5B8HA

Crystal structure of type iii pantothenate kinase (pank iii) from burkholderia cenocepacia complexed with pantothenate, imidodiphosphate, and amp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
256
structure length
256
Chain Sequence
b'SEPHLLIDAGNSRIKWALADARRTLVDTGAFGHTRDGGADPDWSRLPRPRGAWISNVAGADVAARIDALLDARWPGLPRTTIRSRPAQCGVTNGYTTPEQLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGCFTGGLIAPGWALMMRALGTHTAQLPTLTTDIASGLLAGAQAEPFQVDTPRSLSAGCLYAQAGLIERAWRDLVAAWQAPVRLVLAGGAADDVARALTIAHTRHDTLILSGLALIAAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal Structure of Type III pantothenate kinase (PanK III) from Burkholderia cenocepacia complexed with pantothenate, imidodiphosphate, and AMP
rcsb
source organism Burkholderia cenocepacia (strain atcc baa-245 / dsm 16553 / lmg 16656 / nctc 132
molecule tags Transferase
total genus 74
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5b8hA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5b8hA02
3EKSA 3AAPA 4JAXA 5AQJA 2ZWHA 3KHYA 3BF1A 4BQZA 5JLHA 3O4WA 3CQXA 2GEMA 1KAZA 4FWLA 3GDQA 4CZLA 4K42A 4B9QA 3H6EA 2NRHA 4NB4A 5BPNA 3HSCA 5EVZA 1NM1A 5AQTA 1J6ZA 3BF3A 5AQZA 2CH5A 1XC3A 4EFHA 3AAQA 2ASMA 3ZETB 3WUHA 4BR7A 4CBUA 3UKUB 3UB5A 3GBTA 5E26A 5FPNA 4BR5A 3FR0A 3H45C 5E84A 1SAZA 4JHDB 3BEXA 4CI6A 3VEOA 1MWKA 5EX5A 3SK3A 3O8MA 1H1VA 4FOIA 5TKYA 1SQKA 1XQSC 4O5FA 3ZX2A 2YHWA 4C23A 1TYQB 4H5TA 3I33A 4EHUA 1Z05A 2QWPA 3F9MA 4RCHA 5FPEA 3MN6A 3U8XA 1HKBA 2Q2RA 3DXKA 3CERA 2WUSA 2P9IB 5KQ8A 4FWPA 4GY2B 2F9TA 2YI1A 4M7XA 3MN9A 4FWRA 3O08A 3WEEB 4BC4A 3H3NO 5AZIB 4H0VB 2A6AA 3FZLA 3IDHA 3FZHA 3SJHA 3GE1A 2E8AA 3IFRA 2E2PA 3CJBA 4BRAA 4BR4A 3C0BA 1GLJO 3HZ6A 3EO3A 4HWIA 3ENHA 4BRIA 5KPZA 1BWFO 2A41A 4IXCA 4PKHA 2P9UA 3O5BA 2FF3B 4H5RA 1MDUB 5KPTA 4L3QA 2BUPA 1GLCG 4IZ9A 4BGBA 2PBDA 3MDQA 3OHRA 4BRNA 3VF6A 3SMSA 1ATRA 4M7YA 3FZMA 3H1QA 3BUZB 5LY3A 3UKRB 2D0OA 4FOEA 2QXLA 4BQLA 3A5MC 3QFUA 4CD1A 3O80A 4AM6A 5AQPA 1K8KA 3M3ZA 4CZHA 2D0PA 4H0YB 5JICA 5KPRA 3FGUA 1NGGA 1S3XA 1LCUA 2P9SA 3QB0A 1DGKN 2IVPA 4FWNA 1GLEG 5I9EB 3U9DA 2IVNA 2QWLA 4CZJA 3J8AA 4MLEA 4BG9A 1RFQA 2FF6A 3ENOA 4IJAA 1HUXA 4BRCA 5AQIA 5AZJA 1GLAG 3LM9A 3RSEB 4A61A 3FLCO 3LDLA 1C0FA 2P9PB 1U2VA 3JXUA 5AQSA 3CIPA 2P9NB 1MWMA 1RDWX 2FSNA 3QDKA 1DEJA 3ZX3A 3FZKA 1QQMA 3QICA 3VEXA 4MO4A 4CBWA 2IIRA 4CJ7A 2E1YA 1NGFA 2A40A 2ZGZA 5AQXA 5FPMA 3G25A 3D2EA 2NZTA 1NLVA 4B1XB 4M63C 4ISEA 3ZETA 4BRLA 4BR2A 3D2FB 3UKUA 3GG4A 1HX1A 3FE1A 4BVPA 3HM8A 4FWMA 5F0XA 2D4WA 3O6WA 2P9KB 4B1WB 5BRDA 1TUYA 1Z6RA 3EL2A 3LDQA 2W40A 2VCPA 3UE5A 4K25A 4IWVA 1SZ2A 3CQYA 4H5WA 1QHAA 1TYQA 1LOTB 1NGHA 2V7ZA 4J8FA 1IJJA 5BRHA 1JCEA 4GNIA 3WXLA 1ATNA 4WQ5A 2YCHA 4CZIA 5JLFA 1T6DA 3ZX0A 3M6GA 4B1VA 4FWKA 4IO8A 4EIAA 1HKGA 2P9IA 4CD3A 4EAHD 4BRFA 1HLUA 2EWSA 2PAVA 4BVOA 3WEEA 2Q97A 3L6QA 5AZIA 3EKUA 2QW9A 1P8ZA 1S22A 1BU6O 4I6MB 1IG8A 2FSKA 5AQOA 4F9OA 3U4LA 4JD2A 1BG3A 3H1VX 1KAXA 2V7YA 3B8AX 4Y0WA 3P4IA 3HBTA 4RTFD 2QWMA 2CGLA 3LDNA 1KAYA 5AQRA 2OANA 2QWNA 1NBWA 4A62A 5ADXH 1V4TA 5BRFA 3WXKA 3C7NB 4IJNA 3VGMA 3DWLA 2FXUA 2Q0RA 2I7PA 5AFUH 1GLDG 1DKGD 2E20A 1NGCA 4QS8A 4BRDA 2P9LA 3VPZA 2E2OA 5AQMA 3DAWA 4PL8A 1TUUA 4DHYA 1JCFA 3VETA 2QWQA 2E2QA 2ASPA 4DQ8A 3A5OC 4BRMA 1XUPO 4WQ4A 3L4IA 4YDUA 3W0LA 4B1ZA 2HMPA 1QZ6A 3MMVA 1CZAN 1C0GA 1G99A 1HPMA 4ISFA 2V52B 3VEWA 2GELA 1V4SA 1YUWA 2F9WA 1BA0A 1ESVA 2GWJA 2P9UB 3CETA 4FSVA 3CJ9A 3L0QA 4BRQA 1NMDA 3R6MA 2ITMA 4BR9A 3M1FA 2E1ZA 3RSEA 3MCPA 4H0OA 2W41A 2ASOA 2D1KA 1NGDA 4PKIA 5LJWA 1JCGA 4QS9A 5F2RA 2YJFA 3DXMA 2P9PA 5BN9A 2P9NA 2DPNA 1NWKA 3A5LC 2CGJA 5CE3A 5ELZA 4BRGA 3CI5A 2VWBA 4B1YB 4E1JA 5EXWA 3W3DA 2KHOA 3CJ7A 3VEVA 3TPQA 3ULEB 3SLCA 5AQNA 2P9SB 3O1WA 4XH5A 2Q36A 3A8YA 3AY9A 4A2BA 5EOYA 1BUPA 5AQHA 4BG8A 2E88A 4CBXA 5JMVA 1RGIA 4BR0A 1Q18A 5AQQA 3D7EO 3D2FA 3GL1A 3VF2A 1HKCA 5AQVA 2YHYA 2Q1NA 2ZF5O 4CZKA 3ZEUB 1U6ZA 4BC3A 4JN4A 1E4GT 2P9KA 3HI0A 3S41A 4MO5A 4H0XB 3CHWA 3U9ZA 3LDPA 2NLXA 3LDOA 4JHDA 4XH4A 2GTDA 1Y64A 1GLLO 5AQUA 2IVOA 2I7NA 4HTLA 4FL9A 4H5VA 1BDGA 1YXQA 3WQTA 2VYPA 5AQGA 2YJEA 3EZWA 2A5XA 3D2EB 4AM7A 1QQOA 3WQUA 4B1UB 3WXIA 4NO7A 3VF4A 4CZFA 1R59O 4EHTA 3CJAA 5AQFA 2Q0UA 4BRKA 3LM2A 4I6MA 1NGJA 4XH1A 4BGAA 4H0PA 3KVGA 2AP1A 4BREA 2HF3A 1E4FT 3GOIA 3HTVA 3VEYA 2Q31A 2A3ZA 2HOEA 2YHXA 3QFPA 1NGEA 4FWOA 4FPAA 4BC2A 3QMLA 1OKJA 3H3OB 3QBXA 4WQ5C 3C7NA 5AQWA 4PL7A 1QZ5A 3VERA 1NGAA 1ATSA 5AQKA 1BA1A 3SMPA 2E2NA 2QWRA 4FO0A 3ATUA 3MN5A 3UKRA 4BC5A 1T44A 2BTFA 3A0IX 3DXKB 1NGBA 1GLBG 3KZBA 1QQNA 3FZFA 1BOTO 4JD2B 2FLOA 1GLFO 2H3GX 4H03B 4H0TB 4MLHA 3MN7A 4XEIA 4BRPA 4CZEA 2CH6A 3EN9A 3CJCA 5B8HA 3VENA 5KQDA 5BPMA 1T6CA 1ZXOA 1EQYA 1X3MA 1ZC6A 4WYBA 2V51B 3R8EA 5FPDA 4K43A 2CGKA 4CZMA 3VEZA 1WUAA 2P9LB 3DJCA 3ID8A 3WT0A 1X9JA 3QBWA 1YAGA 1BO5O 4RWTA 3VGLA 4WQ4C 2GUPA 4YDUC 2QWOA 1KXPA 4BROA 4A2AA 3FFKB 3ULEA 3IMXA 1D4XA 5BPLA 3A5NC 1HJOA 1ZBSA 1K8KB 4FWQA 4CZGA 4DB3A 5ADXA 5F1XA 3LL3A 2A42A 5AQYA 2AA4A 2UYTA 3ATVA 3VGKA 3JS6A 4BRHA 2GWKA 3VESA 3CJ1A 4ISGA 2J4RA 2ZGYA 5AFUA 4DCHA 3BP8A 3MK6A 1NGIA 2FSJA 3AARA 5BREA 3O1BA 3TU5A 4KBOA 3VOVA 4JNEA 3ZEUA 1WOQA 5AQLA 5BR9A 3I8BA 5EY4A 3WXJA 1YVNA 5BN8A 4LC9B 3DXMB 4Z94A 4H5NA 5AZJB 4FPBA 3IUCA 3H46O 4FWSA 1X3NA 5AR0A 3R9PA 2HF4A 1MA9B 4K41A 4O8KA 1U2VB 4QS7A 4PKGA 5LJVA 2QM1A
chains in the Genus database with same CATH superfamily
4JI7K 4AHRA 3AAPA 4JAXA 5AQJA 3VQ4A 3HRGA 3C6TA 4B3TK 1WSGA 4IKFA 1ASVA 4BQZA 4IDHA 4ILGB 4B9QA 1TL3A 4NB4A 2NRHA 3NGYA 3VTIA 1YIJN 3HSCA 4BY9C 5EVZA 1NM1A 1SL1A 2HHXA 5AQZA 4IO9L 1UOCA 4OVLA 2VQEK 3ZETB 2VQFK 3WUHA 3UKUB 4N56A 3UB5A 1QE1A 3KD5E 2P5OA 2GX9A 1SKRA 1IKWA 4A5BA 3VEOA 4DTJA 3CCVN 4DU4A 3QEXA 4KO0A 1D5AA 4FOIA 1JLEA 1XQSC 3V9SA 2Y1IA 1TYQB 3ZT3A 1VSIA 3I33A 2B4JA 4EHUA 1RDCA 4YOVA 3F9MA 3AVAA 1KRPA 3ALYA 4CHZA 4PQUA 4I2PA 2Z1IA 4G1QA 5T7BA 4UY8O 2NRTA 3DRRA 2P51A 3TTCA 5CR4A 2R7YA 3ZSQA 1D9FA 3MN9A 5M1KA 3TI0A 4FWRA 1RDBA 2A6AA 5CZ1A 4M3WA 2E2PA 1RT5A 1B92A 3HOSA 3CCMN 4IXCA 4PKHA 3V1OA 4B08A 4OLAA 3F73A 3TAPA 5KPTA 1EXQA 3SUPA 4L3QA 4DV2K 3SMSA 1VK0A 1ATRA 3G0ZA 3BUZB 2D0OA 3CPWM 3LP1A 5AQPA 1K8KA 3EY1A 1JKHA 2LSNA 5JICA 2IC3A 3PSIA 3OJSA 4RW8A 3FGUA 1NGGA 3BZCA 1S3XA 2A1RA 3MAQA 2P9SA 3QB0A 3PSFA 3T3FA 2D0CA 4FM1A 2Y1JA 2HBMA 2IVPA 2HHVA 1GLEG 5I9EB 3U9DA 1RT6A 4CZJA 2HVHA 1TKDA 1I3AA 3V9UA 1C0MA 1W97L 5AZJA 4AHTA 4GV3A 5JVHL 1SV5A 2RHKA 4A61A 3FLCO 3VQ6A 4BWMA 4FLWA 1BIZA 1RNHA 1U2VA 3JXUA 5AQSA 4YFUA 1N34K 4FXDA 2P5GA 2FSNA 1NOZA 2HHSA 1OH8A 4WE1A 1M1KO 2PYJA 3THYB 4O5BA 4CJ7A 1LWFA 2E1YA 3OYKA 4CJ3A 2O8EB 4U7BA 1KFSA 3SAGA 3ULDA 4FK4A 4NLBA 3ZETA 4MFBA 3UKUA 1HX1A 1VQ7N 3HM8A 1K9MO 2HHQA 4B1WB 1VSJA 3EL2A 4YOXA 3OW2M 4DTPA 3SQ2A 5KGXA 3WXMB 4H5WA 1U49A 1QHAA 1TYQA 5BRHA 1JCEA 4CGIA 3OYEA 4E1NA 4WQ5A 4JKGB 1TK5A 3M6GA 3IAYA 2F7TA 4FJMA 4Q5VA 4DF4A 3OA9A 4EIAA 3TAFA 3V1QA 4AHSA 4KPYA 1SKSA 3DOLA 1GOBA 4E89A 1S5JA 4IFVA 3KLFA 4JI1K 3L8BA 1S22A 1BU6O 4GW6A 3OYNA 4F9OA 3U4LA 3H1VX 1KAXA 5IWAK 1XI1A 3E66A 4RTFD 3V9WA 2QWMA 4W5NA 4K8ZA 1KAYA 5AQRA 3KKSA 3DI6A 1YJWN 1U45A 3BGRA 5ADXH 3T1HK 3J7YP 1U4BA 4Z4IA 1L3SA 4GV6A 2Q0RA 1T8EA 1QQCA 1RDAA 1WSJA 1NGCA 4QS8A 2RKIA 4JKDA 2E2OA 2OA8A 4GVMA 3VQBA 2HMIA 4N76A 1JCFA 3NAEA 4DTUA 4BE2A 4CJTA 4F2SA 4ISFA 3VEWA 3DLGA 3KK3A 4XIUA 2P9UB 3CETA 4O4GA 1TV6A 4N5SA 3CJ9A 3MX2A 4CJLA 3AO4A 3R6MA 3M1FA 4DF8A 4H0OA 2ASOA 2D1KA 3ID6A 2WOMA 3CPEA 1NWKA 3A5LC 1W7AA 4AHVA 2ZJRL 3P1GA 5CE3A 5ELZA 2VG7A 3T19A 4BRGA 2VWBA 4ZTFA 2YHAA 4Z0UA 5C24A 2KHOA 3CJ7A 1LW0A 3TPQA 3ULEB 3MEEA 5AQNA 4FVUA 3CF5L 2NRWA 4YOTA 3A8YA 1ZBLA 1BUPA 2OCEA 1RT3A 1ASUA 2E88A 5JMVA 3AA2A 3D7EO 1HKCA 5AQVA 3F9KA 2DY4A 4B9NA 3THVA 4DR2K 3L4QA 3OYAA 4BC3A 4JN4A 2X6SA 5CHIA 3VA3A 5JS1A 3HI0A 4K0KK 3S41A 4MO5A 3NH0A 1JLGA 1VSDA 2NLXA 4E7IA 4JHDA 2BGGA 2GTDA 