5B8HA

Crystal structure of type iii pantothenate kinase (pank iii) from burkholderia cenocepacia complexed with pantothenate, imidodiphosphate, and amp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
256
structure length
256
Chain Sequence
SEPHLLIDAGNSRIKWALADARRTLVDTGAFGHTRDGGADPDWSRLPRPRGAWISNVAGADVAARIDALLDARWPGLPRTTIRSRPAQCGVTNGYTTPEQLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGCFTGGLIAPGWALMMRALGTHTAQLPTLTTDIASGLLAGAQAEPFQVDTPRSLSAGCLYAQAGLIERAWRDLVAAWQAPVRLVLAGGAADDVARALTIAHTRHDTLILSGLALIAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal Structure of Type III pantothenate kinase (PanK III) from Burkholderia cenocepacia complexed with pantothenate, imidodiphosphate, and AMP
rcsb
source organism Burkholderia cenocepacia (strain atcc baa-245 / dsm 16553 / lmg 16656 / nctc 132
molecule tags Transferase
total genus 74
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5b8hA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5b8hA02
4CBXA 2FSJA 4CZIA 2E88A 2ASOA 3M6GA 1GLEG 4BG8A 5AQIA 4MLEA 1RFQA 1TYQB 4XEIA 3SMSA 2P9NA 5AQMA 5KQ8A 1QHAA 4CZJA 3VGMA 4EIAA 4C23A 3QMLA 1E4GT 1S3XA 3VPZA 1Z05A 5JMVA 1QQOA 1XQSC 2V7ZA 5KPZA 2HF4A 4EAHD 2GWKA 2P9IA 3QFPA 3TPQA 3FGUA 2QWNA 5BPMA 1YVNA 3GE1A 1ESVA 3IDHA 2GEMA 4IZ9A 2A6AA 1NGJA 4BVPA 1CZAN 5AQWA 5BR9A 4K42A 5BRDA 4PL8A 3RSEA 3D2FA 4E1JA 1NM1A 2P9KA 4CJ7A 2A42A 1WUAA 2Q2RA 3WEEA 4B9QA 3FR0A 4FWNA 2NZTA 4IXCA 3VGKA 3O5BA 3MMVA 3O1BA 4H5NA 1NGGA 2Q0UA 3MK6A 4MLHA 1GLAG 3M3ZA 4EHTA 2HMPA 3WQTA 1Y64A 3MN5A 3A5OC 3O6WA 4DQ8A 5EVZA 3DJCA 1HJOA 2AP1A 3ZX3A 3VETA 2Q1NA 3SMPA 3C0BA 4J8FA 4FOEA 2Q36A 5AQTA 3QB0A 3GBTA 3R8EA 3D2EA 3R6MA 3CERA 5AZIB 2HOEA 3FFKB 2D4WA 1BWFO 1QZ6A 3F9MA 4BR4A 1MWMA 1BUPA 3OHRA 2ZWHA 4H5RA 4PL7A 3EL2A 1K8KA 5AQPA 4QS7A 5EOYA 3VEWA 3ID8A 1HLUA 1GLLO 4BRMA 5JLHA 3QICA 1X9JA 4HWIA 1BOTO 2A41A 4A2BA 3DAWA 5AQGA 3GG4A 3CJ7A 3CQXA 3VEXA 1YXQA 1NMDA 5KQDA 2P9LB 2YHWA 4BR2A 5ADXA 2WUSA 4FWQA 3ZETB 5JICA 1U2VA 3A5MC 4CZGA 4BRDA 2E20A 3VEVA 2AA4A 2FLOA 5LY3A 3FZLA 2Q0RA 5BPLA 3L0QA 4BRAA 1ATNA 4I6MB 4M7XA 2E2PA 4BG9A 2P9PB 1NGBA 1KAXA 3MN6A 1RDWX 4DHYA 2I7NA 5CE3A 3DXKB 4IWVA 4JD2B 1SAZA 2Q31A 4BC5A 3VOVA 2FSKA 1YAGA 2W41A 3EN9A 5FPDA 3CETA 1ATRA 5AQXA 1LCUA 2BTFA 1BDGA 2V51B 4FWKA 5BN9A 2D0OA 2P9SB 4NB4A 2H3GX 3WXJA 4F9OA 2QWPA 5BN8A 1IJJA 3WQUA 4BR7A 4B1VA 4BRCA 4EHUA 4RCHA 3UE5A 4BC3A 5AFUA 3EKUA 1NGCA 2D1KA 4BRNA 4XH5A 3HM8A 3IFRA 1MDUB 3MCPA 4M63C 2P9UA 1X3NA 3S41A 3VEYA 3FZKA 2OANA 3VENA 3QFUA 5AQNA 4BR9A 1LOTB 4CZLA 2VYPA 3AY9A 1OKJA 4BVOA 4BGAA 4MO4A 4AM6A 4JHDA 1BO5O 4IJAA 3KZBA 3DXMB 3VF6A 4CBUA 4B1WB 1Q18A 4BR5A 1X3MA 3U8XA 3WT0A 4RWTA 5FPNA 5AQVA 1T44A 2P9NB 4BRLA 2W40A 3GOIA 1RGIA 1G99A 3ULEA 3UKUA 4IO8A 3CHWA 2UYTA 4H0PA 2IVNA 1ZXOA 3CJ1A 4B1XB 2P9IB 4QS9A 5TKYA 4BQZA 3H3OB 3MN7A 4PKHA 1DGKN 1U6ZA 3ZX0A 3U4LA 4LC9B 4A62A 1QQNA 4KBOA 3BEXA 4NO7A 1QQMA 4FWPA 3FZMA 4FWMA 4GY2B 3FE1A 3LDNA 3RSEB 2BUPA 1QZ5A 3HSCA 3D2FB 5KPTA 2P9KB 5AQOA 1NGDA 5EY4A 3H46O 3SLCA 2A3ZA 3L4IA 1HX1A 1GLFO 4FWSA 2GTDA 2NRHA 3BF3A 4CZFA 2ASMA 4CI6A 3VF2A 5FPEA 3LM9A 4H0YB 2P9LA 2E2QA 4YDUC 3VF4A 3R9PA 5AQHA 1V4TA 5I9EB 3H45C 3MDQA 5AQFA 5AQLA 3BUZB 3ENOA 4QS8A 3FZFA 3D7EO 2CH5A 3D2EB 1KXPA 1BA1A 2QM1A 5EX5A 4WQ5C 4I6MA 5KPRA 5AZJA 3EZWA 3AAPA 3VESA 2QW9A 4BRQA 4H5VA 4BRPA 1K8KB 5LJVA 3C7NA 3WUHA 2ZGZA 1HKBA 3UB5A 1JCEA 2KHOA 4ISGA 4B1YB 4BREA 3H3NO 5AR0A 3ZEUA 3CJAA 3UKRB 1R59O 4K43A 1HPMA 2CH6A 5AQRA 1XUPO 3ENHA 1JCFA 4FWOA 3W3DA 4BRKA 4H03B 2CGKA 1HKCA 3EO3A 2E1YA 1S22A 2A5XA 3EKSA 3ZX2A 4MO5A 3BF1A 3HTVA 3LM2A 1GLDG 1U2VB 3VGLA 4YDUA 1TYQA 2DPNA 5AQSA 1ATSA 4H5TA 3AARA 3O08A 5F2RA 3U9DA 3HBTA 4CD3A 3QBWA 1DKGD 4BR0A 4BRFA 3ATVA 3CIPA 1GLBG 4H0TB 1HKGA 4WQ5A 3SK3A 4FWRA 1GLJO 1NGFA 4XH4A 3A0IX 4FWLA 4ISEA 4CD1A 4PKGA 3FZHA 