5I9E B;  4E19 A;  3UKU A;  4LF6 K;  5M1P A;  4O0J A;  3LPU A;  1NMD A;  3U8X A;  1GOB A;  2O8B B;  1X3M A;  4KTW A;  1IKX A;  5BR9 A;  3LWM A;  3A5O C;  4OX9 K;  4CK3 A;  5EVZ A;  4J2E A;  2IOC A;  3L3U A;  3KJV A;  4FZY A;  5FLX O;  3E1Y A;  1YJN N;  1TV6 A;  5KPZ A;  4MO5 A;  3OHR A;  2OTL N;  2CGL A;  3AA2 A;  1ESV A;  2XY8 A;  4OPK A;  5AZJ B;  1TKD A;  4B8A B;  4DV5 K;  4DU1 A;  4J2D A;  4FLW A;  4OGC A;  2O8F A;  4DSJ A;  1T6C A;  4C23 A;  4CJP A;  4DQ8 A;  1TK5 A;  3C6U A;  4IBN A;  3M8R A;  2NUB A;  4O55 A;  3AVK A;  4CFC A;  1WSF A;  3HP9 A;  3CC4 N;  3U6F A;  1BQN A;  4CES A;  1TKT A;  3BGR A;  5AQG A;  3L2U A;  4KH5 A;  2UXB K;  1TL1 A;  1X3N A;  3MAQ A;  3FE1 A;  1IKW A;  3THW B;  2I7P A;  2P9L A;  3HOS A;  3THV A;  4GV6 A;  3CCU N;  3H1Q A;  3F2K A;  1XC9 A;  5EOY A;  4CI6 A;  3JS6 A;  1U04 A;  3SBT A;  1JLB A;  4F9O A;  4BAC A;  1GLD G;  4LF9 K;  4YOT A;  4G9Z A;  5HL7 L;  3LDO A;  5LL6 Z;  4JKC A;  4C8N A;  4CEQ A;  3TWH A;  4JI3 K;  4MLH A;  2ZQB A;  2Z1H A;  5AFU A;  1LWE A;  2E2Q A;  3IKM A;  3DLK A;  3O4W A;  2X6N A;  2ZJP L;  4CD3 A;  3KD1 E;  3AVN A;  3HZ6 A;  4OO1 J;  4J8F A;  1Z26 A;  4CZF A;  3SI6 A;  3TSP A;  4M3U A;  2KFZ A;  2O8F B;  2RPI A;  3Q7C A;  4IEE A;  1HYV A;  4E89 A;  4Y0W A;  1E3M A;  5C24 A;  1YJ9 N;  4YOR A;  4FW2 A;  2E6M A;  1FK9 A;  1T7P A;  1VK0 A;  3EO3 A;  4DS4 A;  5J2M A;  4M3X A;  1ASW A;  3HST B;  3AA3 A;  1CXU A;  2YHB A;  5AQH A;  2W41 A;  4FPB A;  2P9L B;  4Z4C A;  4FJI A;  3R9P A;  1RGI A;  3HL8 A;  2YKM A;  2E6L A;  5AQZ A;  4U67 L;  4FYD A;  4YDU A;  4ILH A;  4KTZ A;  4B3M K;  3LP1 A;  1HLU A;  2YI1 A;  4BR7 A;  3ZT1 A;  2F9W A;  2GTD A;  1CLQ A;  4HVJ A;  3A8Y A;  1XQS C;  4ELU A;  1TK0 A;  4DCH A;  3O3H A;  1DTT A;  1HRH A;  4YOU A;  4JYA K;  2BTF A;  4JI2 K;  4GKK K;  5M1F A;  2ASP A;  5E84 A;  1C0U A;  3NE6 A;  3NVM A;  4RW8 A;  4BC5 A;  4BRQ A;  4ISE A;  2YJE A;  3SK3 A;  4CJR A;  3O08 A;  4H0T B;  3IAY A;  3RMA