1Y64A 1GOAA 2X74A 2KFNA 4DSFA 4KTQA 1RT7A 4KH4A 3NDKA 2IVOA 2I7NA 2JWLA 3Q7BA 4LF7K 1W9HA 4JI6K 4FJ8A 1BDGA 4CEOA 1WAJA 3ZLJA 4JKGA 4WFAL 1RDDA 1XWLA 4CJ4A 2A5XA 3D2EB 4B1UB 1S6PA 3CCEN 4CJ5A 4BRKA 3C95A 3AVGA 1KVAA 1NK0A 2ZM6K 4BGAA 4H0PA 4AF1A 2HF3A 2E4LA 3VQ8A 1NKCA 4JI2K 4K8XA 3KK2A 3MX5A 2YHXA 4LFCK 3MXIA 4FWOA 4FPAA 4WQ5C 3H3OB 3PLAA 4FJ9A 1RCHA 4HUGA 4KTZA 2KQ2A 1O1WA 1TGOA 4PWDA 5CZ2A 4IG0A 4Z4CA 4EZ9A 5AQKA 4CGHA 3THWA 3AA3A 2E2NA 1FK9A 4DFJA 1S1XA 4PUOA 3E01A 1S9EA 4UQGA 4CJVA 4HUEA 4JS4A 3KZBA 1JL1A 2ZE2A 1HYVA 3ZT2A 4KHQA 1BISA 3PUFA 1BOTO 4JD2B 2FLOA 3THXB 1GLFO 3LZJA 4H03B 4H0TB 3HP9A 2F96A 3CCLN 4WF9L 4CE9A 3CJCA 2VGNA 4PHTX 5B8HA 3VENA 1N32K 1T6CA 1ZXOA 3AVJA 3R8EA 3OYBA 2CGKA 4IDKA 1HYZA 1JXEA 4Z4GA 3DLLL 1NOYA 3V9XA 3WT0A 1X9JA 3QBWA 3M8QA 1BO5O 1QTMA 4JI8K 4WFNL 3S9HA 1C1AA 1XHZA 2G8HA 4A2AA 3ULEA 3IMXA 4FM0A 3U3YA 4ID1A 4DUYK 5BPLA 4FWQA 4CZGA 5ADXA 2DFHA 2AA4A 2UYTA 4BWJA 2OYQA 1SKWA 1VSKA 2HB5A 3CC4N 2RE2A 3OBYA 2FSJA 3AARA 1RBUA 3ZSVA 3TU5A 1NJWA 3VOVA 4LSNA 4JNEA 1IKVA 4DV6K 3I8BA 3HVRA 3BY5A 3TAMA 1VQ4N 3KTQA 4FVMA 4Z94A 4H5NA 4FPBA 3CCQN 2WC9A 5LMUK 3K5MA 3AGKA 2IDOA 1X3NA 3R9PA 4KHPK 2HF4A 3I8DA 4FLZA 4BACA 4W5TA 4I7FA 1UWBA 5LJVA 4M42A 2QM1A 4CIEA 4DTSA 2ZWHA 4O0IA 1LAVA 3O4WA 1KAZA 3CQ8A 4O44A 4K42A 2PZSA 1EKEA 2YNGA 3J80O 3P39A 2UXCK 1HRHA 3TANA 3BF3A 2YKMA 2YNFA 4CJPA 2CH5A 1XC3A 4FJXA 3AAQA 3L3VA 4CBUA 3GBTA 3HVTA 1Q86O 3T69A 4PA1A 3H45C 1C1BA 4B9UA 2E6MA 1QSLA 3L2UA 1MWKA 3CM5A 1UA1A 2XRIA 1BHLA 3O9UA 1W2BM 3G4SN 2YHWA 1QHTA 3D45A 4DSJA 4CEAA 4KB0A 4B3SK 1VAZA 4CVNE 4CW7B 5FPEA 1A5WA 4RW9A 3U8XA 1Q9XA 1HKBA 3SI6A 2P9IB 2WUSA 5KQ8A 1HNVA 4GY2B 2F9TA 2YI1A 3THXA 4BC4A 5AZIB 1XMQK 5M1QA 3FZLA 3IDHA 4DR6K 3FZHA 3BDPA 1TAQA 3RRHA 1ITGA 1JL2A 3CJBA 4IOXA 4BR4A 3C0BA 1VQON 1GLJO 4KFBA 4HWIA 3ENHA 4IEEA 1BWFO 2A41A 4H5RA 1GLCG 3CFRA 4Z4FA 3JYTA 3MDQA 3OHRA 5C42A 3TTDA 4CHOA 3O4QA 4BDPA 5LY3A 3UKRB 2QXLA 4CEZA 3O80A 5GIPA 3AO5A 1P90A 2D0PA 2YX6A 1LCUA 1K73O 4KTWA 1RBVA 4FWNA 1ASWA 3O9TA 2O8CA 2QWLA 1HPZA 2OZMA 1RFQA 2FF6A 3SUQA 1CXQA 3OS0A 3LPTA 3SUNA 3TAQA 1UA0A 4EP5A 3LM9A 3RSEB 5HRPA 3TABA 3U3GA 3OJUA 3NF9A 2P9PB 1HQUA 4FLYA 4OPAA 1MWMA 5GAHP 3QDKA 1QQMA 3NFAA 3VEXA 1JLFA 4CBWA 3CCRN 3OVNA 3OBWA 2IGIA 2A40A 4E7LA 2OZSA 5FPMA 1O13A 3PV8A 1EWQA 1NLVA 3HL8A 2FC0A 2F8SA 3SAHA 1C0TA 4ISEA 4BRLA 2IOCA 4BR2A 4Y1CA 3GG4A 4BVPA 2D4WA 3O6WA 4JKBA 4C1NK 2O8FB 1Z6RA 3LDQA 3QO9A 2VCPA 4JKFA 4IWVA 4FM2A 3C6AA 1SZ2A 4E19A 3CQYA 4CF9A 2B5JA 2GV9A 3OTOK 4X62K 2V7ZA 2VG5A 3WXLA 3VQQA 2YCHA 4CZIA 5HRSA 4J2DA 4NLCA 4B1VA 1RTIA 2G8UA 2I5JA 2P9IA 3DLBA 4E7HA 1OH6A 4KHYA 3T7ZA 3G6EN 4BVOA 3O3HA 3EYZA 3L6QA 5AZIA 3EKUA 3DMJA 4YNQA 4QAGA 2P1JA 2FSKA 1TVRA 1KC8O 1BG3A 1TKTA 3ITHA 3B8AX 2E6LA 4Y0WA 4DLEA 4FZXC 1VSFA 4YORA 2QWNA 3SBGA 3KK1A 3K9JA 1F21A 4A62A 4KB1A 1Z26A 5BRFA 4E3SA 4JI0K 1SS6A 3WXKA 5AJ3K 1YF5L 3VGMA 4AHCA 2HVIA 2FXUA 5AFUH 1GLDG 1C0UA 2ATQA 4OKEA 4E7JA 4BRDA 4FJGA 1TL1A 3AVLA 5HROA 3DAWA 4F4KA 1NG9A 2FBXA 4BDZA 1RT1A 3AVBA 3VETA 4R5PA 2BANA 1N36K 2HHUA 3NH2A 1S1VA 3A5OC 4LY7A 4YDUA 3W0LA 4FYDA 1XHXA 1QVGM 1C0GA 3CMAN 3CMEN 5JS2A 2GELA 5DMRA 1YUWA 5C2DA 2OTLN 1ESVA 3HPGA 1HNWK 4CJEA 1IV0A 4BR9A 2E1ZA 3RSEA 4NCBA 3MCPA 3AVCA 4PKIA 5LJWA 3KJVA 4E7KA 3DXMA 2P9PA 1WSFA 5BN9A 4R79A 3QEIA 5HOOA 1WSEA 2XY7A 2CGJA 3O4NA 2G8IA 1WN7A 4DFKA 3T1AA 1S1WA 4FJHA 3W3DA 4GMJB 5EXWA 1BIUA 3OY9A 3VQDA 4XH5A 1EETA 3AY9A 5EOYA 5AQHA 4CIFA 4CBXA 3NF6A 3LALA 1Q18A 3IKMA 2KZMA 4KI4A 4CESA 4CZKA 3SV3A 1BI4B 2QKBA 4DQPA 1SUQA 3JSMA 3RRGA 4LFAK 2O8FA 3OYLA 1WBBA 1YVUA 3U9ZA 3AVFA 2O4GA 1RTHA 3TTFA 4MDAA 4CJRA 3LWLA 4HTLA 1KSPA 3ASMA 4FL9A 4NYNA 1J5EK 4B9VA 3DYAA 1HR0K 1YXQA 2D0AA 2YJEA 1G15A 2HBJA 1IBMK 1CZ9A 5BR8K 5HLFA 3VQ9A 4NO7A 3O9RA 1S1TA 4CZFA 3SPZA 3CJAA 1NK8A 2PFUA 4B9MA 1NGJA 4XH1A 3RMBA 4BREA 3HM9A 1E4FT 1Q7YO 4Q0BA 3HTVA 4CJSA 2HHHK 4CCHA 3H08A 3V6DA 5M1OA 3QBXA 4FJJA 2OPPA 2YKNA 1ZBIA 4Y1DA 3OYFA 3PX0A 5AQWA 2UUBK 4PL7A 1VRTA 3VERA 1J53A 1ATSA 3CG7A 4DQSA 1VRUA 1N8RO 3SMPA 4FO0A 3ATUA 4NXNK 2BTFA 3A0IX 3DXKB 1NGBA 3HJFA 4CGJA 4L8RB 3C65A 2HHTA 2H3GX 3VTHA 5DM7L 2KLAA 3SZ2A 4AILC 1TAUA 3I56N 4TSXA 1NJIO 1RT2A 3ZSZA 4B9TA 1IG9A 1S9GA 3KK7A 4AHUA 3IRXA 3OYIA 1ZC6A 2AJQA 3J81O 3I55N 4CZMA 2P9LB 3ID8A 4ZHRA 4DV5K 3C6HA 1MU2A 1YAGA 4YDUC 1RILA 2QWOA 4LF9K 4H4OA 3LP2A 3FFKB 2JLEA 4FJ7A 3A5NC 1HJOA 1ZBSA 4DB3A 4HUFA 3KIOA 3WNGA 3LL3A 1NK7A 2VG6A 3THYA 4DQQA 2GWKA 5DK5A 1T7PA 3CJ1A 2XY6A 3DLKA 2J4RA 2ZGYA 3ENBA 5AFUA 1GOCA 3K0SA 1U48A 5HRRA 2O8EA 3MK6A 1NKBA 4CEEA 5BREA 3O1BA 4KBOA 2YHBA 5C10A 1BI4A 3AO2A 1JXBA 3QINA 5AQLA 5EY4A 1DTTA 5BR9A 4DQRA 4V19S 4HTUA 4LC9B 3K9KA 4DR5K 3V4IA 1DLOA 3CM6A 3QEPA 4JKHA 3DLRA 5LL6Z 2KFZA 5AR0A 3CC2N 1MA9B 4K41A 1N33K 4PKGA 4CD3A 2Z1GA 2EHGA 4W5OA 3EE9A 3V81A 4H8KA 3G10A 3KHYA 3A2FA 3BF1A 1VQNN 5JLHA 3CQXA 1OH7A 1WNSA 3QLHA 2GEMA 2XHBA 3AVNA 1JLQA 3H6EA 4FJIA 4DV7K 3KLIA 5AQTA 1J6ZA 3SQ0A 4MDBA 4EFHA 2ASMA 1BQMA 3NGZA 4IFYA 4BR7A 1Q82O 4GVEA 3PIOL 5FPNA 4BR5A 1S72N 5C15A 5J2MA 4DR4K 4DV0K 3LPUA 2WBNA 3BEXA 1LW2A 3KD1E 1RDUA 5KI6A 5H1SQ 3F2KA 1DTQA 3KKRA 4O5FA 4C23A 4H5TA 5HRNA 2QWPA 4RCHA 2Z1JA 4N47A 1NU0A 1WB9A 2Q2RA 3DXKA 3CERA 3TWHA 3N4PA 4FWPA 3L3UA 1HNZK 3H3NO 5CYMA 3MECA 3QETA 4CF2A 3SJHA 4DSEA 3GE1A 1JLCA 4BRAA 3QESA 3HZ6A 5KPZA 5HL7L 2P9UA 3O5BA 2RN2A 2FF3B 1MDUB 4CJWA 3IS9A 4JKEA 4FJNA 4JK8A 3QEVA 3T1YK 4C8LA 5C0YA 1KFDA 4IZ9A 4BGBA 4CFAA 2PBDA 3VF6A 4X66K 4IEIA 4ELTA 3H1QA 3N4QA 4FOEA 4BQLA 3A5MC 5GIOA 3NCIA 3M3ZA 4CZHA 4H0YB 3HOTA 3ZSXA 5GAEP 2UXDK 3QEWA 1IBKK 3ZSWA 1DGKN 5KRTA 3HP6A 4DTXA 3L2WA 1NK5A 3K57A 1KTQA 1SL2A 2IVNA 4F8RA 3J8AA 1KCFA 4IJAA 1HUXA 3OS2A 1XNQK 1GLAG 1NJZA 4IG3A 4FJKA 3LDLA 3AVKA 4FK0A 2RPIA 1C0FA 3SPYA 2FBYA 3SJJA 1ZBHA 2FBTA 1I94K 3CIPA 2P9NB 1RDWX 3ZX3A 3FZKA 3QICA 1ZYQA 1QSYA 1EX4A 4I9QA 4MO4A 4E0DA 1KD1O 2IIRA 2ZD1A 5I3UA 1SL0A 4FLVA 5AQXA 2ITGA 3WNHA 3D2EA 1CXUA 3KLEA 2NZTA 3NVMA 4RW7A 1A5XA 3OYMA 1NJXA 3J7ZO 2O8DB 3D2FB 3FE1A 1HMVA 4DFPA 5F0XA 5BRDA 3LP0A 5E41A 1X9SA 4HVJA 4OPHA 4KH6A 4ID5A 4FW1A 2KTQA 3MEGA 4Z4HA 1LOTB 4JI5K 4J8FA 1IJJA 4GNIA 3HT3A 2W6LA 3KLGA 1ATNA 5JLFA 4I2QA 3RR7A 1IKXA 2ZJQL 3CCUN 2FBVA 3AA4A 4BRFA 1VSEA 2EWSA 2PAVA 3TR8A 1DT9A 2QW9A 4M3UA 5C12A 4I6MB 4PY5A 4DWIA 1FJGK 4JD2A 3VA0A 3AO1A 2O4IA 4DR7K 3NF8A 3HBTA 3P4IA 4DUZK 4HCCA 1BGXT 2CGLA 2OANA 1NBWA 3HPOA 4O8UA 5I42A 3C7NB 3DWLA 2I7PA 4C8MA 4QOZB 2E20A 3VPZA 4CHQA 3J7AP 2GBZA 3K2PA 4PL8A 1I39A 3C94A 4O55A 3WNFA 4JS5A 2QWQA 2E2QA 4DQ8A 5M1PA 4BRMA 1XUPO 3L4IA 2DFFA 2ZJPL 3NH1A 2HNDA 2HSTA 2HMPA 1VSLA 1YT3A 1G99A 1HPMA 4CF0A 2V52B 3B6PA 1V4SA 3VN5A 4F3TA 4B3RK 4KHNA 2JWKA 4LF4K 5JVGL 3L0QA 1J54A 5HP1A 4DSIA 4BRQA 3SQ4A 3DM2A 2ITMA 4JYAK 2VWKA 3VQ7A 3CFOA 1NGDA 4QS9A 5F2RA 3O9SA 4LSLA 4LF5K 4BE0A 2P9NA 1C1CA 1J9AA 2OPQA 3R1XA 3V1RA 4A57A 3L2VA 3VEVA 4KHUA 3TSPA 2KKZA 2P9SB 3QERA 3O1WA 1ZBUA 4CJFA 4DTOA 1T3VA 2G8WA 4A2BA 4JKCA 4HCBA 4X64K 2G8VA 5FDLA 4OLBA 4G9ZA 4I9LA 4BR0A 3P38A 2YNHA 4M45A 5AQQA 3D2FA 3GL1A 3VF2A 4JRQA 1HYSA 4DU1A 2YHYA 1LV5A 2Q1NA 2YV0X 3OYHA 1U6ZA 3K59A 1XNRK 2BDPA 1KVBA 4H0XB 1VQ5N 3CHWA 3KWIA 1XC9A 4XH4A 3K58A 3VQPA 1GLLO 3ZSOA 5AQUA 1K8AO 4CJUA 4OPKA 4H5VA 4DTRA 4FCYA 3OYCA 2XY5A 1VQKN 4C8KA 4DU3A 4J2AA 1NK9A 1T05A 2VYPA 5AQGA 3DRSA 4BE1A 5D3GA 1UAXA 1VQ9N 1QQOA 3PY8A 5GADP 4DV1K 4KHSA 1R59O 3RMDA 1VQPN 3QIOA 4EHTA 4YHHK 1RBRA 2KW4A 5AQFA 4GV9A 2Q0UA 4I6MA 5DM6L 3TARA 2AP1A 3VQCA 3GOIA 2RF2A 3MCAB 3VEYA 4DS4A 1REVA 3RR8A 4OGEA 4KI6A 4IFEA 2DFEA 2A3ZA 2HOEA 3AVIA 4BC2A 3QMLA 1OKJA 4LF8K 4LH4A 4RG8A 3C7NA 4WFBL 2HNZA 3CFPA 2QA4N 1WLJA 1QZ5A 2BE2A 2WTUA 2A1SA 4FW2A 1FW6A 4OO1J 4CFCA 4OGCA 3AVMA 4JEPA 1LWEA 3RMAA 3VQEA 2X6NA 1IH7A 2QWRA 3UKRA 3CC7N 1W0HA 4MLHA 3TAEA 3MN7A 4XEIA 4B9SA 4BRPA 4U67L 2F8TA 4CFDA 4YOYA 1NKEA 5KQDA 