3LDOA 2VCPA 1ZBSA 2F9WA 4Y0WA 1WOQA 3A5LC 4RTFD 4JAXA 2YHXA 2IVOA 4A61A 4XH1A 3O80A 4FO0A 3CJCA 5AQYA 4K25A 2QWOA 5AQQA 2YJEA 2QWLA 1NBWA 2E2OA 4BC2A 4Z94A 3U9ZA 4L3QA 1BA0A 3MN9A 4GNIA 3VEOA 4BC4A 1Z6RA 1C0FA 2FSNA 2YHYA 3H1QA 1MWKA 1NWKA 1KAYA 1JCGA 2EWSA 2QWQA 1SZ2A 2V52B 2ZGYA 2P9UB 3GL1A 5B8HA 3O4WA 4K41A 5ELZA 2E8AA 1YUWA 3P4IA 4AM7A 2NLXA 5AZIA 3W0LA 4CZHA 1J6ZA 2CGLA 3L6QA 4CZMA 1KAZA 3G25A 4JHDB 3ATUA 3CJ9A 1MA9B 3O8MA 5ADXH 4FOIA 2YJFA 3QDKA 3JS6A 2E2NA 4B1UB 1NGIA 3WEEB 2IVPA 5BRHA 2HF3A 3I33A 2QWMA 5E26A 4O8KA 1SQKA 2IIRA 1V4SA 4PKIA 3AAQA 3VERA 2D0PA 3UKUB 3ULEB 5BREA 3LL3A 4H5WA 3CI5A 3KHYA 1T6CA 3CJBA 2CGJA 4H0OA 4IJNA 3M1FA 2FF6A 3LDQA 5BRFA 4M7YA 3ZETA 3HI0A 3LDPA 2ASPA 2F9TA 2YI1A 3KVGA 3IMXA 1E4FT 2ZF5O 1TUYA 1TUUA 3FLCO 4H0VB 4ISFA 3I8BA 5AQJA 2E1ZA 1DEJA 2V7YA 4JN4A 2P9PA 3H6EA 3H1VX 4FPBA 3A8YA 3CQYA 2J4RA 4H0XB 2QWRA 3WXKA 3UKRA 5AFUH 4BROA 3B8AX 3DXKA 4WQ4C 4JD2A 2GUPA 2I7PA 3A5NC 3TU5A 5JLFA 1D4XA 3BP8A 4A2AA 4EFHA 1BG3A 1GLCG 5F0XA 4JNEA 1H1VA 2GWJA 4CZEA 1EQYA 5FPMA 1BU6O 5BPNA 1NGEA 2P9SA 1ZC6A 1NLVA 4CZKA 3JXUA 3QBXA 5AQKA 2PBDA 2Q97A 3O1WA 2PAVA 4FSVA 4O5FA 4BRGA 2QXLA 1NGHA 2ITMA 4CBWA 1C0GA 3WXIA 5AZJB 5EXWA 2VWBA 3SJHA 3LDLA 1NGAA 4FL9A 4DCHA 3HZ6A 4BGBA 4HTLA 2A40A 5AQZA 1IG8A 3C7NB 4DB3A 3GDQA 4WYBA 4FPAA 3DWLA 1P8ZA 3WXLA 4BQLA 2FF3B 2YCHA 5LJWA 3ZEUB 4BRIA 5F1XA 3IUCA 3J8AA 3VEZA 5AQUA 2GELA 4B1ZA 4BRHA 2FXUA 4WQ4A 1XC3A 1T6DA 1HUXA 5E84A 3DXMA
chains in the Genus database with same CATH superfamily
2DFEA 2NRXA 3M6GA 4BG8A 4MLEA 4XEIA 4JKEA 5KQ8A 4UQGA 1W2BM 3LDSA 1KD1O 3VGMA 3RR8A 3E66A 3KLHA 4JK8A 3CPWM 2ZJPL 4AILC 4KHWA 5FRMA 1E4GT 3VPZA 2UXBK 4HHTA 1WAJA 5JMVA 3OYCA 3DLHA 1XQSC 3OS0A 2HF4A 2RHKA 3FGUA 1WSEA 4CJPA 1N8RO 2GEMA 3OYFA 2A6AA 4BVPA 4K42A 4X64K 3RSEA 4F3OA 2RF2A 2OTJN 2P9KA 1S6PA 4CJ7A 4CFAA 5C15A 4DQIA 4CW7B 3FR0A 3WNHA 3TAGA 4MLHA 1GLAG 2YNHA 1EX4A 4O0IA 4B9VA 2AP1A 4M3YA 3ZX3A 5M1FA 3VETA 3TI0A 3L2VA 4FOEA 3C95A 3PX4A 2Q36A 5AQTA 2Z1JA 3GBTA 3R8EA 3R6MA 4OKKA 4DSLA 4LY7A 2GX9A 3RRHA 4L8RB 1BWFO 1QZ6A 3F9MA 4BR4A 3L2QA 3L2UA 2ZWHA 4H5RA 1XNRK 1NU0A 4GKJK 4LF9K 3OBYA 3ID8A 1BGXT 5IT9O 3DMJA 4BRMA 5JLHA 1U49A 1BOTO 3L2RA 2BE2A 5AQGA 1RCHA 1NKCA 4CJEA 1NMDA 1QVFM 5JICA 4FWQA 3AA4A 3HK2A 4CVNE 1GOCA 3K9KA 4KTQA 2YKNA 1Q86O 3DOKA 5DMRA 4IG0A 3SBTA 1VSKA 3TSUA 1ATNA 4OPJA 1RBUA 2E2PA 4BG9A 1NGBA 1KAXA 3NDKA 3MX2A 3AVCA 3DXKB 3C6HA 4CIGA 3ID6A 4CK1A 1IBMK 4JKDA 1M1KO 2HNZA 5FPDA 1XI1A 3CETA 1LCUA 4KV8A 1BDGA 3SQ1A 2LSNA 5J2QA 3AVJA 4FW1A 1WBDA 4G1QA 1A5XA 2NNWA 5SWMA 2H3GX 2KZMA 4GMJB 2GUIA 1IJJA 2NRVA 4BR7A 4CECA 1RDAA 1BI4A 2WOMA 3HPOA 5C10A 4BRNA 1HPZA 3ZSYA 3IFRA 1NJWA 3TR8A 1T05A 4NYNA 4M63C 4BDPA 3V1RA 5C42A 2HBKA 3RWUA 4DF4A 3ZSWA 4GV9A 3FZKA 3VENA 3PSIA 3V1QA 1HNIA 4CZLA 1TK0A 1OKJA 4CK2A 2W6KA 3CC7N 3D45A 4CJ3A 3KJVA 3L8BA 4AM6A 2A1RA 4I2QA 4CJSA 3KK7A 4E7HA 3VF6A 5KGWA 3NF9A 4J2AA 1Q18A 5DK5A 4HUEA 2KFZA 5AQVA 2P9NB 2W40A 3GOIA 4LFCK 1RGIA 3I8DA 2OA8A 1RBTA 1U04A 4H0PA 2KTQA 4DTMA 2P9IB 4M45A 1DTQA 4PKHA 3ZX0A 1D9FA 5I42A 3U4LA 4A62A 3MAQA 2Y1JA 3BEXA 1QQMA 4DV4K 5C2FA 4CJWA 3SV4A 4FWPA 4FWMA 3LDNA 3MWTA 1QZ5A 1XNQK 3TAQA 3O4NA 3CCEN 1UAXA 1IKXA 2ZE2A 3O9QA 1O13A 2A3ZA 2D0CA 4QAGA 3L4IA 3SV3A 1HX1A 1JLBA 3MXJA 2NRHA 3PLAA 4FW2A 4C8KA 1KSPA 4I9QA 1DLOA 2D0AA 4CGJA 5AQHA 3K5LA 3V4IA 1V4TA 5I9EB 3DLEA 4WFAL 4DKWA 3MDQA 4RW8A 1XHXA 1LW0A 1RT7A 5AQLA 2QA4N 1G15A 1JLGA 4WQ5C 2YNGA 1RBRA 1RT6A 4I6MA 4OPKA 4IEIA 1VSLA 2OCEA 3EZWA 2NUBA 1Q9YA 1RT4A 4BRPA 1VQLN 1B92A 1W97L 2ZGZA 3J81O 1LWFA 3N4PA 5IWAK 4O44A 1TAUA 2I5JA 3THYB 5J2PA 4PY5A 4Q0BA 4K43A 1JXEA 3LANA 3MEDA 5AQRA 3P5JA 1RDUA 3PO5A 1JCFA 3L4QA 1TKDA 4FK0A 1J53A 2E1YA 4A5BA 4RW6A 3EKSA 3ZX2A 2F7TA 4B3MK 4RW4A 4YDUA 4KHSA 2DPNA 3QINA 4CIEA 1ATSA 4B9TA 3HBTA 4I9LA 3NAEA 4Z4GA 4X65K 