A;  2QK9 A;  4CBU A;  2E20 A;  3CJA A;  2E88 A;  3S9H A;  1OH6 A;  1U47 A;  1JL1 A;  2NRR A;  2QWR A;  4CJL A;  1LWC A;  2HBL A;  1NGC A;  1T3V A;  4EZ9 A;  1C0M A;  4E7I A;  4X62 K;  1TKZ A;  2GUP A;  3QLH A;  1ZBL A;  2D0A A;  3VQD A;  4E7K A;  2UU9 K;  3SQ1 A;  4BDY A;  4FJG A;  5D3G A;  1BI4 A;  3A5N C;  3D0P A;  1YVU A;  3OJU A;  4FCY A;  3RRG A;  1VQN N;  3DLE A;  2YJF A;  4QS7 A;  4JS5 A;  4O44 A;  2GBZ A;  5AFU H;  2IS3 A;  3B8A X;  3QEW A;  4JI8 K;  1VSL A;  3CME N;  1R59 O;  4KHW A;  2QWL A;  4JI1 K;  3O80 A;  3DLR A;  3KLI A;  3M5R A;  3NMU A;  2FC0 A;  3DRR A;  3T19 A;  2ZD1 A;  3CJB A;  4BR5 A;  1HYS A;  1YI2 N;  3AA5 X;  3KLE A;  4H0Y B;  3THY A;  5M1O A;  5I42 A;  2O4G A;  2NRX A;  3G10 A;  4KPY A; 
#chains in the Genus database with same CATH homology
 2E2P A;  4IEI A;  3DJC A;  4RTF D;  1BU6 O;  4CBW A;  1BA1 A;  5F0X A;  5GIP A;  3CCR N;  3FZL A;  2UYT A;  3AAP A;  1T6D A;  5BN9 A;  1DEJ A;  1JJ2 M;  3CHW A;  4JN4 A;  4JKG A;  4IXC A;  2OTJ N;  1BA0 A;  5AQW A;  2QM1 A;  3ZX2 A;  5M1Q A;  1GLF O;  2P9S B;  2QWO A;  3FZK A;  4FWN A;  3N4Q A;  4OPH A;  1NWK A;  5F1X A;  2ZJR L;  1OVY A;  4JKF A;  4CZJ A;  5JLH A;  1HKG A;  1WUA A;  3L0Q A;  4K25 A;  1GLJ O;  4QS9 A;  3VEN A;  1YIJ N;  1EO1 A;  2ITM A;  2P9P B;  3KWI A;  2HMP A;  3L6Q A;  4B1U B;  4BY9 C;  4BRF A;  4FOE A;  4H0O A;  4Z94 A;  5CHI A;  3R8E A;  4YOY A;  3CCQ N;  4UY8 O;  3VEX A;  4L3Q A;  2NNW A;  4ILG B;  4EHU A;  1QVF M;  4NLB A;  1KAZ A;  2HBK A;  1ATS A;  3MMV A;  1Y64 A;  4PKH A;  2J4R A;  4H03 B;  2QXL A;  2QA4 N;  1MWK A;  5ADX A;  4JHD B;  3VER A;  1W2B M;  4JKB A;  2Q36 A;  5BPM A;  3DXM A;  4BRL A;  3VOV A;  1NLV A;  3O9R A;  3K9J A;  4JEP A;  5AQJ A;  5AQT A;  2W40 A;  3VF4 A;  4PL7 A;  3W0L A;  3BF1 A;  3IUC A;  5JVG L;  5AQL A;  4BVO A;  3D2F B;  1JCF A;  2A5X A;  4EAH D;  3VPZ A;  1BO5 O;  2CGK A;  5FPM A;  5AQV A;  3DXK B;  5AQU A;  4BRC A;  2A6A A;  1Q86 O;  1VQP N;  1VQ9 N;  4EFH