1R0AA 5A2QO 4HHTA 4WYBA 5FPDA 4AQYK 4K43A 1RTDA 3EE8A 3DJCA 1NNEA 3LANA 5GAGP 1YTAA 2XO7A 4CK3A 4RWTA 3VGLA 3ZT4A 2GUPA 5CY4A 4BROA 3DLHA 1D4XA 3I0RA 3QNOA 1N6QA 5FRMA 1FXXA 5AQYA 3ATVA 3VGKA 2WONA 3JS6A 4BRHA 3JAMO 4JRPA 3P83D 4DCHA 3MWTA 4LH5A 1NGIA 4M3TA 4W5QA 1WOQA 1B9DA 3WXJA 3DRPA 5BN8A 4B8CA 3H46O 4OJRA 4CF1A 1QSSA 4FWSA 4FZZA 1T03A 1NK4A 4J2EA 4FLUA 3E9PA 3L2RA 4DSLA 3OYDA 3EKSA 3OYJA 3UIQA 1OVQA 5SZTA 3RVCA 2W6KA 2DTUA 4CGFA 1VQ8N 2HNYA 4FWLA 3GDQA 4OKKA 4CZLA 2VWJA 3PX6A 2HW3A 5BPNA 4FJLA 3NF7A 1NMNA 3ZSYA 1YITN 2Q3SA 2NRZA 3D6RA 2QEXN 2UUAK 5E26A 3NMUA 3MWPA 3FR0A 5E84A 1SAZA 2NRVA 4JHDB 1YTUA 3L2QA 3KLHA 5KGWA 4CI6A 5EX5A 3SK3A 3DLEA 3O8MA 4NCGA 3ZT1A 1H1VA 1L5UA 5TKYA 4CF8A 1SQKA 1X9MA 4KRFA 3ZX2A 1S1UA 3O3FA 1Z05A 3KWGA 1HJRA 4CEBA 3MN6A 1ILYA 4DTMA 4CEQA 3AVHA 1KLMA 4M7XA 3O08A 1OVYA 3WEEB 4GKKK 5J1EA 4QCLA 4H0VB 5M1NA 4KHWA 1VHXA 4H4MA 2JGUA 4RW4A 2HBKA 4KKOA 2E8AA 3IFRA 4DS5A 2IAJA 2F4VK 2KZZA 3QIPA 3EO3A 3ZT0A 4BRIA 3M8RA 1KQSM 4IOCL 4NYFA 4CECA 4DR3K 2BUPA 5SWMA 4Z4EA 1K6YA 4BRNA 3RWUA 4EZ6A 1J5OA 1KLNA 3THWB 4M7YA 4CHPA 3FZMA 2X78A 4JV5K 3QFUA 4CD1A 4KH5A 4AM6A 1IKYA 1Z25A 1S6QA 3K5NA 3NBPA 3M8SA 4BDYA 4B3MK 3HK2A 5KPRA 1X9WA 2UU9K 4B3OA 4CGDA 3P5JA 3M5RA 3LZIA 3TSUA 4C8NA 4N41A 1YJNN 3ZYYX 3SBTA 2ETJA 4M3ZA 3S3NA 1N5YA 4DMNA 4DLGA 1WBDA 4CFBA 4JK7A 3E9LA 4MLEA 4BG9A 5LMNK 3ENOA 1ZBFA 4BRCA 5AQIA 4CJQA 3CCSN 1JLAA 4CHNA 4O0JA 4JI4K 2QXFA 4MQ3A 1DEJA 1BL3A 5EU7A 4F2RA 4CJKA 1B9FA 3NHGA 1NGFA 2ZGZA 2OPSA 1CLQA 1JLBA 3G25A 1VSHA 4JKAA 3P31A 4M3RA 1RT4A 4B1XB 4M63C 1KVCA 3LWMA 2OPRA 1BCOA 3LP3A 2QI2A 4KAZA 4LD0A 4FWMA 2ZQBA 5TKWA 2P9KB 3SNNA 4J2BA 2O8BB 1U47A 1EO1A 1TUYA 1YJ9N 1FKOA 1WSIA 2W40A 4FLTA 3UE5A 4K25A 4B8AB 1BQNA 3O3GA 3MXJA 4JI3K 1JJ2M 1M90O 1VQMN 4KV8A 1TK0A 4W5RA 3VMFB 1NGHA 2VGMA 4DSKA 1TK8A 3F5TA 3MEDA 1T6DA 3ZX0A 2NUBA 4CEFA 4DKWA 3EZ5A 3AGRA 4FWKA 4IO8A 1WAFA 1HKGA 5FRNA 4EAHD 1HLUA 1L3UA 2WFBA 3WEEA 2Q97A 4IOAL 4CEDA 1P8ZA 3O9QA 1IG8A 4DG1A 5AQOA 3VQAA 2V7YA 1RBTA 3ISNC 3ZCMA 5FROA 1YHQN 4DR1K 4YOWA 3LDNA 4ICLA 3HYFA 4JLHA 1L3VA 1V4TA 2HBLA 4IJNA 2PYLA 5K14A 1WSHA 3OS1A 1DKGD 2IS3A 1CZBA 2P9LA 3VQ5A 1Q9YA 5AQMA 4ILHA 4A59A 1VQLN 1TUUA 4ELVA 4DHYA 3C6UA 5C2FA 3U6FA 5J2QA 2ASPA 4ILJA 4B1ZA 4WQ4A 1QZ6A 3MMVA 4C1NI 1CZAN 3LAMA 3AV9A 4LFBK 1TKZA 1BA0A 2F9WA 3LDSA 2GWJA 4NCAA 1IBLK 4FSVA 3M8PA 3SYZA 4DFMA 4NXMK 1NMDA 1HNXK 2W41A 3R3LA 1A5VA 1JCGA 1VSMA 2YJFA 3CD6N 3PO5A 2DPNA 4JK9A 3E9OA 3CI5A 4B1YB 4E1JA 4ZTJA 4M3YA 4A5AA 3K5OA 4CIGA 1E3MA 3SLCA 3HPHA 3CYMA 3K5LA 2D5RA 3D0PA 2Q36A 4LF6K 1QVFM 2YNIA 2HHWA 4CGGA 3V9ZA 1OH5A 3PX4A 4BG8A 2O8CB 1RGIA 2QTDA 3PO4A 2EX3A 3RMCA 2B6AA 1YI2N 1D9DA 4M3XA 2ZF5O 2G8FA 3LAKA 3ZEUB 2QK9A 5HBMA 4OX9K 4CK1A 1E4GT 2P9KA 3IG1A 2O8BA 1Q81O 1RTJA 5MLCQ 4EP4A 4FLXA 3LDPA 3LDOA 3QNNA 3E1YA 4E1MA 3MXMA 5KRSA 3OYGA 1EP4A 1X1PA 3BZKA 3B6OA 3PIPL 3SUOA 3NE6A 4FJ5A 3WQTA 2NRRA 3EZWA 3SV4A 4AM7A 4GKJK 3WQUA 1TKXA 1LWCA 4WCEL 3WXIA 3VF4A 2QKKA 1HQEA 2Z1HA 5GINA 3LM2A 4CERA 4DTNA 3KVGA 4FZYA 4AH9A 4FK2A 1D8YA 2Q31A 1RBSA 1VQ6N 1C6VA 3QFPA 1NGEA 5CYQA 2PY5A 2G8KA 3DOKA 1L3TA 2W42A 2UUCK 3SQ1A 4C8OA 1BCMA 4DQIA 1FKPA 1NGAA 4X65K 5KTQA 5J2NA 4IBNA 4KREA 1BA1A 3ZSRA 1LAWA 4B9LA 3FFIA 3MN5A 4BC5A 1T44A 1QS4A 1GLBG 3CCJN 4M41A 3AA5X 1QQNA 2GUIA 3FZFA 3S3OA 2OTJN 2D0BA 1EWRA 4CZEA 3AO3A 4YOUA 2CH6A 3EN9A 3RTVA 2NRXA 3HO1A 5BPMA 2XY8A 3NGIA 5IT9O 5C25A 1EQYA 1X3MA 1Y97A 3G71N 2V51B 3SCXA 4DV3K 1HNIA 3EEQA 3VEZA 1WUAA 4OKJA 3HSTB 3I0SA 4F3OA 3NVKA 4YY3K 5M1FA 4WQ4C 2NNWA 1KXPA 3Q7CA 1NJYA 1NK6A 1XMOK 5J2PA 1K8KB 3TAGA 5F1XA 2A42A 4CHYA 3VESA 1Q8IA 4ISGA 3TSQA 3SAFA 3CXCM 5FLXO 4CK2A 3BP8A 2UXBK 4DV4K 3S3MA 4ELUA 3ZEUA 2O8DA 4RW6A 3HXMA 2BH1A 1YVNA 1IO2A 3DXMB 5AZJB 4OPJA 3IUCA 2E5LK 1U04A 3WNEA 4O8KA 1U2VB 4QS7A
chains in the Genus database with same CATH topology
3EKSA 3AAPA 4JAXA 5AQJA 3EE9A 3HRGA 2ZWHA 3RVCA 3KHYA 3BF1A 4BQZA 1VQNN 5JLHA 3O4WA 3CQXA 1VQ8N 4IDHA 2GEMA 1KAZA 4FWLA 3GDQA 4CZLA 4K42A 4ILGB 4B9QA 3H6EA 2NRHA 3P39A 4NB4A 3VTIA 3HSCA 5BPNA 1YIJN 4BY9C 5EVZA 1NM1A 5AQTA 1J6ZA 3BF3A 5AQZA 4IO9L 2CH5A 1XC3A 1YITN 4MDBA 3AAQA 4EFHA 2ASMA 3ZETB 3WUHA 2NRZA 4BR7A 4CBUA 3D6RA 4GVEA 3UKUB 3UB5A 1Q82O 2QEXN 3GBTA 5E26A 3NMUA 3MWPA 5FPNA 4BR5A 3FR0A 3T69A 3PIOL 1S72N 5C15A 3H45C 5E84A 1Q86O 1SAZA 2NRVA 4JHDB 2GX9A 2WBNA 3BEXA 4A5BA 4CI6A 1RDUA 3VEOA 5H1SQ 1MWKA 5EX5A 3F2KA 3O8MA 3SK3A 3CCVN 1H1VA 4FOIA 5TKYA 3E9PA 1SQKA 1XQSC 3O9UA 1W2BM 3G4SN 4O5FA 3ZX2A 2YHWA 4C23A 1TYQB 4H5TA 3I33A 4EHUA 1Z05A 1VAZA 4YOVA 2QWPA 3F9MA 4RCHA 3KWGA 5FPEA 4UY8O 3MN6A 3U8XA 1HKBA 2Q2RA 3DXKA 2NRTA 3CERA 1ILYA 3TTCA 5CR4A 2WUSA 2P9IB 5KQ8A 3N4PA 4FWPA 2F9TA 2YI1A 4GY2B 4M7XA 3MN9A 5M1KA 4FWRA 3O08A 1OVYA 3WEEB 4BC4A 3H3NO 5AZIB 4H0VB 2A6AA 5M1NA 5M1QA 3FZLA 3IDHA 3FZHA 3SJHA 2HBKA 3GE1A 2E8AA 3IFRA 2E2PA 3CJBA 4BRAA 4IOXA 4BR4A 3C0BA 1VQON 1GLJO 3HOSA 3HZ6A 3EO3A 4HWIA 3ENHA 4IEEA 4BRIA 1BWFO 5KPZA 5HL7L 2A41A 4IXCA 3CCMN 4PKHA 2P9UA 3O5BA 4IOCL 1KQSM 2FF3B 4H5RA 1MDUB 5KPTA 4L3QA 4JKEA 2BUPA 4JK8A 1GLCG 5C0YA 4IZ9A 4BGBA 2PBDA 3MDQA 3OHRA 4BRNA 3VF6A 3TTDA 3SMSA 1ATRA 4M7YA 4IEIA 3FZMA 3H1QA 3BUZB 3N4QA 3UKRB 2D0OA 4FOEA 2QXLA 4BQLA 3A5MC 5LY3A 5GIOA 3QFUA 4CD1A 3CPWM 3O80A 4KH5A 5GIPA 4AM6A 5AQPA 1K8KA 3M3ZA 1P90A 4CZHA 2D0PA 4H0YB 5JICA 5KPRA 2YX6A 3HOTA 5GAEP 3FGUA 3M5RA 1NGGA 3TSUA 1S3XA 1YJNN 1LCUA 2P9SA 3QB0A 3ZYYX 1DGKN 1K73O 3SBTA 2HBMA 2IVPA 4FWNA 1GLEG 5I9EB 3U9DA 3O9TA 2IVNA 2QWLA 4CZJA 3J8AA 4JK7A 3E9LA 4MLEA 1RFQA 2FF6A 4BG9A 3ENOA 4IJAA 1HUXA 4BRCA 1W97L 5AQIA 5AZJA 1GLAG 3LM9A 4GV3A 3RSEB 5JVHL 2RHKA 3CCSN 4A61A 3FLCO 3LDLA 1C0FA 2P9PB 1U2VA 3JXUA 5AQSA 3CIPA 2P9NB 4OPAA 1MWMA 5GAHP 1RDWX 2FSNA 3QDKA 1DEJA 3ZX3A 3FZKA 1QQMA 3QICA 3VEXA 4MO4A 4CBWA 1KD1O 1M1KO 3CCRN 2IIRA 3OBWA 4CJ7A 2E1YA 1NGFA 2A40A 2ZGZA 5AQXA 5FPMA 1O13A 3G25A 3D2EA 4JKAA 2NZTA 1NLVA 3P31A 3NVMA 4B1XB 4U7BA 4M63C 3SAGA 3SAHA 4ISEA 4NLBA 3J7ZO 3ZETA 4BRLA 4BR2A 3D2FB 3UKUA 3GG4A 1HX1A 2QI2A 3FE1A 1VQ7N 4BVPA 3HM8A 1K9MO 4FWMA 5TKWA 5F0XA 2D4WA 3O6WA 2P9KB 4JKBA 4B1WB 4C1NK 5BRDA 3G71N 1EO1A 1TUYA 1YJ9N 1Z6RA 4KH6A 3EL2A 4OPHA 3LDQA 2W40A 2VCPA 4YOXA 3OW2M 3UE5A 4JKFA 4K25A 4IWVA 3C6AA 1SZ2A 1JJ2M 3CQYA 1M90O 1VQMN 3WXMB 4H5WA 1QHAA 1TYQA 3VMFB 1LOTB 1NGHA 2VGMA 2V7ZA 4J8FA 1IJJA 5BRHA 1JCEA 4GNIA 3WXLA 3F5TA 1ATNA 4WQ5A 2YCHA 4CZIA 5JLFA 1T6DA 4JKGB 3ZX0A 3M6GA 4DKWA 3AGRA 2F7TA 4NLCA 4B1VA 4FWKA 2ZJQL 4IO8A 3CCUN 3OA9A 4EIAA 1HKGA 2P9IA 4CD3A 4EAHD 4BRFA 1HLUA 3T7ZA 3G6EN 2EWSA 2WFBA 2PAVA 4BVOA 3WEEA 2Q97A 3L6QA 5AZIA 1DT9A 3EKUA 4IOAL 2QW9A 1P8ZA 1S22A 1BU6O 5C12A 3O9QA 4I6MB 1IG8A 2FSKA 5AQOA 4F9OA 3U4LA 1KC8O 4JD2A 1BG3A 3H1VX 1KAXA 2V7YA 3B8AX 4Y0WA 3P4IA 3HBTA 1YHQN 3E66A 4RTFD 2QWMA 2CGLA 4YOWA 3LDNA 1KAYA 4YORA 2OANA 2QWNA 5AQRA 3SBGA 3K9JA 1NBWA 1YJWN 4A62A 5ADXH 4O8UA 1V4TA 2HBLA 5BRFA 1SS6A 3C7NB 4IJNA 3WXKA 1YF5L 3VGMA 4GV6A 3DWLA 2FXUA 2Q0RA 2I7PA 5AFUH 1GLDG 1DKGD 2E20A 1NGCA 4QS8A 4BRDA 2P9LA 4JKDA 3VPZA 2E2OA 5AQMA 3DAWA 4ILHA 4PL8A 4A59A 1VQLN 1TUUA 4DHYA 5C2FA 1JCFA 3VETA 2QWQA 2E2QA 2ASPA 4DQ8A 3A5OC 4ILJA 5M1PA 4BRMA 1XUPO 4WQ4A 3L4IA 4YDUA 3W0LA 4B1ZA 2ZJPL 1QVGM 2HSTA 2HMPA 1QZ6A 3MMVA 4C1NI 1CZAN 1C0GA 3CMAN 1G99A 1HPMA 4ISFA 2V52B 3CMEN 3VEWA 2GELA 1V4SA 1YUWA 2F9WA 1BA0A 5C2DA 2OTLN 1ESVA 2GWJA 2JWKA 2P9UB 3CETA 5JVGL 4FSVA 3CJ9A 3MX2A 3L0QA 4BRQA 1NMDA 3R6MA 2ITMA 4BR9A 3M1FA 2E1ZA 3RSEA 3MCPA 4H0OA 2W41A 2ASOA 2D1KA 1NGDA 3R3LA 4PKIA 5LJWA 1JCGA 4QS9A 5F2RA 3ID6A 3O9SA 2YJFA 3DXMA 3CD6N 2P9PA 5BN9A 2P9NA 2DPNA 3CPEA 1NWKA 4R79A 5HOOA 3A5LC 3R1XA 2CGJA 2ZJRL 4JK9A 5CE3A 5ELZA 3E9OA 4BRGA 3CI5A 2VWBA 4B1YB 4E1JA 5EXWA 3W3DA 2KHOA 3CJ7A 3VEVA 4A5AA 4A57A 3TPQA 3ULEB 3SLCA 3TSPA 2KKZA 5AQNA 3CF5L 4FVUA 2P9SB 2NRWA 3O1WA 4XH5A 2Q36A 1T3VA 4YOTA 3A8YA 