3LP1A 1DKGD 2ZJRL 2VGMA 1U45A 1GLBG 3ZSOA 4XH4A 4FWLA 3TAMA 1RNHA 4ISEA 2PFUA 2OZMA 4BWMA 3HP6A 3CC4N 2VCPA 4JS4A 4E7KA 1EXQA 2FBVA 5KI6A 4JAXA 2IVOA 4DSEA 4XH1A 1TKZA 3CD6N 2O8CA 3CJCA 1XMOK 1VQPN 2YJEA 2QWLA 1NBWA 3T1AA 1NK9A 1N32K 3F2KA 4DR7K 4BC4A 3MX5A 3H1QA 1C0FA 3PX6A 1JL2A 2OPPA 3HT3A 4M41A 3OYDA 4M3ZA 4CJ4A 5FRNA 1ASWA 3EE8A 2V52B 4DLGA 4HUGA 3KWGA 3M8RA 4WF9L 4AM7A 2NLXA 5AZIA 1HYZA 1J6ZA 1VQMN 2HHHK 3CJ9A 5ADXH 4HCBA 1J5EK 3KK3A 4CF2A 3ITHA 3WEEB 1VHXA 2HF3A 5C24A 3OVNA 1T8EA 2QWMA 3KLIA 4PKIA 3RMBA 4O4GA 3VERA 4FZXC 2D0PA 4LH5A 3LL3A 3CI5A 3TWHA 1K6YA 2QEXN 3NVKA 1VQ4N 3C6AA 4DV1K 2HVIA 3LDPA 3AV9A 1JL1A 3AVHA 2F9TA 2YI1A 2ZF5O 1ILYA 3FLCO 1IBKK 4H0VB 1SKSA 5AQJA 5HRNA 2P9PA 3WXKA 4BROA 5AFUH 4WQ4C 1KRPA 3L3UA 5J1EA 3Q7CA 3SYZA 1D4XA 4NCAA 1CLQA 1H1VA 2VGNA 4CE9A 1BU6O 3CF5L 3OYKA 4KI6A 1HNVA 4DTOA 3CFRA 4CHQA 3LWLA 4H4MA 3WXIA 1S1UA 2VWBA 3WNFA 3TAFA 4JKHA 4BGBA 4HTLA 4DFPA 3C7NB 3BGRA 3GDQA 3HP9A 4FPAA 2HMIA 1QE1A 2FF3B 2YCHA 5LJWA 3ZEUB 2WBNA 3AVNA 4ILGB 4E7LA 4JKGA 3EYZA 3CCUN 2XRIA 1T6DA 4KB0A 1XHZA 5E84A 1X9WA 4JKAA 1I3AA 2E88A 2ASOA 4CEOA 1GLEG 2YHBA 1HQEA 1BHLA 1YF5L 2HNDA 4CZJA 3CMEN 1NG9A 3E9PA 5M1PA 4C23A 3OYNA 1BIUA 1S3XA 4C1NI 4FM2A 1Z05A 4DV0K 5HOOA 3QIPA 4EAHD 3ZYYX 3TPQA 3NGIA 1ESVA 4IZ9A 1NGJA 1CZAN 5AQWA 2X74A 4CF8A 4PL8A 1VSIA 3D2FA 3K2PA 1LW2A 1RBVA 1VQ8N 2G8WA 1WUAA 2Q2RA 4B9QA 2NZTA 4IXCA 1X9SA 3MMVA 2Q0UA 2UUCK 4FLVA 4EHTA 1KVCA 1FXXA 3O3HA 3AVAA 1D8YA 2P5GA 1C1CA 1Y64A 3MN5A 3O6WA 4DLEA 5EVZA 3DJCA 1HJOA 3QNOA 1O1WA 4MQ3A 2WTUA 3S9HA 2IS3A 3SUPA 5DM7L 4JKFA 1TV6A 3D2EA 3OJUA 4K0KK 2D4WA 4YNQA 5KRSA 1HYSA 3MWPA 3U3GA 3B6PA 2XY5A 1QSYA 1BQMA 3RMCA 4IDHA 3MXIA 3AVFA 1K8KA 5AQPA 3D0PA 4W5RA 5HRRA 4O5BA 3VEWA 1KLNA 5C0YA 3THWB 1GLLO 1QHTA 2YX6A 4C8MA 2UUAK 1LAWA 2VWKA 4A2BA 1YJWN 3DAWA 5CYMA 3GG4A 3CQXA 3IS9A 1K9MO 1RTHA 4J2DA 3J7AP 3DI6A 3ASMA 2E20A 4U67L 3SBGA 3VQEA 1T7PA 2AA4A 4C8OA 4C1NK 4DSKA 4FJLA 4PHTX 2P1JA 4M7XA 4CJFA 1DTTA 1HYVA 3MN6A 4AHVA 2VWJA 4KAZA 2ZQBA 4DHYA 1NK0A 2I7NA 2HNYA 4G9ZA 3SPYA 1NK6A 2O8FB 4B3OA 1UWBA 2F8TA 4CJRA 2FBXA 1RTIA 3VOVA 3P39A 1SKWA 3KK2A 3LP0A 5AQXA 3FFIA 5BN9A 5AJ3K 3OS2A 4AHSA 4OKEA 3IRXA 4F9OA 3QIOA 1QSLA 5BN8A 4B1VA 4DQRA 4EHUA 4RCHA 2KKZA 3H08A 3UE5A 4HCCA 3EKUA 2D1KA 4FJNA 3HJFA 4XH5A 3HM8A 1CXUA 4KHUA 2D5RA 5GINA 1MDUB 4FLYA 3CQ8A 5HLFA 2P9UA 5LL6Z 4J2EA 5JVHL 4DV7K 1YTUA 2OANA 3QFUA 3OYEA 1L3VA 4DTSA 4BVOA 4FJ5A 4KRFA 1S1XA 4JHDA 1VQKN 5HRPA 2XO7A 3DXMB 4JI5K 3AO4A 5GAEP 4BDYA 3O3FA 3CCJN 2YV0X 5FPNA 1IKVA 1T44A 4BRLA 5M1KA 1RT3A 4DQSA 5C2DA 2G8UA 4OJRA 3UKUA 1FKOA 1LV5A 2ITGA 2UYTA 1S72N 3CMAN 1VQON 1IG9A 3PY8A 3KIOA 3QESA 2PYLA 3TSPA 4IOXA 2RPIA 4NO7A 1N6QA 4JEPA 4E7IA 3FZMA 3RSEB 4AF1A 3G71N 3HSCA 2P9KB 4WFBL 4BY9C 5C25A 3AA5X 4V19S 1ZYQA 5EY4A 2HVHA 3C65A 1JLQA 4CJUA 3VQ8A 1J54A 3SUQA 1EWQA 1GLFO 3PUFA 1NMNA 1IH7A 3BF3A 4CZFA 3VF2A 5FPEA 1VRTA 2X6SA 3LM9A 4H0YB 3CM6A 2FC0A 4JK9A 4AHUA 3EZ5A 4QOZB 1EO1A 3PIPL 3N4QA 1E3MA 5HL7L 2XY6A 2X6NA 1L3SA 5JS1A 4DF8A 4J2BA 3ENOA 4QS8A 2B4JA 3D7EO 3FZFA 4FJ9A 2QM1A 2YNFA 5GIOA 2PZSA 3QEXA 4CJVA 4E1NA 1ASVA 4YFUA 3VESA 3OY9A 4B9UA 4CJKA 3WUHA 1LWEA 3UB5A 4ISGA 3HXMA 4BREA 1C1AA 5AR0A 3CJAA 3ENBA 1RT2A 1GOBA 3S3MA 1JLCA 1R59O 2O8BA 1NOYA 1VSJA 3ENHA 4IBNA 4BRKA 4FJIA 3AVIA 1HJRA 4KTWA 3EO3A 4KHYA 3K5MA 3ALYA 4MO5A 3HTVA 3LM2A 3RMDA 1OVQA 1TYQA 2YHAA 1T3VA 3AO1A 3AARA 5F2RA 1HMVA 3AGKA 4AHRA 4DU4A 2G8FA 3VTHA 4CHYA 4OGCA 1QSSA 3CC2N 1WAFA 4DR4K 4BRFA 3AA2A 3ATVA 3SQ0A 4H0TB 3E1YA 4NXNK 5BR8K 4W5QA 4EP5A 3ZSQA 2WONA 1B9DA 3JYTA 1W7AA 3THXA 1WOQA 4RTFD 4YY3K 1JLFA 4QCLA 4A61A 2P51A 4YOWA 3OYJA 1YIJN 1F21A 2KFNA 4BC2A 1S1TA 2E2OA 3LZIA 1ITGA 1NK8A 4CEFA 1X1PA 4DR2K 3NVMA 1OH6A 4B8AB 4FK2A 5M1NA 3V6DA 3MN9A 4GNIA 4B9SA 4CF9A 3VEOA 3SI6A 1Z6RA 1BI4B 5LMNK 1UA0A 3PX0A 1MWKA 3AVGA 