A;  4RWT A;  2IVO A;  2NRH A;  3E9O A;  5E26 A;  3IMX A;  4BG8 A;  3CQX A;  5C2D A;  1KXP A;  1SZ2 A;  3H3O B;  4HWI A;  2QI2 A;  3R6M A;  3WQU A;  4BR4 A;  4DB3 A;  1O13 A;  5M1N A;  3MK6 A;  4C1N I;  4FWS A;  1LCU A;  3C7N A;  3T69 A;  2NRV A;  3MX2 A;  4RCH A;  4BVP A;  4DKW A;  3C6H A;  3SAG A;  1U2V A;  4JKH A;  1K73 O;  3T7Z A;  3WUH A;  3DLL L;  1W97 L;  2PFU A;  2NZT A;  4JKG B;  2A40 A;  3DWL A;  1HJO A;  3F5T A;  5C15 A;  1NGA A;  3CCJ N;  5TKW A;  4JAX A;  3SMS A;  4M7X A;  4NLC A;  1QQN A;  2FSN A;  3FFK B;  1VQ5 N;  3O8M A;  4B1W B;  2QW9 A;  3L4Q A;  2P9I A;  3BEX A;  1WOQ A;  3A5M C;  3FZM A;  2E2O A;  3R3L A;  1XUP O;  4WQ5 A;  1U6Z A;  3G25 A;  3TSU A;  2NLX A;  5DM7 L;  3AAR A;  4PHT X;  4WYB A;  4BRH A;  5M1K A;  3J8A A;  1MDU B;  3QB0 A;  1YJW N;  1V4S A;  3HI0 A;  1QZ5 A;  2Q1N A;  3BP8 A;  4GY2 B;  4AF1 A;  5BRD A;  1SS6 A;  5C2F A;  1S3X A;  2BH1 A;  4KH4 A;  3JXU A;  5JVH L;  4E1J A;  3C65 A;  3H46 O;  5AQQ A;  3EN9 A;  1S72 N;  3GOI A;  3WXL A;  3DXM B;  3LDL A;  4NB4 A;  3TSQ A;  2Q0U A;  5EXW A;  3CJ1 A;  4BRG A;  5AR0 A;  3CC2 N;  2ASO A;  3SLC A;  3S41 A;  3QBW A;  3LDN A;  3LM2 A;  4WFN L;  3E9L A;  1E4F T;  4MDB A;  4WQ4 C;  1VQO N;  5AQR A;  3D6R A;  4CZG A;  5CR4 A;  2F7T A;  3EKU A;  3MCP A;  4BR9 A;  4K43 A;  4H0V B;  3CET A;  3FGU A;  1QHA A;  2BUP A;  4U7B A;  3G71 N;  1YVN A;  4IJN A;  1GLC G;  4FWL A;  2RHK A;  1Q7Y O;  1YUW A;  4FPA A;  3VEY A;  3C7N B;  2YHY A;  4H0X B;  3A5L C;  5AQY A;  4A57 A;  4BGA A;  1U2V B;  3EE9 A;  3CJ9 A;  3N4P A;  3QBX A;  4ISG A;  5BPL A;  1TYQ A;  3OBY A;  1ILY A;  4BGB A;  3CPW M;  4BRN A;  5C0Y A;  4ILJ A;  5GAD P;  3CMA N;  4PKI A;  2FXU A;  2VCP A;  3QIC A;  1CZA N;  3ZYY X;  1VQ6 N;  3CCV N;  5CE3 A;  5TKY A;  4ISF A;  5BRE A;  3MWT A;  4JNE A;  1BDG A;  2P9I B;  3AGR A;  3BUZ B;  3KHY A;  3IDH A;  2KHO A;  3O1W A;  4XH1 A;  3HOT A;  3P4I A;  5ADX H;  2WC9 A;  4CD1 A;  1KAX A;  4K41 A;  4FVU A;  