3AY9A 4A2BA 1QVFM 5EOYA 1BUPA 4JKCA 5AQHA 4BG8A 2E88A 4CBXA 4G9ZA 5JMVA 1RGIA 2QTDA 1Q18A 3P38A 4BR0A 3IKMA 5AQQA 3D2FA 3D7EO 3GL1A 3VF2A 1HKCA 5AQVA 1YI2N 2YHYA 2Q1NA 2ZF5O 4CZKA 3L4QA 3ZEUB 1U6ZA 4BC3A 4JN4A 5CHIA 1E4GT 2P9KA 3HI0A 1Q81O 3S41A 4MO5A 4H0XB 1VQ5N 5MLCQ 3CHWA 3KWIA 3U9ZA 3LDPA 2NLXA 3LDOA 4JHDA 3TTFA 3E1YA 4XH4A 2GTDA 1Y64A 1GLLO 4MDAA 5AQUA 4KH4A 2IVOA 2I7NA 1K8AO 4HTLA 2JWLA 3Q7BA 4FL9A 4H5VA 3PIPL 1BDGA 1VQKN 1YXQA 3WQTA 2VYPA 4JKGA 4WFAL 2NRRA 5AQGA 2YJEA 2HBJA 3EZWA 2A5XA 3D2EB 4AM7A 1QQOA 1VQ9N 3WQUA 5GADP 4B1UB 4WCEL 3WXIA 4NO7A 3VF4A 3O9RA 4CZFA 1R59O 1VQPN 4EHTA 3CJAA 3CCEN 5AQFA 2PFUA 4GV9A 5GINA 2Q0UA 4BRKA 3LM2A 4I6MA 1NGJA 4XH1A 4BGAA 4H0PA 3KVGA 2AP1A 4AF1A 4BREA 5DM6L 2HF3A 1E4FT 1Q7YO 3GOIA 3HTVA 3MCAB 3VEYA 2Q31A 4IFEA 2A3ZA 2HOEA 2YHXA 3MX5A 1VQ6N 3QFPA 1NGEA 4FWOA 4FPAA 4BC2A 3QMLA 1OKJA 3H3OB 3QBXA 4WQ5C 5M1OA 3PLAA 3C7NA 4WFBL 2QA4N 5AQWA 4PL7A 1QZ5A 3VERA 4OO1J 1NGAA 1ATSA 4JEPA 5AQKA 1N8RO 1BA1A 3SMPA 2E2NA 2QWRA 4FO0A 3ATUA 3MN5A 3UKRA 4BC5A 1T44A 2BTFA 3A0IX 3DXKB 1NGBA 3CC7N 1GLBG 3CCJN 3KZBA 1QQNA 3FZFA 3C65A 1BOTO 4JD2B 2FLOA 1GLFO 2H3GX 2OTJN 4H03B 4H0TB 4MLHA 3MN7A 4XEIA 3CCLN 3VTHA 4BRPA 4CZEA 2KLAA 4U67L 5DM7L 4WF9L 4YOUA 2CH6A 3EN9A 3CJCA 2VGNA 4PHTX 2NRXA 3I56N 4YOYA 1NJIO 5B8HA 3VENA 5KQDA 5BPMA 1T6CA 3KK7A 1ZXOA 1EQYA 1X3MA 1ZC6A 4WYBA 2V51B 3R8EA 5FPDA 4K43A 2CGKA 3I55N 4CZMA 3VEZA 1WUAA 3EE8A 3DLLL 2P9LB 3DJCA 3ID8A 3WT0A 1X9JA 3C6HA 3QBWA 5GAGP 3NVKA 1YAGA 1BO5O 4RWTA 3VGLA 5M1FA 4WQ4C 2GUPA 4YDUC 2NNWA 2QWOA 4WFNL 1KXPA 4BROA 3Q7CA 4A2AA 3FFKB 3ULEA 3IMXA 1D4XA 5BPLA 3A5NC 1HJOA 1ZBSA 1K8KB 4FWQA 4CZGA 4DB3A 5ADXA 5F1XA 3LL3A 2A42A 5AQYA 2AA4A 2UYTA 3ATVA 3VGKA 3JS6A 4BRHA 2GWKA 3VESA 3CJ1A 4ISGA 3TSQA 2J4RA 2ZGYA 3ENBA 5AFUA 3SAFA 3CXCM 3CC4N 4DCHA 3MWTA 2RE2A 3BP8A 3MK6A 1NGIA 3OBYA 2FSJA 3AARA 5BREA 3O1BA 3TU5A 4KBOA 3VOVA 4JNEA 3ZEUA 5C10A 1WOQA 5AQLA 5BR9A 3I8BA 5EY4A 3WXJA 2BH1A 1YVNA 5BN8A 1VQ4N 4LC9B 3DXMB 3K9KA 4Z94A 4H5NA 5AZJB 4FPBA 3CCQN 2WC9A 3IUCA 3AGKA 3H46O 4JKHA 4FWSA 1X3NA 5AR0A 3R9PA 3CC2N 2HF4A 1MA9B 4K41A 4O8KA 1U2VB 4QS7A 4PKGA 5LJVA 2QM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKS A;  3AAP A;  4JAX A;  5AQJ A;  2ZWH A;  3KHY A;  3BF1 A;  4BQZ A;  5JLH A;  3O4W A;  3CQX A;  2GEM A;  1KAZ A;  4FWL A;  3GDQ A;  4CZL A;  4K42 A;  4B9Q A;  3H6E A;  2NRH A;  4NB4 A;  5BPN A;  3HSC A;  5EVZ A;  1NM1 A;  5AQT A;  1J6Z A;  3BF3 A;  5AQZ A;  2CH5 A;  1XC3 A;  4EFH A;  3AAQ A;  2ASM A;  3ZET B;  3WUH A;  4BR7 A;  4CBU A;  3UKU B;  3UB5 A;  3GBT A;  5E26 A;  5FPN A;  4BR5 A;  3FR0 A;  3H45 C;  5E84 A;  1SAZ A;  4JHD B;  3BEX A;  4CI6 A;  3VEO A;  1MWK A;  5EX5 A;  3SK3 A;  3O8M A;  1H1V A;  4FOI A;  5TKY A;  1SQK A;  1XQS C;  4O5F A;  3ZX2 A;  2YHW A;  4C23 A;  1TYQ B;  4H5T A;  3I33 A;  4EHU A;  1Z05 A;  2QWP A;  3F9M A;  4RCH A;  5FPE A;  3MN6 A;  3U8X A;  1HKB A;  2Q2R A;  3DXK A;  3CER A;  2WUS A;  2P9I B;  5KQ8 A;  4FWP A;  4GY2 B;  2F9T A;  2YI1 A;  4M7X A;  3MN9 A;  4FWR A;  3O08 A;  3WEE B;  4BC4 A;  3H3N O;  5AZI B;  4H0V B;  2A6A A;  3FZL A;  3IDH A;  3FZH A;  3SJH A;  3GE1 A;  2E8A A;  3IFR A;  2E2P A;  3CJB A;  4BRA A;  4BR4 A;  3C0B A;  1GLJ O;  3HZ6 A;  3EO3 A;  4HWI A;  3ENH A;  4BRI A;  5KPZ A;  1BWF O;  2A41 A;  4IXC A;  4PKH A;  2P9U A;  3O5B A;  2FF3 B;  4H5R A;  1MDU B;  5KPT A;  4L3Q A;  2BUP A;  1GLC G;  4IZ9 A;  4BGB A;  2PBD A;  3MDQ A;  3OHR A;  4BRN A;  3VF6 A;  3SMS A;  1ATR A;  4M7Y A;  3FZM A;  3H1Q A;  3BUZ B;  5LY3 A;  3UKR B;  2D0O A;  4FOE A;  2QXL A;  4BQL A;  3A5M C;  3QFU A;  4CD1 A;  3O80 A;  4AM6 A;  5AQP A;  1K8K A;  3M3Z A;  4CZH A;  2D0P A;  4H0Y B;  5JIC A;  5KPR A;  3FGU A;  1NGG A;  1S3X A;  1LCU A;  2P9S A;  3QB0 A;  1DGK N;  2IVP A;  4FWN A;  1GLE G;  5I9E B;  3U9D A;  2IVN A;  2QWL A;  4CZJ A;  3J8A A;  4MLE A;  4BG9 A;  1RFQ A;  2FF6 A;  3ENO A;  4IJA A;  1HUX A;  4BRC A;  5AQI A;  5AZJ A;  1GLA G;  3LM9 A;  3RSE B;  4A61 A;  3FLC O;  3LDL A;  1C0F A;  2P9P B;  1U2V A;  3JXU A;  5AQS A;  3CIP A;  2P9N B;  1MWM A;  1RDW X;  2FSN A;  3QDK A;  1DEJ A;  3ZX3 A;  3FZK A;  1QQM A;  3QIC A;  3VEX A;  4MO4 A;  4CBW A;  2IIR A;  4CJ7 A;  2E1Y A;  1NGF A;  2A40 A;  2ZGZ A;  5AQX A;  5FPM A;  3G25 A;  3D2E A;  2NZT A;  1NLV A;  4B1X B;  4M63 C;  4ISE A;  3ZET A;  4BRL A;  4BR2 A;  3D2F B;  3UKU A;  3GG4 A;  1HX1 A;  3FE1 A;  4BVP A;  3HM8 A;  4FWM A;  5F0X A;  2D4W A;  3O6W A;  2P9K B;  4B1W B;  5BRD A;  1TUY A;  1Z6R A;  3EL2 A;  3LDQ A;  2W40 A;  2VCP A;  3UE5 A;  4K25 A;  4IWV A;  1SZ2 A;  3CQY A;  4H5W A;  1QHA A;  1TYQ A;  1LOT B;  1NGH A;  2V7Z A;  4J8F A;  1IJJ A;  5BRH A;  1JCE A;  4GNI A;  3WXL A;  1ATN A;  4WQ5 A;  2YCH A;  4CZI A;  5JLF A;  1T6D A;  3ZX0 A;  3M6G A;  4B1V A;  4FWK A;  4IO8 A;  4EIA A;  1HKG A;  2P9I A;  4CD3 A;  4EAH D;  4BRF A;  1HLU A;  2EWS A;  2PAV A;  4BVO A;  3WEE A;  2Q97 A;  3L6Q A;  5AZI A;  3EKU A;  2QW9 A;  1P8Z A;  1S22 A;  1BU6 O;  4I6M B;  1IG8 A;  2FSK A;  5AQO A;  4F9O A;  3U4L A;  4JD2 A;  1BG3 A;  3H1V X;  1KAX A;  2V7Y A;  3B8A X;  4Y0W A;  3P4I A;  3HBT A;  4RTF D;  2QWM A;  2CGL A;  3LDN A;  1KAY A;  5AQR A;  2OAN A;  2QWN A;  1NBW A;  4A62 A;  5ADX H;  1V4T A;  5BRF A;  3WXK A;  3C7N B;  4IJN A;  3VGM A;  3DWL A;  2FXU A;  2Q0R A;  2I7P A;  5AFU H;  1GLD G;  1DKG D;  2E20 A;  1NGC A;  4QS8 A;  4BRD A;  2P9L A;  3VPZ A;  2E2O A;  5AQM A;  3DAW A;  4PL8 A;  1TUU A;  4DHY A;  1JCF A;  3VET A;  2QWQ A;  2E2Q A;  2ASP A;  4DQ8 A;  3A5O C;  4BRM A;  1XUP O;  4WQ4 A;  3L4I A;  4YDU A;  3W0L A;  4B1Z A;  2HMP A;  1QZ6 A;  3MMV A;  1CZA N;  1C0G A;  1G99 A;  1HPM A;  4ISF A;  2V52 B;  3VEW A;  2GEL A;  1V4S A;  1YUW A;  2F9W A;  1BA0 A;  1ESV A;  2GWJ A;  2P9U B;  3CET A;  4FSV A;  3CJ9 A;  3L0Q A;  4BRQ A;  1NMD A;  3R6M A;  2ITM A;  4BR9 A;  3M1F A;  2E1Z A;  3RSE A;  3MCP A;  4H0O A;  2W41 A;  2ASO A;  2D1K A;  1NGD A;  4PKI A;  5LJW A;  1JCG A;  4QS9 A;  5F2R A;  2YJF A;  3DXM A;  2P9P A;  5BN9 A;  2P9N A;  2DPN A;  1NWK A;  3A5L C;  2CGJ A;  5CE3 A;  5ELZ A;  4BRG A;  3CI5 A;  2VWB A;  4B1Y B;  4E1J A;  5EXW A;  3W3D A;  2KHO A;  3CJ7 A;  3VEV A;  3TPQ A;  3ULE B;  3SLC A;  5AQN A;  2P9S B;  3O1W A;  4XH5 A;  2Q36 A;  3A8Y A;  3AY9 A;  4A2B A;  5EOY A;  1BUP A;  5AQH A;  4BG8 A;  2E88 A;  4CBX A;  5JMV A;  1RGI A;  4BR0 A;  1Q18 A;  5AQQ A;  3D7E O;  3D2F A;  3GL1 A;  3VF2 A;  1HKC A;  5AQV A;  2YHY A;  2Q1N A;  2ZF5 O;  4CZK A;  3ZEU B;  1U6Z A;  4BC3 A;  4JN4 A;  1E4G T;  2P9K A;  3HI0 A;  3S41 A;  4MO5 A;  4H0X B;  3CHW A;  3U9Z A;  3LDP A;  2NLX A;  3LDO A;  4JHD A;  4XH4 A;  2GTD A;  1Y64 A;  1GLL O;  5AQU A;  2IVO A;  2I7N A;  4HTL A;  4FL9 A;  4H5V A;  1BDG A;  1YXQ A;  3WQT A;  2VYP A;  5AQG A;  2YJE A;  3EZW A;  2A5X A;  3D2E B;  4AM7 A;  1QQO A;  3WQU A;  4B1U B;  3WXI A;  4NO7 A;  3VF4 A;  4CZF A;  1R59 O;  4EHT A;  3CJA A;  5AQF A;  2Q0U A;  4BRK A;  3LM2 A;  4I6M A;  1NGJ A;  4XH1 A;  4BGA A;  4H0P A;  3KVG A;  2AP1 A;  4BRE A;  2HF3 A;  1E4F T;  3GOI A;  3HTV A;  3VEY A;  2Q31 A;  2A3Z A;  2HOE A;  2YHX A;  3QFP A;  1NGE A;  4FWO A;  4FPA A;  4BC2 A;  3QML A;  1OKJ A;  3H3O B;  3QBX A;  4WQ5 C;  3C7N A;  5AQW A;  4PL7 A;  1QZ5 A;  3VER A;  1NGA A;  1ATS A;  5AQK A;  1BA1 A;  3SMP A;  2E2N A;  2QWR A;  4FO0 A;  3ATU A;  3MN5 A;  3UKR A;  4BC5 A;  1T44 A;  2BTF A;  3A0I X;  3DXK B;  1NGB A;  1GLB G;  3KZB A;  1QQN A;  3FZF A;  1BOT O;  4JD2 B;  2FLO A;  1GLF O;  2H3G X;  4H03 B;  4H0T B;  4MLH A;  3MN7 A;  4XEI A;  4BRP A;  4CZE A;  2CH6 A;  3EN9 A;  3CJC A;  5B8H A;  3VEN A;  5KQD A;  5BPM A;  1T6C A;  1ZXO A;  1EQY A;  1X3M A;  1ZC6 A;  4WYB A;  2V51 B;  3R8E A;  5FPD A;  4K43 A;  2CGK A;  4CZM A;  3VEZ A;  1WUA A;  2P9L B;  3DJC A;  3ID8 A;  3WT0 A;  1X9J A;  3QBW A;  1YAG A;  1BO5 O;  4RWT A;  3VGL A;  4WQ4 C;  2GUP A;  4YDU C;  2QWO A;  1KXP A;  4BRO A;  4A2A A;  3FFK B;  3ULE A;  3IMX A;  1D4X A;  5BPL A;  3A5N C;  1HJO A;  1ZBS A;  1K8K B;  4FWQ A;  4CZG A;  4DB3 A;  5ADX A;  5F1X A;  3LL3 A;  2A42 A;  5AQY A;  2AA4 A;  2UYT A;  3ATV A;  3VGK A;  3JS6 A;  4BRH A;  2GWK A;  3VES A;  3CJ1 A;  4ISG A;  2J4R A;  2ZGY A;  5AFU A;  4DCH A;  3BP8 A;  3MK6 A;  1NGI A;  2FSJ A;  3AAR A;  5BRE A;  3O1B A;  3TU5 A;  4KBO A;  3VOV A;  4JNE A;  3ZEU A;  1WOQ A;  5AQL A;  5BR9 A;  3I8B A;  5EY4 A;  3WXJ A;  1YVN A;  5BN8 A;  4LC9 B;  3DXM B;  4Z94 A;  4H5N A;  5AZJ B;  4FPB A;  3IUC A;  3H46 O;  4FWS A;  1X3N A;  5AR0 A;  3R9P A;  2HF4 A;  1MA9 B;  4K41 A;  4O8K A;  1U2V B;  4QS7 A;  4PKG A;  5LJV A;  2QM1 A; 