3AO3A 4DU1A 4XIUA 3P38A 4Z0UA 4YHHK 3I55N 5HP1A 4JI3K 4MFBA 3P83D 1TK5A 3NMUA 3GL1A 5B8HA 3O4WA 3SAGA 5ELZA 2E8AA 1EWRA 1YUWA 3O9UA 3QETA 2QKKA 3L6QA 4CGHA 4DV2K 4ILJA 4FOIA 3NF7A 2YJFA 4FJMA 3JS6A 4B1UB 4ZTFA 1WBBA 3DYAA 4DR6K 1NJXA 4GW6A 2IVPA 2O8DA 4K8XA 1NKBA 5E26A 2IIRA 1QQCA 3CYMA 5BREA 2ZJQL 4IDKA 3CJBA 4JRQA 4H0OA 5HROA 3QLHA 4IJNA 3LDQA 3MEGA 4CHNA 3ZETA 4BE0A 3NGYA 2QKBA 1S1VA 2X78A 4CFBA 3NCIA 4EZ6A 4ISFA 2VQFK 2E1ZA 1DEJA 2V7YA 4KO0A 2UXDK 4CIFA 4FPBA 4H0XB 4LF6K 2B6AA 3B6OA 3T19A 4O0JA 4FJ8A 4JD2A 2GUPA 4DQQA 2I7PA 3A5NC 3ZSRA 5JLFA 4E19A 3BP8A 4FJ7A 1KQSM 3NFAA 2GWJA 5M1OA 3TAPA 2QXFA 1NGEA 2P9SA 1NLVA 4BDZA 4JI4K 1NJYA 2HB5A 3S3OA 2Q97A 3O1WA 3V9XA 4OLBA 2PAVA 4FSVA 1A5VA 4BRGA 1NGHA 4WCEL 3RRGA 1KCFA 3LDLA 3HZ6A 3O9TA 3IAYA 4DB3A 1IG8A 1NK7A 4HVJA 4E7JA 3WXLA 1WLJA 2RN2A 4KB1A 1WSHA 5AQUA 2GELA 3M8QA 1BL3A 2FXUA 2FBTA 4ZHRA 4B9LA 4N76A 4OPAA 3K58A 4JI7K 4FVMA 3G6EN 2FSJA 3QERA 4CZIA 3OYMA 5AQIA 3SMSA 1NK4A 5AQMA 4JI8K 4KHPK 1QHAA 4EIAA 1C1BA 1SV5A 3C94A 1YI2N 3T69A 3TSQA 4Z4CA 3WNEA 3AA3A 5KPZA 3HVTA 3DRSA 3OBWA 3NHGA 1YITN 2BDPA 5BPMA 2QWNA 3IDHA 5BR9A 3RVCA 2GBZA 1NK5A 2KLAA 4ELUA 2IDOA 3L3VA 4ID1A 4E1JA 2NRRA 3HOSA 2O8CB 3OJSA 2YNIA 3WEEA 3K0SA 3SQ4A 1HR0K 4IO9L 3HSTB 3KKSA 3CCVN 3VGKA 3O5BA 4LSLA 4FLZA 3VQPA 3CM5A 1DT9A 3MK6A 1BCOA 3M3ZA 4KTZA 3BY5A 3A5OC 4DQ8A 4CGGA 4CHOA 2Z1IA 4CK3A 1C0TA 2Q1NA 3SMPA 1JJ2M 3QB0A 5C12A 2IOCA 1FKPA 5AZIB 3KD1E 4JLHA 2HOEA 3UIQA 1L3TA 4KH4A 5FDLA 4CGDA 3T3FA 1YJNN 1BUPA 2Z1GA 3OHRA 4DUYK 2HHXA 4QS7A 3O9SA 3THVA 4C8NA 4F8RA 4JI6K 1X9JA 4HWIA 3CG7A 4C8LA 4FJGA 4MDBA 2A41A 4A5AA 4DTUA 3LP2A 3MEEA 4IFVA 2P9LB 4WE1A 5ADXA 2WUSA 1YHQN 3ZSZA 1U2VA 4DTJA 3OTOK 3LPTA 4DV6K 3VEVA 4NCBA 2FLOA 4DFKA 5LY3A 2Q0RA 3FZLA 5H1SQ 3HRGA 4PA1A 4OGEA 1QTMA 2P9PB 1HNZK 3G4SN 4E1MA 4Q5VA 1KC8O 4N47A 1XWLA 1RILA 4WFNL 2R7YA 1C0UA 2FSKA 1Q7YO 1YAGA 4CF1A 2WC9A 1ATRA 3M5RA 4A59A 1QS4A 2BTFA 3ZLJA 3SUNA 4K8ZA 2D0OA 1X9MA 1EP4A 4FYDA 3DM2A 2F96A 3WXJA 2BANA 4BC3A 1K8AO 5AFUA 2B5JA 1NGCA 4DV5K 1IKYA 3K5NA 4CEEA 3VA0A 4NLBA 5KGXA 3ISNC 3QEIA 4YOVA 4O55A 4GVMA 2O8EA 4KPYA 4E0DA 4CJTA 4BR9A 4KH6A 4MO4A 4HTUA 1CZBA 1RT5A 3AVLA 4JKGB 1BO5O 1WSGA 4DFMA 2NRZA 1RDBA 4B1WB 2HBMA 1X3MA 3PO4A 4JI2K 3U8XA 3SCXA 4RWTA 4AH9A 4AQYK 2ZD1A 4JS5A 3MCAB 4N5SA 3ULEA 4IG3A 4ZTJA 5HBMA 5GIPA 3NF6A 4FK4A 2IVNA 2JLEA 3RR7A 1ZXOA 4X66K 3VQCA 4QS9A 3I56N 3OA9A 1M90O 4JI1K 4OKJA 3H3OB 3MN7A 1U6ZA 1QQNA 4E89A 1JKHA 1C0MA 1NNEA 1SUQA 3EY1A 3SJJA 3VQAA 2BUPA 3D2FB 5KPTA 4DTXA 1T03A 3EE9A 4LFBK 1WSFA 3V9WA 4Y1DA 4FWSA 1S9GA 3TABA 1HQUA 3DLLL 4HUFA 4M3UA 4YOYA 3BZKA 4NXMK 2OYQA 4X62K 3OYGA 3KD5E 4YDUC 3I0SA 3BZCA 3KLGA 5AQFA 3BUZB 1HNWK 3OS1A 3D2EB 3AGRA 1BA1A 1SS6A 2YKMA 5KPRA 1A5WA 5AZJA 3AAPA 4BWJA 3V81A 4BRQA 1K8KB 3LP3A 5LJVA 1HKBA 3OYAA 4E3SA 2DY4A 3DLRA 1JCEA 3AO5A 4B1YB 1U48A 3H3NO 3UKRB 1OH5A 5FLXO 1XUPO 2KQ2A 3VQ4A 2XHBA 4FVUA 1S22A 2A5XA 3LWMA 3BF1A 1GLDG 3VGLA 1IV0A 4H5TA 3O08A 2O4GA 1Q82O 4PWDA 1S6QA 5D3GA 4CD3A 3QBWA 1L3UA 4OPHA 3Q7BA 4WQ5A 3T1YK 4ILHA 1GLJO 3SQ2A 2JWLA 4CJ5A 3G0ZA 3MECA 4CFDA 3QO9A 2F9WA 4NCGA 4CF0A 1VSEA 2YHXA 1VSDA 2G8HA 4M3TA 2QI2A 2IC3A 5AQYA 4FJXA 4DSJA 2QWOA 3ZT0A 5LMUK 4FCYA 3VQ9A 4Z94A 4W5OA 1BA0A 4H4OA 2FSNA 3CFPA 1KFDA 1KAYA 2QWQA 1VSFA 4M42A 1SZ2A 4N41A 2P9UB 2KZZA 2VG6A 3KWIA 3TTFA 5CY4A 4ELVA 4LSNA 1I39A 4LF4K 4Z4IA 1RT1A 3P4IA 1N34K 4KFBA 1D9DA 3W0LA 2BH1A 1QVGM 1KAZA 3G25A 4JHDB 3ATUA 1TGOA 1MA9B 4FM0A 4Z4HA 3ZT4A 4CEDA 2E2NA 1BISA 1VSHA 1CXQA 4FLXA 1Z26A 1NGIA 1B9FA 3KKRA 2IGIA 4B3RK 4B08A 4IFEA 5HRSA 3LAKA 1ZBLA 3E01A 5I3UA 1V4SA 3EEQA 4KHNA 3UKUB 3ULDA 4B3SK 4H5WA 2QTDA 4A57A 3P31A 1T6CA 1ZBUA 3M1FA 2FF6A 1ZBIA 4M7YA 3HI0A 3VQBA 2GV9A 3L2WA 4DSFA 2ASPA 1SL1A 3KVGA 3IMXA 1E4FT 3M8SA 1J5OA 4BE1A 2PY5A 2VQEK 4IOCL 3QEPA 3QEWA 3KLFA 1P90A 4JN4A 4CJQA 