2YHX A;  1IG8 A;  4H5N A;  4IO8 A;  4FWP A;  4NO7 A;  4BG9 A;  1HUX A;  2ASM A;  5KQD A;  1K9M O;  3H3N O;  4PKG A;  3UKR A;  1K8A O;  3GE1 A;  4H5V A;  3QFP A;  4FL9 A;  5AQO A;  4BRE A;  3P39 A;  3TU5 A;  2Q31 A;  3VF6 A;  4BC3 A;  2A41 A;  4K42 A;  1IJJ A;  2F9T A;  2GX9 A;  2ZF5 O;  4H5R A;  4CZE A;  1KD1 O;  3OA9 A;  4BRD A;  3LDQ A;  1Z6R A;  3CIP A;  3PIP L;  4BR2 A;  2ZJQ L;  3Q7B A;  2ZWH A;  3D7E O;  2FF3 B;  4LC9 B;  1X9J A;  4CBX A;  5JLF A;  1BUP A;  5AQK A;  3VES A;  5H1S Q;  2GWJ A;  3UE5 A;  3NVK A;  1HKC A;  1QVG M;  3CJ7 A;  5AZJ A;  2WFB A;  3TTD A;  3MDQ A;  1VQ8 N;  4JKE A;  5AQS A;  4IOC L;  3TPQ A;  3VTI A;  3ZEU A;  3ZX0 A;  4FO0 A;  2DPN A;  4CJ7 A;  1RFQ A;  3MN7 A;  4FSV A;  3MX5 A;  5KPT A;  1M90 O;  4YOW A;  3U9D A;  3LDP A;  5GIN A;  5ELZ A;  3ATV A;  4A59 A;  3WT0 A;  3MCA B;  1ZXO A;  1SAZ A;  1NGF A;  3VMF B;  1C0G A;  2ZGY A;  3FZH A;  3VET A;  4BRI A;  1QQM A;  2HF4 A;  4A61 A;  3C0B A;  3ENB A;  3K9K A;  3OBW A;  2YHW A;  3RSE A;  3F9M A;  1KAY A;  3WQT A;  4BQZ A;  1YAG A;  3VEZ A;  1GLE G;  2WBN A;  5BRF A;  1DGK N;  1YF5 L;  2Q0R A;  4A5B A;  5I9E B;  3SAF A;  3SAH A;  1DT9 A;  2PAV A;  5FPN A;  2KKZ A;  1VAZ A;  2P9N A;  3CPE A;  3UKU A;  4H0P A;  2YCH A;  5M1P A;  1XC3 A;  1RDU A;  2Q97 A;  1NMD A;  3U8X A;  4CZI A;  1M1K O;  3UKR B;  3MN5 A;  3VEV A;  1X3M A;  4FWR A;  2FSJ A;  1E4G T;  2WUS A;  4CZM A;  5BR9 A;  3A5O C;  1NGJ A;  1NGI A;  4XH5 A;  2HBJ A;  5EVZ A;  2QWP A;  3L4I A;  3VEW A;  3CCM N;  4B1Y B;  3FZF A;  3UB5 A;  3O9T A;  5AQX A;  1NM1 A;  3E1Y A;  1K8K A;  5AQM A;  4I6M A;  1MWM A;  1YJN N;  5KPZ A;  4WF9 L;  4MO5 A;  4BRK A;  3GBT A;  3OHR A;  2OTL N;  3QML A;  2CGL A;  2FF6 A;  3VGM A;  4HTL A;  1ESV A;  1QZ6 A;  3GL1 A;  3FLC O;  4AM6 A;  4XH4 A;  5AZJ B;  3CXC M;  2H3G X;  5KQ8 A;  2V52 B;  4IDH A;  5GAE P;  3WXJ A;  1T6C A;  3R1X A;  4C23 A;  3ZET A;  4DQ8 A;  5BPN A;  3I56 N;  3HRG A;  2HOE A;  3U9Z A;  2E8A A;  