#chains in the Genus database with same CATH topology
 4JI7 K;  4AHR A;  3AAP A;  4JAX A;  5AQJ A;  3VQ4 A;  3HRG A;  3C6T A;  4B3T K;  1WSG A;  4IKF A;  1ASV A;  4BQZ A;  4IDH A;  4ILG B;  4B9Q A;  1TL3 A;  4NB4 A;  2NRH A;  3NGY A;  3VTI A;  1YIJ N;  3HSC A;  4BY9 C;  5EVZ A;  1NM1 A;  1SL1 A;  2HHX A;  5AQZ A;  4IO9 L;  1UOC A;  4OVL A;  2VQE K;  3ZET B;  2VQF K;  3WUH A;  3UKU B;  4N56 A;  3UB5 A;  1QE1 A;  3KD5 E;  2P5O A;  2GX9 A;  1SKR A;  1IKW A;  4A5B A;  3VEO A;  4DTJ A;  3CCV N;  4DU4 A;  3QEX A;  4KO0 A;  1D5A A;  4FOI A;  1JLE A;  1XQS C;  3V9S A;  2Y1I A;  1TYQ B;  3ZT3 A;  1VSI A;  3I33 A;  2B4J A;  4EHU A;  1RDC A;  4YOV A;  3F9M A;  3AVA A;  1KRP A;  3ALY A;  4CHZ A;  4PQU A;  4I2P A;  2Z1I A;  4G1Q A;  5T7B A;  4UY8 O;  2NRT A;  3DRR A;  2P51 A;  3TTC A;  5CR4 A;  2R7Y A;  3ZSQ A;  1D9F A;  3MN9 A;  5M1K A;  3TI0 A;  4FWR A;  1RDB A;  2A6A A;  5CZ1 A;  4M3W A;  2E2P A;  1RT5 A;  1B92 A;  3HOS A;  3CCM N;  4IXC A;  4PKH A;  3V1O A;  4B08 A;  4OLA A;  3F73 A;  3TAP A;  5KPT A;  1EXQ A;  3SUP A;  4L3Q A;  4DV2 K;  3SMS A;  1VK0 A;  1ATR A;  3G0Z A;  3BUZ B;  2D0O A;  3CPW M;  3LP1 A;  5AQP A;  1K8K A;  3EY1 A;  1JKH A;  2LSN A;  5JIC A;  2IC3 A;  3PSI A;  3OJS A;  4RW8 A;  3FGU A;  1NGG A;  3BZC A;  1S3X A;  2A1R A;  3MAQ A;  2P9S A;  3QB0 A;  3PSF A;  3T3F A;  2D0C A;  4FM1 A;  2Y1J A;  2HBM A;  2IVP A;  2HHV A;  1GLE G;  5I9E B;  3U9D A;  1RT6 A;  4CZJ A;  2HVH A;  1TKD A;  1I3A A;  3V9U A;  1C0M A;  1W97 L;  5AZJ A;  4AHT A;  4GV3 A;  5JVH L;  1SV5 A;  2RHK A;  4A61 A;  3FLC O;  3VQ6 A;  4BWM A;  4FLW A;  1BIZ A;  1RNH A;  1U2V A;  3JXU A;  5AQS A;  4YFU A;  1N34 K;  4FXD A;  2P5G A;  2FSN A;  1NOZ A;  2HHS A;  1OH8 A;  4WE1 A;  1M1K O;  2PYJ A;  3THY B;  4O5B A;  4CJ7 A;  1LWF A;  2E1Y A;  3OYK A;  4CJ3 A;  2O8E B;  4U7B A;  1KFS A;  3SAG A;  3ULD A;  4FK4 A;  4NLB A;  3ZET A;  4MFB A;  3UKU A;  1HX1 A;  1VQ7 N;  3HM8 A;  1K9M O;  2HHQ A;  4B1W B;  1VSJ A;  3EL2 A;  4YOX A;  3OW2 M;  4DTP A;  3SQ2 A;  5KGX A;  3WXM B;  4H5W A;  1U49 A;  1QHA A;  1TYQ A;  5BRH A;  1JCE A;  4CGI A;  3OYE A;  4E1N A;  4WQ5 A;  4JKG B;  1TK5 A;  3M6G A;  3IAY A;  2F7T A;  4FJM A;  4Q5V A;  4DF4 A;  3OA9 A;  4EIA A;  3TAF A;  3V1Q A;  4AHS A;  4KPY A;  1SKS A;  3DOL A;  1GOB A;  4E89 A;  1S5J A;  4IFV A;  3KLF A;  4JI1 K;  3L8B A;  1S22 A;  1BU6 O;  4GW6 A;  3OYN A;  4F9O A;  3U4L A;  3H1V X;  1KAX A;  5IWA K;  1XI1 A;  3E66 A;  4RTF D;  3V9W A;  2QWM A;  4W5N A;  4K8Z A;  1KAY A;  5AQR A;  3KKS A;  3DI6 A;  1YJW N;  1U45 A;  3BGR A;  5ADX H;  3T1H K;  3J7Y P;  1U4B A;  4Z4I A;  1L3S A;  4GV6 A;  2Q0R A;  1T8E A;  1QQC A;  1RDA A;  1WSJ A;  1NGC A;  4QS8 A;  2RKI A;  4JKD A;  2E2O A;  2OA8 A;  4GVM A;  3VQB A;  2HMI A;  4N76 A;  1JCF A;  3NAE A;  4DTU A;  4BE2 A;  4CJT A;  4F2S A;  4ISF A;  3VEW A;  3DLG A;  3KK3 A;  4XIU A;  2P9U B;  3CET A;  4O4G A;  1TV6 A;  4N5S A;  3CJ9 A;  3MX2 A;  4CJL A;  3AO4 A;  3R6M A;  3M1F A;  4DF8 A;  4H0O A;  2ASO A;  2D1K A;  3ID6 A;  2WOM A;  3CPE A;  1NWK A;  3A5L C;  1W7A A;  4AHV A;  2ZJR L;  3P1G A;  5CE3 A;  5ELZ A;  2VG7 A;  3T19 A;  4BRG A;  2VWB A;  4ZTF A;  2YHA A;  4Z0U A;  5C24 A;  2KHO A;  3CJ7 A;  1LW0 A;  3TPQ A;  3ULE B;  3MEE A;  5AQN A;  4FVU A;  3CF5 L;  2NRW A;  4YOT A;  3A8Y A;  1ZBL A;  1BUP A;  2OCE A;  1RT3 A;  1ASU A;  2E88 A;  5JMV A;  3AA2 A;  3D7E O;  1HKC A;  5AQV A;  3F9K A;  2DY4 A;  4B9N A;  3THV A;  4DR2 K;  3L4Q A;  3OYA A;  4BC3 A;  4JN4 A;  2X6S A;  5CHI A;  3VA3 A;  5JS1 A;  3HI0 A;  4K0K K;  3S41 A;  4MO5 A;  3NH0 A;  1JLG A;  1VSD A;  2NLX A;  4E7I A;  4JHD A;  2BGG A;  2GTD A;  1Y64 A;  1GOA A;  2X74 A;  2KFN A;  4DSF A;  4KTQ A;  1RT7 A;  4KH4 A;  3NDK A;  2IVO A;  2I7N A;  2JWL A;  3Q7B A;  4LF7 K;  1W9H A;  4JI6 K;  4FJ8 A;  1BDG A;  4CEO A;  1WAJ A;  3ZLJ A;  4JKG A;  4WFA L;  1RDD A;  1XWL A;  4CJ4 A;  2A5X A;  3D2E B;  4B1U B;  1S6P A;  3CCE N;  4CJ5 A;  4BRK A;  3C95 A;  3AVG A;  1KVA A;  1NK0 A;  2ZM6 K;  4BGA A;  4H0P A;  4AF1 A;  2HF3 A;  2E4L A;  3VQ8 A;  1NKC A;  4JI2 K;  4K8X A;  3KK2 A;  3MX5 A;  2YHX A;  4LFC K;  3MXI A;  4FWO A;  4FPA A;  4WQ5 C;  3H3O B;  3PLA A;  4FJ9 A;  1RCH A;  4HUG A;  4KTZ A;  2KQ2 A;  1O1W A;  1TGO A;  4PWD A;  5CZ2 A;  4IG0 A;  4Z4C A;  4EZ9 A;  5AQK A;  4CGH A;  3THW A;  3AA3 A;  2E2N A;  1FK9 A;  4DFJ A;  1S1X A;  4PUO A;  3E01 A;  1S9E A;  4UQG A;  4CJV A;  4HUE A;  4JS4 A;  3KZB A;  1JL1 A;  2ZE2 A;  1HYV A;  3ZT2 A;  4KHQ A;  1BIS A;  3PUF A;  1BOT O;  4JD2 B;  2FLO A;  3THX B;  1GLF O;  3LZJ A;  4H03 B;  4H0T B;  3HP9 A;  2F96 A;  3CCL N;  4WF9 L;  4CE9 A;  3CJC A;  2VGN A;  4PHT X;  5B8H A;  3VEN A;  1N32 K;  1T6C A;  1ZXO A;  3AVJ A;  3R8E A;  3OYB A;  2CGK A;  4IDK A;  1HYZ A;  1JXE A;  4Z4G A;  3DLL L;  1NOY A;  3V9X A;  3WT0 A;  1X9J A;  3QBW A;  3M8Q A;  1BO5 O;  1QTM A;  4JI8 K;  4WFN L;  3S9H A;  1C1A A;  1XHZ A;  2G8H A;  4A2A A;  3ULE A;  3IMX A;  4FM0 A;  3U3Y A;  4ID1 A;  4DUY K;  5BPL A;  4FWQ A;  4CZG A;  5ADX A;  2DFH A;  2AA4 A;  2UYT A;  4BWJ A;  2OYQ A;  1SKW A;  1VSK A;  2HB5 A;  3CC4 N;  2RE2 A;  3OBY A;  2FSJ A;  3AAR A;  1RBU A;  3ZSV A;  3TU5 A;  1NJW A;  3VOV A;  4LSN A;  4JNE A;  1IKV A;  4DV6 K;  3I8B A;  3HVR A;  3BY5 A;  3TAM A;  1VQ4 N;  3KTQ A;  4FVM A;  4Z94 A;  4H5N A;  4FPB A;  3CCQ N;  2WC9 A;  5LMU K;  3K5M A;  3AGK A;  2IDO A;  1X3N A;  3R9P A;  4KHP K;  2HF4 A;  3I8D A;  4FLZ A;  4BAC A;  4W5T A;  4I7F A;  1UWB A;  5LJV A;  4M42 A;  2QM1 A;  4CIE A;  4DTS A;  2ZWH A;  4O0I A;  1LAV A;  3O4W A;  1KAZ A;  3CQ8 A;  4O44 A;  4K42 A;  2PZS A;  1EKE A;  2YNG A;  3J80 O;  3P39 A;  2UXC K;  1HRH A;  3TAN A;  3BF3 A;  2YKM A;  2YNF A;  4CJP A;  2CH5 A;  1XC3 A;  4FJX A;  3AAQ A;  3L3V A;  4CBU A;  3GBT A;  3HVT A;  1Q86 O;  3T69 A;  4PA1 A;  3H45 C;  1C1B A;  4B9U A;  2E6M A;  1QSL A;  3L2U A;  1MWK A;  3CM5 A;  1UA1 A;  2XRI A;  1BHL A;  3O9U A;  1W2B M;  3G4S N;  2YHW A;  1QHT A;  3D45 A;  4DSJ A;  4CEA A;  4KB0 A;  4B3S K;  1VAZ A;  4CVN E;  4CW7 B;  5FPE A;  1A5W A;  4RW9 A;  3U8X A;  1Q9X A;  1HKB A;  3SI6 A;  2P9I B;  2WUS A;  5KQ8 A;  1HNV A;  4GY2 B;  2F9T A;  2YI1 A;  3THX A;  4BC4 A;  5AZI B;  1XMQ K;  5M1Q A;  3FZL A;  3IDH A;  4DR6 K;  3FZH A;  3BDP A;  1TAQ A;  3RRH A;  1ITG A;  1JL2 A;  3CJB A;  4IOX A;  4BR4 A;  3C0B A;  1VQO N;  1GLJ O;  4KFB A;  4HWI A;  3ENH A;  4IEE A;  1BWF O;  2A41 A;  4H5R A;  1GLC G;  3CFR A;  4Z4F A;  3JYT A;  3MDQ A;  3OHR A;  5C42 A;  3TTD A;  4CHO A;  3O4Q A;  4BDP A;  5LY3 A;  3UKR B;  2QXL A;  4CEZ A;  3O80 A;  5GIP A;  3AO5 A;  1P90 A;  2D0P A;  2YX6 A;  1LCU A;  1K73 O;  4KTW A;  1RBV A;  4FWN A;  1ASW A;  3O9T A;  2O8C A;  2QWL A;  1HPZ A;  2OZM A;  1RFQ A;  2FF6 A;  3SUQ A;  1CXQ A;  3OS0 A;  3LPT A;  3SUN A;  3TAQ A;  1UA0 A;  4EP5 A;  3LM9 A;  3RSE B;  5HRP A;  3TAB A;  3U3G A;  3OJU A;  3NF9 A;  