3H6EA 3A8YA 3J7ZO 4JRPA 2J4RA 3DLGA 3SZ2A 3DXKA 3G10A 3R1XA 2KW4A 3TU5A 3VTIA 4A2AA 4F3TA 4EFHA 1BG3A 3DRRA 1WB9A 3J7YP 2EX3A 3V9ZA 1GLCG 1HRHA 5F0XA 1UA1A 1IKWA 4CZEA 1EQYA 3NH0A 5BPNA 1VAZA 3E9OA 1ZC6A 1BQNA 4BACA 4LFAK 3QBXA 4YORA 4FXDA 4CERA 1I94K 4O5FA 4CCHA 3CCRN 4N56A 5EXWA 3VQDA 1TKXA 1NGAA 4FL9A 3S3NA 2Q3SA 2A40A 1TL3A 4DTNA 3CCLN 4JK7A 3C6UA 4WYBA 1W9HA 1P8ZA 1LWCA 1VK0A 2E6LA 4BRIA 1FW6A 3R3LA 3LZJA 3J8AA 3VEZA 3NH2A 4BRHA 2O8BB 4WQ4A 2UUBK 1XC3A 3VN5A 4DS4A 1HUXA 1YVUA 3TAEA 4W5NA 3DLBA 4FLUA 4CBXA 1VQ7N 4DR5K 4CGFA 3CFOA 1RBSA 4UY8O 3CXCM 1RFQA 1TYQB 1HNXK 2P9NA 2JWKA 1VQ5N 3E9LA 2DFFA 3OYBA 3QMLA 3ZT3A 3A2FA 4LH4A 1QQOA 2V7ZA 3NE6A 2GWKA 2P9IA 1OVYA 3QFPA 3CCMN 1YVNA 3GE1A 2W42A 4ID5A 4F2RA 2XY7A 3THXB 4R5PA 5DM6L 2G8IA 5BRDA 4DV3K 1S5JA 4DQPA 4IFYA 4FJHA 3LPUA 5MLCQ 1NM1A 3U6FA 2Z1HA 2A42A 4M3RA 4LF7K 4FWNA 5CYQA 1Q8IA 3O1BA 4I7FA 4H5NA 1NGGA 3WNGA 5GADP 5GAHP 2HHSA 4FJKA 5J2MA 1TAQA 2HMPA 3PV8A 4DFJA 3WQTA 4CHPA 5SZTA 3O9RA 3WXMB 4GV6A 4KKOA 1WNSA 3C0BA 3TTCA 2QK9A 4J8FA 1SL2A 2HHWA 2NRWA 3CERA 1LAVA 3VQ5A 4JYAK 3FFKB 2HBJA 1N36K 1WSJA 1MWMA 4PL7A 3EL2A 5EOYA 1HLUA 2DTUA 1UOCA 1BCMA 3QICA 4DR1K 2O8DB 1L5UA 4FLTA 3THYA 4OVLA 4PUOA 1VSMA 2JGUA 4IEEA 3CJ7A 2HW3A 3SAHA 4JI0K 2IAJA 4Z4FA 4B9NA 3OYLA 3VEXA 4R79A 2OTLN 1YXQA 3OYHA 5KQDA 2YHWA 4BR2A 4CGIA 1XC9A 1FK9A 3ZETB 3A5MC 4CZGA 4BRDA 2A1SA 2HHQA 4NYFA 5BPLA 3L0QA 3O4QA 2BGGA 3PSFA 4BRAA 4DS5A 3SUOA 4I6MB 4KI4A 5CZ1A 1OH7A 3PIOL 4GKKK 2ATQA 1RDWX 4YOUA 1KVBA 3DOLA 5CE3A 3KLEA 4IWVA 4JD2B 1D5AA 1SAZA 3RTVA 3RMAA 2Q31A 4BC5A 4EZ9A 2W41A 3EN9A 2UXCK 1J9AA 2E4LA 2V51B 4FWKA 2OPRA 4H8KA 2P9SB 2HHVA 5EU7A 4M3XA 4FZYA 4NB4A 4YOXA 1MU2A 1C6VA 2QWPA 3ZSXA 3V1OA 3WQUA 3KTQA 4BRCA 2Y1IA 3SAFA 2HHUA 3O3GA 3MCPA 4B9MA 5CHIA 3LAMA 1U4BA 3K5OA 4FM1A 1X3NA 3KK1A 3ZT2A 3S41A 4GV3A 3VEYA 3J80O 4JV5K 5A2QO 5AQNA 5M1QA 1LOTB 4FZZA 2VYPA 3AY9A 4KH5A 1W0HA 4BGAA 2D0BA 4JKCA 4Y1CA 3NH1A 4DUZK 4MDAA 4IJAA 2NRTA 3KZBA 4CBUA 3DRPA 4BR5A 3WT0A 3QEVA 3F73A 3NBPA 2WFBA 1TK8A 5JVGL 3AVBA 4JKBA 1G99A 2PYJA 4DMNA 4O8UA 4Z4EA 4IO8A 3CHWA 1NJIO 3M8PA 1NOZA 4B8CA 3CJ1A 4B1XB 1Q81O 5TKYA 3VQ7A 4BQZA 5TKWA 1DGKN 4LC9B 1ASUA 4IOAL 4KBOA 1XMQK 1RDDA 4RG8A 4GY2B 3BDPA 3FE1A 1IBLK 5AQOA 1NGDA 4OLAA 4DU3A 3H46O 3SLCA 3TANA 2VG5A 3AVKA 1WSIA 2GTDA 1RTDA 2RKIA 1EKEA 3TARA 2ASMA 4CI6A 1KVAA 3HPHA 3ZCMA 3QNNA 5GAGP 2P9LA 2E2QA 3VA3A 3VF4A 3R9PA 3C6TA 3H45C 3LALA 2AJQA 2OPSA 4RW9A 2F4VK 4DWIA 2CH5A 1KXPA 4FJJA 5EX5A 2HSTA 2OPQA 5KTQA 2QW9A 4F2SA 4H5VA 3SPZA 3C7NA 4YOTA 4CEQA 2KHOA 1R0AA 4W5TA 4ICLA 4DTPA 3ZEUA 3P1GA 1K73O 3DLKA 1JXBA 4F4KA 1HPMA 3OW2M 2CH6A 1ZBHA 5KRTA 1BIZA 3OYIA 3NGZA 4FWOA 3W3DA 3ZSVA 3SNNA 4H03B 2CGKA 4CEZA 1HKCA 1SL0A 2ETJA 1U2VB 5AQSA 3HPGA 4EP4A 3U9DA 1YT3A 1JLAA 3HYFA 4U7BA 4BR0A 2P5OA 1VQ9N 3HM9A 3CIPA 3V9SA 5CR4A 1HKGA 4TSXA 3SK3A 4FWRA 3HVRA 1NGFA 3A0IX 4CD1A 3V9UA 1S1WA 4PKGA 2UU9K 3FZHA 3LDOA 1Q9XA 1ZBSA 4Y0WA 4IKFA 3A5LC 4ELTA 3O80A 1Z25A 4FO0A 4K25A 4CEBA 5AQQA 4KREA 1EETA 1VQNN 3F9KA 4GVEA 3U9ZA 4L3QA 4M3WA 1N5YA 4AHCA 1U47A 4NLCA 1GOAA 2XY8A 4LF8K 4OX9K 2F8SA 2HBLA 3IG1A 2YHYA 3VQQA 4DR3K 1Y97A 1NWKA 3VMFB 3T7ZA 4B3TK 3AVMA 5K14A 1VRUA 1JCGA 2EWSA 2ZGYA 3HL8A 2O8EB 3HOTA 1TKTA 5JS2A 2EHGA 1TVRA 4K41A 3CCSN 4CZHA 4LD0A 4LF5K 1ZBFA 2CGLA 4CZMA 3O8MA 4BE2A 2DFHA 3QDKA 1KLMA 2E6MA 5T7BA 3K59A 3THWA 1VQ6N 5BRHA 3I33A 1N33K 4O8KA 1SQKA 1JLEA 5J2NA 4OO1J 3AAQA 1KTQA 4CFCA 4I2PA 3ULEB 3U3YA 3KHYA 2CGJA 2G8KA 4DG1A 3K57A 4CHZA 5BRFA 4CJLA 4CESA 1NKEA 1YJ9N 3VQ6A 3JAMO 4KHQA 3ZT1A 2G8VA 2O4IA 1RTJA 1TUYA 1TUUA 3IKMA 3T1HK 3I8BA 2ZM6K 2VG7A 1RDCA 1TL1A 3H1VX 3CQYA 2QWRA 3UKRA 3B8AX 1FJGK 2O8FA 3HO1A 2W6LA 3D6RA 3AO2A 4DSIA 3NF8A 4JNEA 1IO2A 3I0RA 5FPMA 1OH8A 3MXMA 1KFSA 1S9EA 4CEAA 4RW7A 3JSMA 3K9JA 3CPEA 4CZKA 3JXUA 3CCQN 1WN7A 4PQUA 5AQKA 4FLWA 2PBDA 1REVA 3TTDA 2QXLA 2ITMA 1SKRA 5CZ2A 4CBWA 1C0GA 2HHTA 5AZJB 2RE2A 3SJHA 1YTAA 4DCHA 4AHTA 1CZ9A 4DTRA 5AQZA 3F5TA 2OZSA 3DWLA 4BQLA 2FBYA 2E5LK 5F1XA 3IUCA 5E41A 4B1ZA 1NJZA 5FROA 3DXMA