3CJC A;  5MLC Q;  3MN6 A;  2EWS A;  2CH6 A;  2FSK A;  3P38 A;  2QWQ A;  4QS8 A;  4B1V A;  1V4T A;  5C12 A;  4YOX A;  1DKG D;  5AQI A;  4A5A A;  2IIR A;  3O1B A;  4O5F A;  2IVP A;  4CZL A;  1LOT B;  1H1V A;  4O8U A;  3EKS A;  1GLA G;  3ID8 A;  2FLO A;  3CC4 N;  3PLA A;  3CCE N;  4CZH A;  3H45 C;  5AQG A;  3RSE B;  1S22 A;  2PBD A;  4KH5 A;  4A62 A;  3G4S N;  1NGD A;  1X3N A;  2NRZ A;  3FE1 A;  4FWQ A;  5GAG P;  2I7P A;  2P9L A;  3HOS A;  4GV6 A;  4JHD A;  3CCU N;  1NGB A;  2P9N B;  3ULE A;  4BRP A;  3H1Q A;  3F2K A;  2GEM A;  3AY9 A;  3O9U A;  3GG4 A;  3O9S A;  4WFA L;  5EOY A;  4CI6 A;  1ZBS A;  2VYP A;  3H1V X;  3JS6 A;  3SBT A;  3QDK A;  4F9O A;  4A2A A;  3HSC A;  1VQ4 N;  1NGH A;  3CCL N;  4C1N K;  1GLD G;  4YOT A;  4G9Z A;  3HM8 A;  1C0F A;  4WFB L;  5HL7 L;  3LDO A;  2QWN A;  3HBT A;  1NJI O;  1ATR A;  1VQM N;  4KBO A;  4MO4 A;  3CER A;  4B1X B;  2E2N A;  4JKC A;  4YOV A;  3W3D A;  1BG3 A;  1MA9 B;  4MLH A;  1K8K B;  3SJH A;  4GNI A;  3U4L A;  2AA4 A;  4I6M B;  4JK9 A;  5AFU A;  3CD6 N;  4H5T A;  2E2Q A;  3IKM A;  3EE8 A;  4WQ4 A;  3O4W A;  1HPM A;  1P8Z A;  4YDU C;  2ZJP L;  4CD3 A;  3WXM B;  3KK7 A;  5BN8 A;  2VGN A;  3HZ6 A;  4OO1 J;  4FOI A;  3ID6 A;  4J8F A;  4CZF A;  3TSP A;  3E9P A;  4OPA A;  3A0I X;  4IZ9 A;  2ZGZ A;  2E1Z A;  1Q18 A;  3Q7C A;  4IEE A;  1BWF O;  3ZET B;  2QTD A;  4AM7 A;  4Y0W A;  4IJA A;  3ENO A;  4BRO A;  3EL2 A;  4MLE A;  3WEE A;  4EHT A;  4R79 A;  3OW2 M;  5AQP A;  4A2B A;  1VQ7 N;  1YJ9 N;  4YOR A;  3CF5 L;  5HOO A;  1NGG A;  2GEL A;  4PL8 A;  1Q82 O;  4IWV A;  2P9K A;  1QQO A;  5FPE A;  3EO3 A;  1Q81 O;  3P31 A;  2QEX N;  4JD2 A;  1ATN A;  1Z05 A;  2A42 A;  1G99 A;  2A3Z A;  5DM6 L;  2I7N A;  3MWP A;  2IVN A;  4B1Z A;  3TTF A;  4IOA L;  3DAW A;  5AQH A;  1TYQ B;  1ZC6 A;  2Q2R A;  1OKJ A;  2W41 A;  4JKD A;  2E1Y A;  4FPB A;  2P9L B;  3WXI A;  5GAH P;  5JMV A;  2D0O A;  4M7Y A;  3R9P A;  4BC2 A;  1RGI A;  3ULE B;  5AQF A;  1D4X A;  3H6E