2P9P B;  1HQU A;  4FLY A;  4OPA A;  1MWM A;  5GAH P;  3QDK A;  1QQM A;  3NFA A;  3VEX A;  1JLF A;  4CBW A;  3CCR N;  3OVN A;  3OBW A;  2IGI A;  2A40 A;  4E7L A;  2OZS A;  5FPM A;  1O13 A;  3PV8 A;  1EWQ A;  1NLV A;  3HL8 A;  2FC0 A;  2F8S A;  3SAH A;  1C0T A;  4ISE A;  4BRL A;  2IOC A;  4BR2 A;  4Y1C A;  3GG4 A;  4BVP A;  2D4W A;  3O6W A;  4JKB A;  4C1N K;  2O8F B;  1Z6R A;  3LDQ A;  3QO9 A;  2VCP A;  4JKF A;  4IWV A;  4FM2 A;  3C6A A;  1SZ2 A;  4E19 A;  3CQY A;  4CF9 A;  2B5J A;  2GV9 A;  3OTO K;  4X62 K;  2V7Z A;  2VG5 A;  3WXL A;  3VQQ A;  2YCH A;  4CZI A;  5HRS A;  4J2D A;  4NLC A;  4B1V A;  1RTI A;  2G8U A;  2I5J A;  2P9I A;  3DLB A;  4E7H A;  1OH6 A;  4KHY A;  3T7Z A;  3G6E N;  4BVO A;  3O3H A;  3EYZ A;  3L6Q A;  5AZI A;  3EKU A;  3DMJ A;  4YNQ A;  4QAG A;  2P1J A;  2FSK A;  1TVR A;  1KC8 O;  1BG3 A;  1TKT A;  3ITH A;  3B8A X;  2E6L A;  4Y0W A;  4DLE A;  4FZX C;  1VSF A;  4YOR A;  2QWN A;  3SBG A;  3KK1 A;  3K9J A;  1F21 A;  4A62 A;  4KB1 A;  1Z26 A;  5BRF A;  4E3S A;  4JI0 K;  1SS6 A;  3WXK A;  5AJ3 K;  1YF5 L;  3VGM A;  4AHC A;  2HVI A;  2FXU A;  5AFU H;  1GLD G;  1C0U A;  2ATQ A;  4OKE A;  4E7J A;  4BRD A;  4FJG A;  1TL1 A;  3AVL A;  5HRO A;  3DAW A;  4F4K A;  1NG9 A;  2FBX A;  4BDZ A;  1RT1 A;  3AVB A;  3VET A;  4R5P A;  2BAN A;  1N36 K;  2HHU A;  3NH2 A;  1S1V A;  3A5O C;  4LY7 A;  4YDU A;  3W0L A;  4FYD A;  1XHX A;  1QVG M;  1C0G A;  3CMA N;  3CME N;  5JS2 A;  2GEL A;  5DMR A;  1YUW A;  5C2D A;  2OTL N;  1ESV A;  3HPG A;  1HNW K;  4CJE A;  1IV0 A;  4BR9 A;  2E1Z A;  3RSE A;  4NCB A;  3MCP A;  3AVC A;  4PKI A;  5LJW A;  3KJV A;  4E7K A;  3DXM A;  2P9P A;  1WSF A;  5BN9 A;  4R79 A;  3QEI A;  5HOO A;  1WSE A;  2XY7 A;  2CGJ A;  3O4N A;  2G8I A;  1WN7 A;  4DFK A;  3T1A A;  1S1W A;  4FJH A;  3W3D A;  4GMJ B;  5EXW A;  1BIU A;  3OY9 A;  3VQD A;  4XH5 A;  1EET A;  3AY9 A;  5EOY A;  5AQH A;  4CIF A;  4CBX A;  3NF6 A;  3LAL A;  1Q18 A;  3IKM A;  2KZM A;  4KI4 A;  4CES A;  4CZK A;  3SV3 A;  1BI4 B;  2QKB A;  4DQP A;  1SUQ A;  3JSM A;  3RRG A;  4LFA K;  2O8F A;  3OYL A;  1WBB A;  1YVU A;  3U9Z A;  3AVF A;  2O4G A;  1RTH A;  3TTF A;  4MDA A;  4CJR A;  3LWL A;  4HTL A;  1KSP A;  3ASM A;  4FL9 A;  4NYN A;  1J5E K;  4B9V A;  3DYA A;  1HR0 K;  1YXQ A;  2D0A A;  2YJE A;  1G15 A;  2HBJ A;  1IBM K;  1CZ9 A;  5BR8 K;  5HLF A;  3VQ9 A;  4NO7 A;  3O9R A;  1S1T A;  4CZF A;  3SPZ A;  3CJA A;  1NK8 A;  2PFU A;  4B9M A;  1NGJ A;  4XH1 A;  3RMB A;  4BRE A;  3HM9 A;  1E4F T;  1Q7Y O;  4Q0B A;  3HTV A;  4CJS A;  2HHH K;  4CCH A;  3H08 A;  3V6D A;  5M1O A;  3QBX A;  4FJJ A;  2OPP A;  2YKN A;  1ZBI A;  4Y1D A;  3OYF A;  3PX0 A;  5AQW A;  2UUB K;  4PL7 A;  1VRT A;  3VER A;  1J53 A;  1ATS A;  3CG7 A;  4DQS A;  1VRU A;  1N8R O;  3SMP A;  4FO0 A;  3ATU A;  4NXN K;  2BTF A;  3A0I X;  3DXK B;  1NGB A;  3HJF A;  4CGJ A;  4L8R B;  3C65 A;  2HHT A;  2H3G X;  3VTH A;  5DM7 L;  2KLA A;  3SZ2 A;  4AIL C;  1TAU A;  3I56 N;  4TSX A;  1NJI O;  1RT2 A;  3ZSZ A;  4B9T A;  1IG9 A;  1S9G A;  3KK7 A;  4AHU A;  3IRX A;  3OYI A;  1ZC6 A;  2AJQ A;  3J81 O;  3I55 N;  4CZM A;  2P9L B;  3ID8 A;  4ZHR A;  4DV5 K;  3C6H A;  1MU2 A;  1YAG A;  4YDU C;  1RIL A;  2QWO A;  4LF9 K;  4H4O A;  3LP2 A;  3FFK B;  2JLE A;  4FJ7 A;  3A5N C;  1HJO A;  1ZBS A;  4DB3 A;  4HUF A;  3KIO A;  3WNG A;  3LL3 A;  1NK7 A;  2VG6 A;  3THY A;  4DQQ A;  2GWK A;  5DK5 A;  1T7P A;  3CJ1 A;  2XY6 A;  3DLK A;  2J4R A;  2ZGY A;  3ENB A;  5AFU A;  1GOC A;  3K0S A;  1U48 A;  5HRR A;  2O8E A;  3MK6 A;  1NKB A;  4CEE A;  5BRE A;  3O1B A;  4KBO A;  2YHB A;  5C10 A;  1BI4 A;  3AO2 A;  1JXB A;  3QIN A;  5AQL A;  5EY4 A;  1DTT A;  5BR9 A;  4DQR A;  4V19 S;  4HTU A;  4LC9 B;  3K9K A;  4DR5 K;  3V4I A;  1DLO A;  3CM6 A;  3QEP A;  4JKH A;  3DLR A;  5LL6 Z;  2KFZ A;  5AR0 A;  3CC2 N;  1MA9 B;  4K41 A;  1N33 K;  4PKG A;  4CD3 A;  2Z1G A;  2EHG A;  4W5O A;  3EE9 A;  3V81 A;  4H8K A;  3G10 A;  3KHY A;  3A2F A;  3BF1 A;  1VQN N;  5JLH A;  3CQX A;  1OH7 A;  1WNS A;  3QLH A;  2GEM A;  2XHB A;  3AVN A;  1JLQ A;  3H6E A;  4FJI A;  4DV7 K;  3KLI A;  5AQT A;  1J6Z A;  3SQ0 A;  4MDB A;  4EFH A;  2ASM A;  1BQM A;  3NGZ A;  4IFY A;  4BR7 A;  1Q82 O;  4GVE A;  3PIO L;  5FPN A;  4BR5 A;  1S72 N;  5C15 A;  5J2M A;  4DR4 K;  4DV0 K;  3LPU A;  2WBN A;  3BEX A;  1LW2 A;  3KD1 E;  1RDU A;  5KI6 A;  5H1S Q;  3F2K A;  1DTQ A;  3KKR A;  4O5F A;  4C23 A;  4H5T A;  5HRN A;  2QWP A;  4RCH A;  2Z1J A;  4N47 A;  1NU0 A;  1WB9 A;  2Q2R A;  3DXK A;  3CER A;  3TWH A;  3N4P A;  4FWP A;  3L3U A;  1HNZ K;  3H3N O;  5CYM A;  3MEC A;  3QET A;  4CF2 A;  3SJH A;  4DSE A;  3GE1 A;  1JLC A;  4BRA A;  3QES A;  3HZ6 A;  5KPZ A;  5HL7 L;  2P9U A;  3O5B A;  2RN2 A;  2FF3 B;  1MDU B;  4CJW A;  3IS9 A;  4JKE A;  4FJN A;  4JK8 A;  3QEV A;  3T1Y K;  4C8L A;  5C0Y A;  1KFD A;  4IZ9 A;  4BGB A;  4CFA A;  2PBD A;  3VF6 A;  4X66 K;  4IEI A;  4ELT A;  3H1Q A;  3N4Q A;  4FOE A;  4BQL A;  3A5M C;  5GIO A;  3NCI A;  3M3Z A;  4CZH A;  4H0Y B;  3HOT A;  3ZSX A;  5GAE P;  2UXD K;  3QEW A;  1IBK K;  3ZSW A;  1DGK N;  5KRT A;  3HP6 A;  4DTX A;  3L2W A;  1NK5 A;  3K57 A;  1KTQ A;  1SL2 A;  2IVN A;  4F8R A;  3J8A A;  1KCF A;  4IJA A;  1HUX A;  3OS2 A;  1XNQ K;  1GLA G;  1NJZ A;  4IG3 A;  4FJK A;  3LDL A;  3AVK A;  4FK0 A;  2RPI A;  1C0F A;  3SPY A;  2FBY A;  3SJJ A;  1ZBH A;  2FBT A;  1I94 K;  3CIP A;  2P9N B;  1RDW X;  3ZX3 A;  3FZK A;  3QIC A;  1ZYQ A;  1QSY A;  1EX4 A;  4I9Q A;  4MO4 A;  4E0D A;  1KD1 O;  2IIR A;  2ZD1 A;  5I3U A;  1SL0 A;  4FLV A;  5AQX A;  2ITG A;  3WNH A;  3D2E A;  1CXU A;  3KLE A;  2NZT A;  3NVM A;  4RW7 A;  1A5X A;  3OYM A;  1NJX A;  3J7Z O;  2O8D B;  3D2F B;  3FE1 A;  1HMV A;  4DFP A;  5F0X A;  5BRD A;  3LP0 A;  5E41 A;  1X9S A;  4HVJ A;  4OPH A;  4KH6 A;  4ID5 A;  4FW1 A;  2KTQ A;  3MEG A;  4Z4H A;  1LOT B;  4JI5 K;  4J8F A;  1IJJ A;  4GNI A;  3HT3 A;  2W6L A;  3KLG A;  1ATN A;  5JLF A;  4I2Q A;  3RR7 A;  1IKX A;  2ZJQ L;  3CCU N;  2FBV A;  3AA4 A;  4BRF A;  1VSE A;  2EWS A;  2PAV A;  3TR8 A;  1DT9 A;  2QW9 A;  4M3U A;  5C12 A;  4I6M B;  4PY5 A;  4DWI A;  1FJG K;  4JD2 A;  3VA0 A;  3AO1 A;  2O4I A;  4DR7 K;  3NF8 A;  3HBT A;  3P4I A;  4DUZ K;  4HCC A;  1BGX T;  2CGL A;  2OAN A;  1NBW A;  3HPO A;  4O8U A;  5I42 A;  3C7N B;  3DWL A;  2I7P A;  4C8M A;  4QOZ B;  2E20 A;  3VPZ A;  4CHQ A;  3J7A P;  2GBZ A;  3K2P A;  4PL8 A;  1I39 A;  3C94 A;  4O55 A;  3WNF A;  4JS5 A;  2QWQ A;  2E2Q A;  4DQ8 A;  5M1P A;  4BRM A;  1XUP O;  3L4I A;  2DFF A;  2ZJP L;  3NH1 A;  2HND A;  2HST A;  2HMP A;  1VSL A;  1YT3 A;  1G99 A;  1HPM A;  4CF0 A;  2V52 B;  3B6P A;  1V4S A;  3VN5 A;  4F3T A;  4B3R K;  4KHN A;  2JWK A;  4LF4 K;  5JVG L;  3L0Q A;  1J54 A;  5HP1 A;  4DSI A;  4BRQ A;  3SQ4 A;  3DM2 A;  2ITM A;  4JYA K;  2VWK A;  3VQ7 A;  3CFO A;  1NGD A;  4QS9 A;  5F2R A;  3O9S A;  4LSL A;  4LF5 K;  4BE0 A;  2P9N A;  1C1C A;  1J9A A;  2OPQ A;  3R1X A;  3V1R A;  4A57 A;  3L2V A;  3VEV A;  4KHU A;  3TSP A;  2KKZ A;  2P9S B;  3QER A;  3O1W A;  1ZBU A;  4CJF A;  4DTO A;  1T3V A;  2G8W A;  4A2B A;  4JKC A;  4HCB A;  4X64 K;  2G8V A;  5FDL A;  4OLB A;  4G9Z A;  4I9L A;  4BR0 A;  3P38 A;  2YNH A;  4M45 A;  5AQQ A;  3D2F A;  3GL1 A;  3VF2 A;  4JRQ A;  1HYS A;  4DU1 A;  2YHY A;  1LV5 A;  2Q1N A;  2YV0 X;  3OYH A;  1U6Z A;  3K59 A;  1XNR K;  2BDP A;  1KVB A;  4H0X B;  1VQ5 N;  3CHW A;  3KWI A;  1XC9 A;  4XH4 A;  3K58 A;  3VQP A;  1GLL O;  3ZSO A;  5AQU A;  1K8A O;  4CJU A;  4OPK A;  4H5V A;  4DTR A;  4FCY A;  3OYC A;  2XY5 A;  1VQK N;  4C8K A;  4DU3 A;  4J2A A;  1NK9 A;  1T05 A;  2VYP A;  5AQG A;  3DRS A;  4BE1 A;  5D3G A;  1UAX A;  1VQ9 N;  1QQO A;  3PY8 A;  5GAD P;  4DV1 K;  4KHS A;  1R59 O;  3RMD A;  1VQP N;  3QIO A;  4EHT A;  4YHH K;  1RBR