chains in the Genus database with same CATH topology
4CBXA 1VQ7N 3G6EN 2FSJA 4JKAA 2NRXA 2E88A 2ASOA 4CZIA 3M6GA 1GLEG 4UY8O 4BG8A 5AQIA 4MLEA 1RFQA 1TYQB 4XEIA 3SMSA 3CXCM 1YF5L 2P9NA 4JKEA 5AQMA 2JWKA 1QHAA 4CZJA 5KQ8A 3CMEN 1W2BM 1VQ5N 1KD1O 3E9LA 3VGMA 4EIAA 3E9PA 3E66A 5M1PA 4C23A 1YI2N 4JK8A 3QMLA 3CPWM 2ZJPL 3T69A 3TSQA 1E4GT 1S3XA 3VPZA 4C1NI 1Z05A 5JMVA 1QQOA 5HOOA 1XQSC 2V7ZA 5KPZA 2HF4A 4EAHD 3ZYYX 2GWKA 2P9IA 2RHKA 3OBWA 1OVYA 3QFPA 3TPQA 1YITN 3CCMN 3FGUA 2QWNA 5BPMA 1N8RO 1YVNA 3GE1A 1ESVA 3IDHA 2GEMA 4IZ9A 2A6AA 1NGJA 4BVPA 1CZAN 5AQWA 5BR9A 4K42A 5DM6L 5BRDA 3RVCA 4PL8A 3RSEA 2KLAA 3D2FA 2OTJN 4E1JA 5MLCQ 1NM1A 2P9KA 2NRRA 3HOSA 4CJ7A 5C15A 1VQ8N 2A42A 1WUAA 2Q2RA 3WEEA 4B9QA 4IO9L 3FR0A 4FWNA 2NZTA 4IXCA 3VGKA 3CCVN 3O5BA 3MMVA 3O1BA 4H5NA 1NGGA 2Q0UA 1DT9A 5GADP 5GAHP 3MK6A 4MLHA 1GLAG 3M3ZA 4EHTA 2HMPA 3WQTA 1Y64A 3MN5A 3A5OC 3O6WA 4DQ8A 3O9RA 3DJCA 1HJOA 5EVZA 2AP1A 3WXMB 3ZX3A 5M1FA 3VETA 4GV6A 2Q1NA 3SMPA 3C0BA 3TTCA 1JJ2M 4J8FA 4FOEA 2Q36A 5AQTA 3QB0A 5DM7L 4JKFA 2NRWA 3GBTA 3R8EA 3D2EA 3R6MA 5C12A 3CERA 5AZIB 2GX9A 2HOEA 3FFKB 2HBJA 2D4WA 1BWFO 1QZ6A 4KH4A 3F9MA 4BR4A 3MWPA 1MWMA 1YJNN 1BUPA 3OHRA 2ZWHA 4H5RA 4PL7A 4IDHA 3EL2A 1K8KA 5AQPA 4QS7A 5EOYA 3O9SA 3OBYA 3ID8A 3VEWA 1HLUA 5C0YA 1GLLO 2YX6A 4BRMA 5JLHA 3QICA 1X9JA 4HWIA 1BOTO 4MDBA 2A41A 4A5AA 4A2BA 1YJWN 3DAWA 4IEEA 3GG4A 5AQGA 3CJ7A 3SAHA 3CQXA 3VEXA 4R79A 2OTLN 1K9MO 1YXQA 1NMDA 5KQDA 2P9LB 1QVFM 2YHWA 4BR2A 5ADXA 2WUSA 4FWQA 3ZETB 5JICA 1YHQN 1U2VA 3A5MC 4CZGA 3K9KA 4BRDA 2E20A 3VEVA 4U67L 3SBGA 2AA4A 2FLOA 5LY3A 4C1NK 1Q86O 2Q0RA 3FZLA 5H1SQ 3HRGA 3L0QA 5BPLA 3SBTA 4BRAA 3TSUA 1ATNA 4PHTX 4I6MB 4M7XA 2E2PA 4BG9A 2P9PB 1NGBA 1KAXA 3MN6A 3G4SN 3PIOL 1RDWX 3MX2A 4YOUA 4DHYA 2I7NA 1KC8O 5CE3A 3DXKB 4IWVA 4G9ZA 4JD2B 1SAZA 3C6HA 2Q31A 4BC5A 3ID6A 4WFNL 3VOVA 2FSKA 4JKDA 1Q7YO 1YAGA 3P39A 1M1KO 2W41A 3EN9A 5FPDA 2WC9A 3CETA 1ATRA 5AQXA 3M5RA 4A59A 1LCUA 2BTFA 1BDGA 2V51B 4FWKA 5BN9A 2D0OA 2P9SB 2NNWA 4NB4A 4YOXA 2H3GX 3WXJA 4F9OA 2QWPA 5BN8A 1IJJA 2NRVA 3WQUA 4B1VA 4BR7A 4BRCA 4RCHA 2KKZA 3UE5A 4BC3A 4EHUA 5AFUA 1K8AO 3EKUA 3SAFA 1NGCA 2D1KA 5C10A 4BRNA 4XH5A 3HM8A 4NLBA 3IFRA 5GINA 1MDUB 3MCPA 5CHIA 4M63C 4YOVA 2P9UA 1X3NA 2HBKA 3S41A 5JVHL 4GV3A 3VEYA 4GV9A 3FZKA 2OANA 3VENA 3QFUA 5AQNA 5M1QA 1LOTB 4BR9A 4CZLA 2VYPA 3AY9A 1OKJA 4KH5A 4BVOA 4BGAA 4KH6A 4JKCA 4MO4A 3CC7N 4AM6A 4JHDA 4MDAA 1VQKN 4JKGB 1BO5O 4IJAA 2NRTA 3KK7A 3KZBA 3DXMB 2NRZA 3VF6A 4CBUA 4B1WB 1Q18A 4BR5A 2HBMA 5GAEP 1X3MA 3U8XA 3WT0A 4RWTA 3CCJN 5FPNA 5AQVA 1T44A 2P9NB 4BRLA 2WFBA 2W40A 5M1KA 3GOIA 5JVGL 4JKBA 3MCAB 1RGIA 5C2DA 1G99A 3ULEA 3UKUA 4O8UA 4IO8A 5GIPA 3CHWA 2UYTA 1S72N 3CMAN 4H0PA 1NJIO 2IVNA 1ZXOA 3CJ1A 4B1XB 1VQON 1Q81O 2P9IB 4QS9A 5TKYA 3I56N 3OA9A 1M90O 4BQZA 3H3OB 3MN7A 4PKHA 1DGKN 1U6ZA 5TKWA 3TSPA 3U4LA 3ZX0A 4LC9B 4A62A 1QQNA 4IOAL 4KBOA 3BEXA 4IOXA 4NO7A 1QQMA 5C2FA 4JEPA 4FWPA 3FZMA 4FWMA 4GY2B 3FE1A 3LDNA 3RSEB 2BUPA 1QZ5A 3MWTA 3HSCA 4AF1A 3D2FB 5KPTA 3G71N 3CCEN 2P9KB 5AQOA 4WFBL 4BY9C 3O9QA 1O13A 3EE9A 1NGDA 5EY4A 3C65A 3H46O 3SLCA 2A3ZA 3L4IA 1HX1A 1GLFO 4FWSA 2GTDA 2NRHA 3BF3A 3PLAA 4CZFA 2ASMA 4CI6A 3DLLL 3VF2A 5FPEA 4YOYA 3LM9A 4H0YB 5GAGP 2P9LA 2E2QA 4JK9A 4YDUC 3VF4A 3PIPL 3N4QA 1EO1A 3R9PA 5AQHA 5HL7L 1V4TA 5I9EB 4WFAL 3H45C 4DKWA 3MDQA 5AQFA 5AQLA 3BUZB 2QA4N 3ENOA 4QS8A 3FZFA 3D7EO 2CH5A 3D2EB 1KXPA 3AGRA 1BA1A 1SS6A 2QM1A 5EX5A 4WQ5C 4I6MA 5GIOA 5KPRA 4IEIA 2HSTA 5AZJA 3EZWA 3AAPA 3VESA 2QW9A 4BRQA 4H5VA 4BRPA 1K8KB 1VQLN 1W97L 3C7NA 3WUHA 5LJVA 2ZGZA 4YOTA 1HKBA 3UB5A 1JCEA 2KHOA 4ISGA 4B1YB 4BREA 3H3NO 3N4PA 