A;  3EZW A;  5AQZ A;  2HF3 A;  4H5W A;  4WQ5 C;  4ILH A;  4YDU A;  4EIA A;  3LL3 A;  4U67 L;  5LY3 A;  1VQL N;  1HLU A;  2YI1 A;  5C10 A;  4BR7 A;  3O9Q A;  2OAN A;  2F9W A;  2GTD A;  3A8Y A;  1XQS C;  3KVG A;  4XEI A;  3PIO L;  1VQK N;  3IFR A;  3VGL A;  4DCH A;  4KH6 A;  2HST A;  3BF3 A;  3VF2 A;  3ZX3 A;  1SQK A;  2D1K A;  2AP1 A;  2D0P A;  2V51 B;  3KZB A;  2P9U A;  4JK7 A;  4YOU A;  2BTF A;  2KLA A;  4IO9 L;  5AZI A;  5M1F A;  2ASP A;  5E84 A;  3D2E A;  4FWK A;  3NVM A;  5AQN A;  4BC5 A;  4BRQ A;  5LJW A;  4ISE A;  2YJE A;  3I33 A;  2CH5 A;  3SK3 A;  4IOX A;  3O08 A;  4H0T B;  2JWK A;  2NRW A;  1N8R O;  3AAQ A;  1HKB A;  3CC7 N;  3HTV A;  3O6W A;  2V7Z A;  4CBU A;  4IFE A;  2E20 A;  1TUU A;  2E88 A;  2V7Y A;  1TUY A;  3CJA A;  4JK8 A;  5EX5 A;  4WCE L;  1KC8 O;  4GV9 A;  3VTH A;  3WEE B;  2RE2 A;  2NRR A;  4JKA A;  2QWR A;  3VEO A;  4FWM A;  2HBL A;  1EQY A;  1J6Z A;  1NGC A;  1T3V A;  4GVE A;  3VGK A;  3ZEU B;  4DHY A;  1YHQ N;  1BOT O;  2P9K B;  1GLL O;  2GUP A;  3AGK A;  3KWG A;  2P9S A;  4BQL A;  1HX1 A;  2HBM A;  3C6A A;  3CI5 A;  4JD2 B;  2D4W A;  3LM9 A;  5JIC A;  4FWO A;  4B9Q A;  1YIT N;  4GV3 A;  2P9P A;  1P90 A;  3A5N C;  5KPR A;  3FR0 A;  3M3Z A;  1NBW A;  1RDW X;  4MDA A;  3J7Z O;  1JCG A;  1VQN N;  1YXQ A;  1KQS M;  3CQY A;  4O8K A;  2YJF A;  4QS7 A;  1GLB G;  3QFU A;  2JWL A;  3ATU A;  4CZK A;  5AFU H;  4BC4 A;  2GWK A;  2VGM A;  5FPD A;  2NRT A;  3B8A X;  4M63 C;  1T44 A;  3MN9 A;  3SBG A;  3CME N;  1R59 O;  3O5B A;  5BRH A;  3UKU B;  2QWL A;  3O80 A;  3M5R A;  3NMU A;  3G6E N;  4BR0 A;  2P9U B;  3I8B A;  5B8H A;  5F2R A;  2CGJ A;  3CJB A;  4BRA A;  5AZI B;  3D2F A;  3WXK A;  2QWM A;  3D2E B;  3GDQ A;  4BR5 A;  2VWB A;  1JCE A;  3SMP A;  3DXK A;  3E66 A;  1YI2 N;  3CCS N;  3M1F A;  5GIO A;  3ENH A;  4H0Y B;  3I55 N;  5LJV A;  5M1O A;  5EY4 A;  3M6G A;  2NRX A;  1NGE A;  3RVC A;  2YX6 A;  4BRM A;  3TTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...