A;  2KW4 A;  5AQF A;  4GV9 A;  2Q0U A;  4I6M A;  5DM6 L;  3TAR A;  2AP1 A;  3VQC A;  3GOI A;  2RF2 A;  3MCA B;  3VEY A;  4DS4 A;  1REV A;  3RR8 A;  4OGE A;  4KI6 A;  4IFE A;  2DFE A;  2A3Z A;  2HOE A;  3AVI A;  4BC2 A;  3QML A;  1OKJ A;  4LF8 K;  4LH4 A;  4RG8 A;  3C7N A;  4WFB L;  2HNZ A;  3CFP A;  2QA4 N;  1WLJ A;  1QZ5 A;  2BE2 A;  2WTU A;  2A1S A;  4FW2 A;  1FW6 A;  4OO1 J;  4CFC A;  4OGC A;  3AVM A;  4JEP A;  1LWE A;  3RMA A;  3VQE A;  2X6N A;  1IH7 A;  2QWR A;  3UKR A;  3CC7 N;  1W0H A;  4MLH A;  3TAE A;  3MN7 A;  4XEI A;  4B9S A;  4BRP A;  4U67 L;  2F8T A;  4CFD A;  4YOY A;  1NKE A;  5KQD A;  1R0A A;  5A2Q O;  4HHT A;  4WYB A;  5FPD A;  4AQY K;  4K43 A;  1RTD A;  3EE8 A;  3DJC A;  1NNE A;  3LAN A;  5GAG P;  1YTA A;  2XO7 A;  4CK3 A;  4RWT A;  3VGL A;  3ZT4 A;  2GUP A;  5CY4 A;  4BRO A;  3DLH A;  1D4X A;  3I0R A;  3QNO A;  1N6Q A;  5FRM A;  1FXX A;  5AQY A;  3ATV A;  3VGK A;  2WON A;  3JS6 A;  4BRH A;  3JAM O;  4JRP A;  3P83 D;  4DCH A;  3MWT A;  4LH5 A;  1NGI A;  4M3T A;  4W5Q A;  1WOQ A;  1B9D A;  3WXJ A;  3DRP A;  5BN8 A;  4B8C A;  3H46 O;  4OJR A;  4CF1 A;  1QSS A;  4FWS A;  4FZZ A;  1T03 A;  1NK4 A;  4J2E A;  4FLU A;  3E9P A;  3L2R A;  4DSL A;  3OYD A;  3EKS A;  3OYJ A;  3UIQ A;  1OVQ A;  5SZT A;  3RVC A;  2W6K A;  2DTU A;  4CGF A;  1VQ8 N;  2HNY A;  4FWL A;  3GDQ A;  4OKK A;  4CZL A;  2VWJ A;  3PX6 A;  2HW3 A;  5BPN A;  4FJL A;  3NF7 A;  1NMN A;  3ZSY A;  1YIT N;  2Q3S A;  2NRZ A;  3D6R A;  2QEX N;  2UUA K;  5E26 A;  3NMU A;  3MWP A;  3FR0 A;  5E84 A;  1SAZ A;  2NRV A;  4JHD B;  1YTU A;  3L2Q A;  3KLH A;  5KGW A;  4CI6 A;  5EX5 A;  3SK3 A;  3DLE A;  3O8M A;  4NCG A;  3ZT1 A;  1H1V A;  1L5U A;  5TKY A;  4CF8 A;  1SQK A;  1X9M A;  4KRF A;  3ZX2 A;  1S1U A;  3O3F A;  1Z05 A;  3KWG A;  1HJR A;  4CEB A;  3MN6 A;  1ILY A;  4DTM A;  4CEQ A;  3AVH A;  1KLM A;  4M7X A;  3O08 A;  1OVY A;  3WEE B;  4GKK K;  5J1E A;  4QCL A;  4H0V B;  5M1N A;  4KHW A;  1VHX A;  4H4M A;  2JGU A;  4RW4 A;  2HBK A;  4KKO A;  2E8A A;  3IFR A;  4DS5 A;  2IAJ A;  2F4V K;  2KZZ A;  3QIP A;  3EO3 A;  3ZT0 A;  4BRI A;  3M8R A;  1KQS M;  4IOC L;  4NYF A;  4CEC A;  4DR3 K;  2BUP A;  5SWM A;  4Z4E A;  1K6Y A;  4BRN A;  3RWU A;  4EZ6 A;  1J5O A;  1KLN A;  3THW B;  4M7Y A;  4CHP A;  3FZM A;  2X78 A;  4JV5 K;  3QFU A;  4CD1 A;  4KH5 A;  4AM6 A;  1IKY A;  1Z25 A;  1S6Q A;  3K5N A;  3NBP A;  3M8S A;  4BDY A;  4B3M K;  3HK2 A;  5KPR A;  1X9W A;  2UU9 K;  4B3O A;  4CGD A;  3P5J A;  3M5R A;  3LZI A;  3TSU A;  4C8N A;  4N41 A;  1YJN N;  3ZYY X;  3SBT A;  2ETJ A;  4M3Z A;  3S3N A;  1N5Y A;  4DMN A;  4DLG A;  1WBD A;  4CFB A;  4JK7 A;  3E9L A;  4MLE A;  4BG9 A;  5LMN K;  3ENO A;  1ZBF A;  4BRC A;  5AQI A;  4CJQ A;  3CCS N;  1JLA A;  4CHN A;  4O0J A;  4JI4 K;  2QXF A;  4MQ3 A;  1DEJ A;  1BL3 A;  5EU7 A;  4F2R A;  4CJK A;  1B9F A;  3NHG A;  1NGF A;  2ZGZ A;  2OPS A;  1CLQ A;  1JLB A;  3G25 A;  1VSH A;  4JKA A;  3P31 A;  4M3R A;  1RT4 A;  4B1X B;  4M63 C;  1KVC A;  3LWM A;  2OPR A;  1BCO A;  3LP3 A;  2QI2 A;  4KAZ A;  4LD0 A;  4FWM A;  2ZQB A;  5TKW A;  2P9K B;  3SNN A;  4J2B A;  2O8B B;  1U47 A;  1EO1 A;  1TUY A;  1YJ9 N;  1FKO A;  1WSI A;  2W40 A;  4FLT A;  3UE5 A;  4K25 A;  4B8A B;  1BQN A;  3O3G A;  3MXJ A;  4JI3 K;  1JJ2 M;  1M90 O;  1VQM N;  4KV8 A;  1TK0 A;  4W5R A;  3VMF B;  1NGH A;  2VGM A;  4DSK A;  1TK8 A;  3F5T A;  3MED A;  1T6D A;  3ZX0 A;  2NUB A;  4CEF A;  4DKW A;  3EZ5 A;  3AGR A;  4FWK A;  4IO8 A;  1WAF A;  1HKG A;  5FRN A;  4EAH D;  1HLU A;  1L3U A;  2WFB A;  3WEE A;  2Q97 A;  4IOA L;  4CED A;  1P8Z A;  3O9Q A;  1IG8 A;  4DG1 A;  5AQO A;  3VQA A;  2V7Y A;  1RBT A;  3ISN C;  3ZCM A;  5FRO A;  1YHQ N;  4DR1 K;  4YOW A;  3LDN A;  4ICL A;  3HYF A;  4JLH A;  1L3V A;  1V4T A;  2HBL A;  4IJN A;  2PYL A;  5K14 A;  1WSH A;  3OS1 A;  1DKG D;  2IS3 A;  1CZB A;  2P9L A;  3VQ5 A;  1Q9Y A;  5AQM A;  4ILH A;  4A59 A;  1VQL N;  1TUU A;  4ELV A;  4DHY A;  3C6U A;  5C2F A;  3U6F A;  5J2Q A;  2ASP A;  4ILJ A;  4B1Z A;  4WQ4 A;  1QZ6 A;  3MMV A;  4C1N I;  1CZA N;  3LAM A;  3AV9 A;  4LFB K;  1TKZ A;  1BA0 A;  2F9W A;  3LDS A;  2GWJ A;  4NCA A;  1IBL K;  4FSV A;  3M8P A;  3SYZ A;  4DFM A;  4NXM K;  1NMD A;  1HNX K;  2W41 A;  3R3L A;  1A5V A;  1JCG A;  1VSM A;  2YJF A;  3CD6 N;  3PO5 A;  2DPN A;  4JK9 A;  3E9O A;  3CI5 A;  4B1Y B;  4E1J A;  4ZTJ A;  4M3Y A;  4A5A A;  3K5O A;  4CIG A;  1E3M A;  3SLC A;  3HPH A;  3CYM A;  3K5L A;  2D5R A;  3D0P A;  2Q36 A;  4LF6 K;  1QVF M;  2YNI A;  2HHW A;  4CGG A;  3V9Z A;  1OH5 A;  3PX4 A;  4BG8 A;  2O8C B;  1RGI A;  2QTD A;  3PO4 A;  2EX3 A;  3RMC A;  2B6A A;  1YI2 N;  1D9D A;  4M3X A;  2ZF5 O;  2G8F A;  3LAK A;  3ZEU B;  2QK9 A;  5HBM A;  4OX9 K;  4CK1 A;  1E4G T;  2P9K A;  3IG1 A;  2O8B A;  1Q81 O;  1RTJ A;  5MLC Q;  4EP4 A;  4FLX A;  3LDP A;  3LDO A;  3QNN A;  3E1Y A;  4E1M A;  3MXM A;  5KRS A;  3OYG A;  1EP4 A;  1X1P A;  3BZK A;  3B6O A;  3PIP L;  3SUO A;  3NE6 A;  4FJ5 A;  3WQT A;  2NRR A;  3EZW A;  3SV4 A;  4AM7 A;  4GKJ K;  3WQU A;  1TKX A;  1LWC A;  4WCE L;  3WXI A;  3VF4 A;  2QKK A;  1HQE A;  2Z1H A;  5GIN A;  3LM2 A;  4CER A;  4DTN A;  3KVG A;  4FZY A;  4AH9 A;  4FK2 A;  1D8Y A;  2Q31 A;  1RBS A;  1VQ6 N;  1C6V A;  3QFP A;  1NGE A;  5CYQ A;  2PY5 A;  2G8K A;  3DOK A;  1L3T A;  2W42 A;  2UUC K;  3SQ1 A;  4C8O A;  1BCM A;  4DQI A;  1FKP A;  1NGA A;  4X65 K;  5KTQ A;  5J2N A;  4IBN A;  4KRE A;  1BA1 A;  3ZSR A;  1LAW A;  4B9L A;  3FFI A;  3MN5 A;  4BC5 A;  1T44 A;  1QS4 A;  1GLB G;  3CCJ N;  4M41 A;  3AA5 X;  1QQN A;  2GUI A;  3FZF A;  3S3O A;  2OTJ N;  2D0B A;  1EWR A;  4CZE A;  3AO3 A;  4YOU A;  2CH6 A;  3EN9 A;  3RTV A;  2NRX A;  3HO1 A;  5BPM A;  2XY8 A;  3NGI A;  5IT9 O;  5C25 A;  1EQY A;  1X3M A;  1Y97 A;  3G71 N;  2V51 B;  3SCX A;  4DV3 K;  1HNI A;  3EEQ A;  3VEZ A;  1WUA A;  4OKJ A;  3HST B;  3I0S A;  4F3O A;  3NVK A;  4YY3 K;  5M1F A;  4WQ4 C;  2NNW A;  1KXP A;  3Q7C A;  1NJY A;  1NK6 A;  1XMO K;  5J2P A;  1K8K B;  3TAG A;  5F1X A;  2A42 A;  4CHY A;  3VES A;  1Q8I A;  4ISG A;  3TSQ A;  3SAF A;  3CXC M;  5FLX O;  4CK2 A;  3BP8 A;  2UXB K;  4DV4 K;  3S3M A;  4ELU A;  3ZEU A;  2O8D A;  4RW6 A;  3HXM A;  2BH1 A;  1YVN A;  1IO2 A;  3DXM B;  5AZJ B;  4OPJ A;  3IUC A;  2E5L K;  1U04 A;  3WNE A;  4O8K A;  1U2V B;  4QS7 A; 
#chains in the Genus database with same CATH homology
 3EKS A;  3AAP A;  4JAX A;  5AQJ A;  3EE9 A;  3HRG A;  2ZWH A;  3RVC A;  3KHY A;  3BF1 A;  4BQZ A;  1VQN N;  5JLH A;  3O4W A;  3CQX A;  1VQ8 N;  4IDH A;  2GEM A;  1KAZ A;  4FWL A;  3GDQ A;  4CZL A;  4K42 A;  4ILG B;  4B9Q A;  3H6E A;  2NRH A;  3P39 A;  4NB4 A;  3VTI A;  3HSC A;  5BPN A;  1YIJ N;  4BY9 C;  5EVZ A;  1NM1 A;  5AQT A;  1J6Z A;  3BF3 A;  5AQZ A;  4IO9 L;  2CH5 A;  1XC3 A;  1YIT N;  4MDB A;  3AAQ A;  4EFH A;  2ASM A;  3ZET B;  3WUH A;  2NRZ A;  4BR7 A;  4CBU A;  3D6R A;  4GVE A;  3UKU B;  3UB5 A;  1Q82 O;  2QEX N;  3GBT A;  5E26 A;  3NMU A;  3MWP A;  5FPN A;  4BR5 A;  3FR0 A;  3T69 A;  3PIO L;  1S72 N;  5C15 A;  3H45 C;  5E84 A;  1Q86 O;  1SAZ A;  2NRV A;  4JHD B;  2GX9 A;  2WBN A;  3BEX A;  4A5B A;  4CI6 A;  1RDU A;  3VEO A;  5H1S Q;  1MWK A;  5EX5 A;  3F2K A;  3O8M A;  3SK3 A;  3CCV N;  1H1V A;  4FOI A;  5TKY A;  3E9P A;  1SQK A;  1XQS C;  3O9U A;  1W2B M;  3G4S N;  4O5F A;  3ZX2 A;  2YHW A;  4C23 A;  1TYQ B;  4H5T A;  3I33 A;  4EHU A;  1Z05 A;  1VAZ A;  4YOV A;  2QWP A;  3F9M A;  4RCH A;  3KWG A;  5FPE A;  4UY8 O;  3MN6 A;  3U8X A;  1HKB A;  2Q2R A;  3DXK A;  2NRT A;  3CER A;  1ILY A;  3TTC A;  5CR4 A;  2WUS A;  2P9I B;  5KQ8 A;  3N4P A;  4FWP A;  2F9T A;  2YI1 A;  4GY2 B;  4M7X A;  3MN9 A;  5M1K A;  4FWR A;  3O08 A;  1OVY A;  3WEE B;  4BC4 A;  3H3N O;  5AZI B;  4H0V B;  2A6A A;  5M1N A;  5M1Q A;  