5AR0A 3ZEUA 3CJAA 3ENBA 3UKRB 1K73O 1R59O 4K43A 1HPMA 3OW2M 2CH6A 5AQRA 1XUPO 1RDUA 3ENHA 1JCFA 3L4QA 4FWOA 3W3DA 4BRKA 4H03B 2CGKA 4FVUA 1HKCA 3EO3A 2E1YA 4A5BA 1S22A 2A5XA 3EKSA 3ZX2A 4MO5A 3BF1A 2F7TA 3HTVA 3LM2A 1GLDG 1U2VB 3VGLA 4YDUA 1TYQA 2DPNA 5AQSA 1ATSA 4H5TA 1T3VA 3AARA 3O08A 5F2RA 3AGKA 3U9DA 1Q82O 3VTHA 3HBTA 4CD3A 3QBWA 1DKGD 4U7BA 4BR0A 3CC2N 4BRFA 3ATVA 2VGMA 2ZJRL 1VQ9N 3CIPA 1GLBG 4H0TB 3Q7BA 1HKGA 4OPHA 4WQ5A 5CR4A 4FWRA 1GLJO 1NGFA 3E1YA 4ILHA 2JWLA 4XH4A 3A0IX 4FWLA 4ISEA 4CD1A 2PFUA 4PKGA 3FZHA 3LDOA 3CC4N 2VCPA 1ZBSA 2F9WA 4Y0WA 1WOQA 3A5LC 4RTFD 4JAXA 2YHXA 2IVOA 4A61A 4XH1A 2QI2A 4YOWA 3CD6N 3O80A 1YIJN 4FO0A 3CJCA 5AQYA 4K25A 1VQPN 2QWOA 5AQQA 2YJEA 2QWLA 1NBWA 2E2OA 4BC2A 4Z94A 1VQNN 3U9ZA 4GVEA 4L3QA 3NVMA 4NLCA 1BA0A 3F2KA 5M1NA 3MN9A 4GNIA 3VEOA 4BC4A 2HBLA 3MX5A 1Z6RA 1C0FA 2FSNA 2YHYA 3H1QA 1MWKA 1NWKA 3VMFB 3T7ZA 3P38A 1KAYA 3I55N 1JCGA 2EWSA 2QWQA 3EE8A 1SZ2A 2V52B 2ZGYA 2P9UB 3NMUA 3KWIA 3GL1A 3TTFA 5B8HA 3HOTA 3O4WA 3SAGA 3KWGA 4K41A 3CCSN 4WF9L 5ELZA 2E8AA 1YUWA 3P4IA 3O9UA 2NLXA 4AM7A 5AZIA 3W0LA 2BH1A 1QVGM 4CZHA 1J6ZA 2CGLA 3L6QA 4CZMA 1KAZA 3G25A 4JHDB 1VQMN 3ATUA 3CJ9A 4ILJA 1MA9B 3O8MA 5ADXH 4FOIA 2YJFA 3QDKA 3JS6A 2E2NA 4B1UB 1NGIA 1VQ6N 3WEEB 4IFEA 2IVPA 5BRHA 2HF3A 3I33A 2QWMA 5E26A 4O8KA 1SQKA 2IIRA 1V4SA 4PKIA 3AAQA 3VERA 4OO1J 2D0PA 3UKUB 3ULEB 5BREA 3LL3A 4H5WA 3CI5A 2ZJQL 2QTDA 3KHYA 2QEXN 3NVKA 1VQ4N 4A57A 3P31A 1T6CA 3CJBA 2CGJA 4H0OA 3C6AA 4IJNA 3M1FA 2FF6A 3LDQA 5BRFA 4M7YA 3ZETA 3HI0A 1YJ9N 3LDPA 2ASPA 2F9TA 2YI1A 3KVGA 3IMXA 1E4FT 2ZF5O 1TUYA 1TUUA 3IKMA 1ILYA 3FLCO 4IOCL 4H0VB 4ISFA 3I8BA 1P90A 5AQJA 2E1ZA 1DEJA 2V7YA 4JN4A 2P9PA 3H6EA 3H1VX 4FPBA 3A8YA 3SK3A 3CQYA 2J4RA 4H0XB 3J7ZO 2QWRA 3WXKA 3UKRA 5AFUH 4BROA 3B8AX 3DXKA 3R1XA 4WQ4C 4JD2A 2GUPA 2I7PA 3A5NC 3TU5A 5JLFA 3VTIA 3Q7CA 1D4XA 3BP8A 3D6RA 4A2AA 4EFHA 1BG3A 1GLCG 5F0XA 4JNEA 1H1VA 1KQSM 2GWJA 2VGNA 5M1OA 4CZEA 1EQYA 5FPMA 1BU6O 5BPNA 1VAZA 1NGEA 2P9SA 3E9OA 1ZC6A 1NLVA 3CF5L 3K9JA 3CPEA 4CZKA 3JXUA 3CCQN 3QBXA 4YORA 5AQKA 2PBDA 2Q97A 3O1WA 2PAVA 4FSVA 4O5FA 3TTDA 4BRGA 2QXLA 1NGHA 2ITMA 3CCRN 4CBWA 1C0GA 3WXIA 5AZJB 2RE2A 5EXWA 2VWBA 4WCEL 3SJHA 3LDLA 1NGAA 4FL9A 4DCHA 3HZ6A 4JKHA 4BGBA 4HTLA 2A40A 3O9TA 5AQZA 1IG8A 3C7NB 4JK7A 4DB3A 3GDQA 3CCLN 3F5TA 4FPAA 4WYBA 3DWLA 1P8ZA 3WXLA 4BQLA 2FF3B 2YCHA 5LJWA 3ZEUB 4BRIA 5F1XA 3IUCA 2WBNA 3R3LA 3J8AA 3VEZA 5AQUA 2GELA 4B1ZA 4ILGB 4BRHA 2FXUA 4WQ4A 1XC3A 4JKGA 3CCUN 1T6DA 1HUXA 4OPAA 5E84A 3DXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBX A;  2FSJ A;  4CZI A;  2E88 A;  2ASO A;  3M6G A;  1GLE G;  4BG8 A;  5AQI A;  4MLE A;  1RFQ A;  1TYQ B;  4XEI A;  3SMS A;  2P9N A;  5AQM A;  5KQ8 A;  1QHA A;  4CZJ A;  3VGM A;  4EIA A;  4C23 A;  3QML A;  1E4G T;  1S3X A;  3VPZ A;  1Z05 A;  5JMV A;  1QQO A;  1XQS C;  2V7Z A;  5KPZ A;  2HF4 A;  4EAH D;  2GWK A;  2P9I A;  3QFP A;  3TPQ A;  3FGU A;  2QWN A;  5BPM A;  1YVN A;  3GE1 A;  1ESV A;  3IDH A;  2GEM A;  4IZ9 A;  2A6A A;  1NGJ A;  4BVP A;  1CZA N;  5AQW A;  5BR9 A;  4K42 A;  5BRD A;  4PL8 A;  3RSE A;  3D2F A;  4E1J A;  1NM1 A;  2P9K A;  4CJ7 A;  2A42 A;  1WUA A;  2Q2R A;  3WEE A;  4B9Q A;  3FR0 A;  4FWN A;  2NZT A;  4IXC A;  3VGK A;  3O5B A;  3MMV A;  3O1B A;  4H5N A;  1NGG A;  2Q0U A;  3MK6 A;  4MLH A;  1GLA G;  3M3Z A;  4EHT A;  2HMP A;  3WQT A;  1Y64 A;  3MN5 A;  3A5O C;  3O6W A;  4DQ8 A;  5EVZ A;  3DJC A;  1HJO A;  2AP1 A;  3ZX3 A;  3VET A;  2Q1N A;  3SMP A;  3C0B A;  4J8F A;  4FOE A;  2Q36 A;  5AQT A;  3QB0 A;  3GBT A;  3R8E A;  3D2E A;  3R6M A;  3CER A;  5AZI B;  2HOE A;  3FFK B;  2D4W A;  1BWF O;  1QZ6 A;  3F9M A;  4BR4 A;  1MWM A;  1BUP A;  3OHR A;  2ZWH A;  4H5R A;  4PL7 A;  3EL2 A;  1K8K A;  5AQP A;  4QS7 A;  5EOY A;  3VEW A;  3ID8 A;  1HLU A;  1GLL O;  4BRM A;  5JLH A;  