3FZL A;  3IDH A;  3FZH A;  3SJH A;  2HBK A;  3GE1 A;  2E8A A;  3IFR A;  2E2P A;  3CJB A;  4BRA A;  4IOX A;  4BR4 A;  3C0B A;  1VQO N;  1GLJ O;  3HOS A;  3HZ6 A;  3EO3 A;  4HWI A;  3ENH A;  4IEE A;  4BRI A;  1BWF O;  5KPZ A;  5HL7 L;  2A41 A;  4IXC A;  3CCM N;  4PKH A;  2P9U A;  3O5B A;  4IOC L;  1KQS M;  2FF3 B;  4H5R A;  1MDU B;  5KPT A;  4L3Q A;  4JKE A;  2BUP A;  4JK8 A;  1GLC G;  5C0Y A;  4IZ9 A;  4BGB A;  2PBD A;  3MDQ A;  3OHR A;  4BRN A;  3VF6 A;  3TTD A;  3SMS A;  1ATR A;  4M7Y A;  4IEI A;  3FZM A;  3H1Q A;  3BUZ B;  3N4Q A;  3UKR B;  2D0O A;  4FOE A;  2QXL A;  4BQL A;  3A5M C;  5LY3 A;  5GIO A;  3QFU A;  4CD1 A;  3CPW M;  3O80 A;  4KH5 A;  5GIP A;  4AM6 A;  5AQP A;  1K8K A;  3M3Z A;  1P90 A;  4CZH A;  2D0P A;  4H0Y B;  5JIC A;  5KPR A;  2YX6 A;  3HOT A;  5GAE P;  3FGU A;  3M5R A;  1NGG A;  3TSU A;  1S3X A;  1YJN N;  1LCU A;  2P9S A;  3QB0 A;  3ZYY X;  1DGK N;  1K73 O;  3SBT A;  2HBM A;  2IVP A;  4FWN A;  1GLE G;  5I9E B;  3U9D A;  3O9T A;  2IVN A;  2QWL A;  4CZJ A;  3J8A A;  4JK7 A;  3E9L A;  4MLE A;  1RFQ A;  2FF6 A;  4BG9 A;  3ENO A;  4IJA A;  1HUX A;  4BRC A;  1W97 L;  5AQI A;  5AZJ A;  1GLA G;  3LM9 A;  4GV3 A;  3RSE B;  5JVH L;  2RHK A;  3CCS N;  4A61 A;  3FLC O;  3LDL A;  1C0F A;  2P9P B;  1U2V A;  3JXU A;  5AQS A;  3CIP A;  2P9N B;  4OPA A;  1MWM A;  5GAH P;  1RDW X;  2FSN A;  3QDK A;  1DEJ A;  3ZX3 A;  3FZK A;  1QQM A;  3QIC A;  3VEX A;  4MO4 A;  4CBW A;  1KD1 O;  1M1K O;  3CCR N;  2IIR A;  3OBW A;  4CJ7 A;  2E1Y A;  1NGF A;  2A40 A;  2ZGZ A;  5AQX A;  5FPM A;  1O13 A;  3G25 A;  3D2E A;  4JKA A;  2NZT A;  1NLV A;  3P31 A;  3NVM A;  4B1X B;  4U7B A;  4M63 C;  3SAG A;  3SAH A;  4ISE A;  4NLB A;  3J7Z O;  3ZET A;  4BRL A;  4BR2 A;  3D2F B;  3UKU A;  3GG4 A;  1HX1 A;  2QI2 A;  3FE1 A;  1VQ7 N;  4BVP A;  3HM8 A;  1K9M O;  4FWM A;  5TKW A;  5F0X A;  2D4W A;  3O6W A;  2P9K B;  4JKB A;  4B1W B;  4C1N K;  5BRD A;  3G71 N;  1EO1 A;  1TUY A;  1YJ9 N;  1Z6R A;  4KH6 A;  3EL2 A;  4OPH A;  3LDQ A;  2W40 A;  2VCP A;  4YOX A;  3OW2 M;  3UE5 A;  4JKF A;  4K25 A;  4IWV A;  3C6A A;  1SZ2 A;  1JJ2 M;  3CQY A;  1M90 O;  1VQM N;  3WXM B;  4H5W A;  1QHA A;  1TYQ A;  3VMF B;  1LOT B;  1NGH A;  2VGM A;  2V7Z A;  4J8F A;  1IJJ A;  5BRH A;  1JCE A;  4GNI A;  3WXL A;  3F5T A;  1ATN A;  4WQ5 A;  2YCH A;  4CZI A;  5JLF A;  1T6D A;  4JKG B;  3ZX0 A;  3M6G A;  4DKW A;  3AGR A;  2F7T A;  4NLC A;  4B1V A;  4FWK A;  2ZJQ L;  4IO8 A;  3CCU N;  3OA9 A;  4EIA A;  1HKG A;  2P9I A;  4CD3 A;  4EAH D;  4BRF A;  1HLU A;  3T7Z A;  3G6E N;  2EWS A;  2WFB A;  2PAV A;  4BVO A;  3WEE A;  2Q97 A;  3L6Q A;  5AZI A;  1DT9 A;  3EKU A;  4IOA L;  2QW9 A;  1P8Z A;  1S22 A;  1BU6 O;  5C12 A;  3O9Q A;  4I6M B;  1IG8 A;  2FSK A;  5AQO A;  4F9O A;  3U4L A;  1KC8 O;  4JD2 A;  1BG3 A;  3H1V X;  1KAX A;  2V7Y A;  3B8A X;  4Y0W A;  3P4I A;  3HBT A;  1YHQ N;  3E66 A;  4RTF D;  2QWM A;  2CGL A;  4YOW A;  3LDN A;  1KAY A;  4YOR A;  2OAN A;  2QWN A;  5AQR A;  3SBG A;  3K9J A;  1NBW A;  1YJW N;  4A62 A;  5ADX H;  4O8U A;  1V4T A;  2HBL A;  5BRF A;  1SS6 A;  3C7N B;  4IJN A;  3WXK A;  1YF5 L;  3VGM A;  4GV6 A;  3DWL A;  2FXU A;  2Q0R A;  2I7P A;  5AFU H;  1GLD G;  1DKG D;  2E20 A;  1NGC A;  4QS8 A;  4BRD A;  2P9L A;  4JKD A;  3VPZ A;  2E2O A;  5AQM A;  3DAW A;  4ILH A;  4PL8 A;  4A59 A;  1VQL N;  1TUU A;  4DHY A;  5C2F A;  1JCF A;  3VET A;  2QWQ A;  2E2Q A;  2ASP A;  4DQ8 A;  3A5O C;  4ILJ A;  5M1P A;  4BRM A;  1XUP O;  4WQ4 A;  3L4I A;  4YDU A;  3W0L A;  4B1Z A;  2ZJP L;  1QVG M;  2HST A;  2HMP A;  1QZ6 A;  3MMV A;  4C1N I;  1CZA N;  1C0G A;  3CMA N;  1G99 A;  1HPM A;  4ISF A;  2V52 B;  3CME N;  3VEW A;  2GEL A;  1V4S A;  1YUW A;  2F9W A;  1BA0 A;  5C2D A;  2OTL N;  1ESV A;  2GWJ A;  2JWK A;  2P9U B;  3CET A;  5JVG L;  4FSV A;  3CJ9 A;  3MX2 A;  3L0Q A;  4BRQ A;  1NMD A;  3R6M A;  2ITM A;  4BR9 A;  3M1F A;  2E1Z A;  3RSE A;  3MCP A;  4H0O A;  2W41 A;  2ASO A;  2D1K A;  1NGD A;  3R3L A;  4PKI A;  5LJW A;  1JCG A;  4QS9 A;  5F2R A;  3ID6 A;  3O9S A;  2YJF A;  3DXM A;  3CD6 N;  2P9P A;  5BN9 A;  2P9N A;  2DPN A;  3CPE A;  1NWK A;  4R79 A;  5HOO A;  3A5L C;  3R1X A;  2CGJ A;  2ZJR L;  4JK9 A;  5CE3 A;  5ELZ A;  3E9O A;  4BRG A;  3CI5 A;  2VWB A;  4B1Y B;  4E1J A;  5EXW A;  3W3D A;  2KHO A;  3CJ7 A;  3VEV A;  4A5A A;  4A57 A;  3TPQ A;  3ULE B;  3SLC A;  3TSP A;  2KKZ A;  5AQN A;  3CF5 L;  4FVU A;  2P9S B;  2NRW A;  3O1W A;  4XH5 A;  2Q36 A;  1T3V A;  4YOT A;  3A8Y A;  3AY9 A;  4A2B A;  1QVF M;  5EOY A;  1BUP A;  4JKC A;  5AQH A;  4BG8 A;  2E88 A;  4CBX A;  4G9Z A;  5JMV A;  1RGI A;  2QTD A;  1Q18 A;  3P38 A;  4BR0 A;  3IKM A;  5AQQ A;  3D2F A;  3D7E O;  3GL1 A;  3VF2 A;  1HKC A;  5AQV A;  1YI2 N;  2YHY A;  2Q1N A;  2ZF5 O;  4CZK A;  3L4Q A;  3ZEU B;  1U6Z A;  4BC3 A;  4JN4 A;  5CHI A;  1E4G T;  2P9K A;  3HI0 A;  1Q81 O;  3S41 A;  4MO5 A;  4H0X B;  1VQ5 N;  5MLC Q;  3CHW A;  3KWI A;  3U9Z A;  3LDP A;  2NLX A;  3LDO A;  4JHD A;  3TTF A;  3E1Y A;  4XH4 A;  2GTD A;  1Y64 A;  1GLL O;  4MDA A;  5AQU A;  4KH4 A;  2IVO A;  2I7N A;  1K8A O;  4HTL A;  2JWL A;  3Q7B A;  4FL9 A;  4H5V A;  3PIP L;  1BDG A;  1VQK N;  1YXQ A;  3WQT A;  2VYP A;  4JKG A;  4WFA L;  2NRR A;  5AQG A;  2YJE A;  2HBJ A;  3EZW A;  2A5X A;  3D2E B;  4AM7 A;  1QQO A;  1VQ9 N;  3WQU A;  5GAD P;  4B1U B;  4WCE L;  3WXI A;  4NO7 A;  3VF4 A;  3O9R A;  4CZF A;  1R59 O;  1VQP N;  4EHT A;  3CJA A;  3CCE N;  5AQF A;  2PFU A;  4GV9 A;  5GIN A;  2Q0U A;  4BRK A;  3LM2 A;  4I6M A;  1NGJ A;  4XH1 A;  4BGA A;  4H0P A;  3KVG A;  2AP1 A;  4AF1 A;  4BRE A;  5DM6 L;  2HF3 A;  1E4F T;  1Q7Y O;  3GOI A;  3HTV A;  3MCA B;  3VEY A;  2Q31 A;  4IFE A;  2A3Z A;  2HOE A;  2YHX A;  3MX5 A;  1VQ6 N;  3QFP A;  1NGE A;  4FWO A;  4FPA A;  4BC2 A;  3QML A;  1OKJ A;  3H3O B;  3QBX A;  4WQ5 C;  5M1O A;  3PLA A;  3C7N A;  4WFB L;  2QA4 N;  5AQW A;  4PL7 A;  1QZ5 A;  3VER A;  4OO1 J;  1NGA A;  1ATS A;  4JEP A;  5AQK A;  1N8R O;  1BA1 A;  3SMP A;  2E2N A;  2QWR A;  4FO0 A;  3ATU A;  3MN5 A;  3UKR A;  4BC5 A;  1T44 A;  2BTF A;  3A0I X;  3DXK B;  1NGB A;  3CC7 N;  1GLB G;  3CCJ N;  3KZB A;  1QQN A;  3FZF A;  3C65 A;  1BOT O;  4JD2 B;  2FLO A;  1GLF O;  2H3G X;  2OTJ N;  4H03 B;  4H0T B;  4MLH A;  3MN7 A;  4XEI A;  3CCL N;  3VTH A;  4BRP A;  4CZE A;  2KLA A;  4U67 L;  5DM7 L;  4WF9 L;  4YOU A;  2CH6 A;  3EN9 A;  3CJC A;  2VGN A;  4PHT X;  2NRX A;  3I56 N;  4YOY A;  1NJI O;  5B8H A;  3VEN A;  5KQD A;  5BPM A;  1T6C A;  3KK7 A;  1ZXO A;  1EQY A;  1X3M A;  1ZC6 A;  4WYB A;  2V51 B;  3R8E A;  5FPD A;  4K43 A;  2CGK A;  3I55 N;  4CZM A;  3VEZ A;  1WUA A;  3EE8 A;  3DLL L;  2P9L B;  3DJC A;  3ID8 A;  3WT0 A;  1X9J A;  3C6H A;  3QBW A;  5GAG P;  3NVK A;  1YAG A;  1BO5 O;  4RWT A;  3VGL A;  5M1F A;  4WQ4 C;  2GUP A;  4YDU C;  2NNW A;  2QWO A;  4WFN L;  1KXP A;  4BRO A;  3Q7C A;  4A2A A;  3FFK B;  3ULE A;  3IMX A;  1D4X A;  5BPL A;  3A5N C;  1HJO A;  1ZBS A;  1K8K B;  4FWQ A;  4CZG A;  4DB3 A;  5ADX A;  5F1X A;  3LL3 A;  2A42 A;  5AQY A;  2AA4 A;  2UYT A;  3ATV A;  3VGK A;  3JS6 A;  4BRH A;  2GWK A;  3VES A;  3CJ1 A;  4ISG A;  3TSQ A;  2J4R A;  2ZGY A;  3ENB A;  5AFU A;  3SAF A;  3CXC M;  3CC4 N;  4DCH A;  3MWT A;  2RE2 A;  3BP8 A;  3MK6 A;  1NGI A;  3OBY A;  2FSJ A;  3AAR A;  5BRE A;  3O1B A;  3TU5 A;  4KBO A;  3VOV A;  4JNE A;  3ZEU A;  5C10 A;  1WOQ A;  5AQL A;  5BR9 A;  3I8B A;  5EY4 A;  3WXJ A;  2BH1 A;  1YVN A;  5BN8 A;  1VQ4 N;  4LC9 B;  3DXM B;  3K9K A;  4Z94 A;  4H5N A;  5AZJ B;  4FPB A;  3CCQ N;  2WC9 A;  3IUC A;  3AGK A;  3H46 O;  4JKH A;  4FWS A;  1X3N A;  5AR0 A;  3R9P A;  3CC2 N;  2HF4 A;  1MA9 B;  4K41 A;  4O8K A;  1U2V B;  4QS7 A;  4PKG A;  5LJV A;  2QM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...