3QIC A;  1X9J A;  4HWI A;  1BOT O;  2A41 A;  4A2B A;  3DAW A;  5AQG A;  3GG4 A;  3CJ7 A;  3CQX A;  3VEX A;  1YXQ A;  1NMD A;  5KQD A;  2P9L B;  2YHW A;  4BR2 A;  5ADX A;  2WUS A;  4FWQ A;  3ZET B;  5JIC A;  1U2V A;  3A5M C;  4CZG A;  4BRD A;  2E20 A;  3VEV A;  2AA4 A;  2FLO A;  5LY3 A;  3FZL A;  2Q0R A;  5BPL A;  3L0Q A;  4BRA A;  1ATN A;  4I6M B;  4M7X A;  2E2P A;  4BG9 A;  2P9P B;  1NGB A;  1KAX A;  3MN6 A;  1RDW X;  4DHY A;  2I7N A;  5CE3 A;  3DXK B;  4IWV A;  4JD2 B;  1SAZ A;  2Q31 A;  4BC5 A;  3VOV A;  2FSK A;  1YAG A;  2W41 A;  3EN9 A;  5FPD A;  3CET A;  1ATR A;  5AQX A;  1LCU A;  2BTF A;  1BDG A;  2V51 B;  4FWK A;  5BN9 A;  2D0O A;  2P9S B;  4NB4 A;  2H3G X;  3WXJ A;  4F9O A;  2QWP A;  5BN8 A;  1IJJ A;  3WQU A;  4BR7 A;  4B1V A;  4BRC A;  4EHU A;  4RCH A;  3UE5 A;  4BC3 A;  5AFU A;  3EKU A;  1NGC A;  2D1K A;  4BRN A;  4XH5 A;  3HM8 A;  3IFR A;  1MDU B;  3MCP A;  4M63 C;  2P9U A;  1X3N A;  3S41 A;  3VEY A;  3FZK A;  2OAN A;  3VEN A;  3QFU A;  5AQN A;  4BR9 A;  1LOT B;  4CZL A;  2VYP A;  3AY9 A;  1OKJ A;  4BVO A;  4BGA A;  4MO4 A;  4AM6 A;  4JHD A;  1BO5 O;  4IJA A;  3KZB A;  3DXM B;  3VF6 A;  4CBU A;  4B1W B;  1Q18 A;  4BR5 A;  1X3M A;  3U8X A;  3WT0 A;  4RWT A;  5FPN A;  5AQV A;  1T44 A;  2P9N B;  4BRL A;  2W40 A;  3GOI A;  1RGI A;  1G99 A;  3ULE A;  3UKU A;  4IO8 A;  3CHW A;  2UYT A;  4H0P A;  2IVN A;  1ZXO A;  3CJ1 A;  4B1X B;  2P9I B;  4QS9 A;  5TKY A;  4BQZ A;  3H3O B;  3MN7 A;  4PKH A;  1DGK N;  1U6Z A;  3ZX0 A;  3U4L A;  4LC9 B;  4A62 A;  1QQN A;  4KBO A;  3BEX A;  4NO7 A;  1QQM A;  4FWP A;  3FZM A;  4FWM A;  4GY2 B;  3FE1 A;  3LDN A;  3RSE B;  2BUP A;  1QZ5 A;  3HSC A;  3D2F B;  5KPT A;  2P9K B;  5AQO A;  1NGD A;  5EY4 A;  3H46 O;  3SLC A;  2A3Z A;  3L4I A;  1HX1 A;  1GLF O;  4FWS A;  2GTD A;  2NRH A;  3BF3 A;  4CZF A;  2ASM A;  4CI6 A;  3VF2 A;  5FPE A;  3LM9 A;  4H0Y B;  2P9L A;  2E2Q A;  4YDU C;  3VF4 A;  3R9P A;  5AQH A;  1V4T A;  5I9E B;  3H45 C;  3MDQ A;  5AQF A;  5AQL A;  3BUZ B;  3ENO A;  4QS8 A;  3FZF A;  3D7E O;  2CH5 A;  3D2E B;  1KXP A;  1BA1 A;  2QM1 A;  5EX5 A;  4WQ5 C;  4I6M A;  5KPR A;  5AZJ A;  3EZW A;  3AAP A;  3VES A;  2QW9 A;  4BRQ A;  4H5V A;  4BRP A;  1K8K B;  5LJV A;  3C7N A;  3WUH A;  2ZGZ A;  1HKB A;  3UB5 A;  1JCE A;  2KHO A;  4ISG A;  4B1Y B;  4BRE A;  3H3N O;  5AR0 A;  3ZEU A;  3CJA A;  3UKR B;  1R59 O;  4K43 A;  1HPM A;  2CH6 A;  5AQR A;  1XUP O;  3ENH A;  1JCF A;  4FWO A;  3W3D A;  4BRK A;  4H03 B;  2CGK A;  1HKC A;  3EO3 A;  2E1Y A;  1S22 A;  2A5X A;  3EKS A;  3ZX2 A;  4MO5 A;  3BF1 A;  3HTV A;  3LM2 A;  1GLD G;  1U2V B;  3VGL A;  4YDU A;  1TYQ A;  2DPN A;  5AQS A;  1ATS A;  4H5T A;  3AAR A;  3O08 A;  5F2R A;  3U9D A;  3HBT A;  4CD3 A;  3QBW A;  1DKG D;  4BR0 A;  4BRF A;  3ATV A;  3CIP A;  1GLB G;  4H0T B;  1HKG A;  4WQ5 A;  3SK3 A;  4FWR A;  1GLJ O;  1NGF A;  4XH4 A;  3A0I X;  4FWL A;  4ISE A;  4CD1 A;  4PKG A;  3FZH A;  3LDO A;  2VCP A;  1ZBS A;  2F9W A;  4Y0W A;  1WOQ A;  3A5L C;  4RTF D;  4JAX A;  2YHX A;  2IVO A;  4A61 A;  4XH1 A;  3O80 A;  4FO0 A;  3CJC A;  5AQY A;  4K25 A;  2QWO A;  5AQQ A;  2YJE A;  2QWL A;  1NBW A;  2E2O A;  4BC2 A;  4Z94 A;  3U9Z A;  4L3Q A;  1BA0 A;  3MN9 A;  4GNI A;  3VEO A;  4BC4 A;  1Z6R A;  1C0F A;  2FSN A;  2YHY A;  3H1Q A;  1MWK A;  1NWK A;  1KAY A;  1JCG A;  2EWS A;  2QWQ A;  1SZ2 A;  2V52 B;  2ZGY A;  2P9U B;  3GL1 A;  5B8H A;  3O4W A;  4K41 A;  5ELZ A;  2E8A A;  1YUW A;  3P4I A;  4AM7 A;  2NLX A;  5AZI A;  3W0L A;  4CZH A;  1J6Z A;  2CGL A;  3L6Q A;  4CZM A;  1KAZ A;  3G25 A;  4JHD B;  3ATU A;  3CJ9 A;  1MA9 B;  3O8M A;  5ADX H;  4FOI A;  2YJF A;  3QDK A;  3JS6 A;  2E2N A;  4B1U B;  1NGI A;  3WEE B;  2IVP A;  5BRH A;  2HF3 A;  3I33 A;  2QWM A;  5E26 A;  4O8K A;  1SQK A;  2IIR A;  1V4S A;  4PKI A;  3AAQ A;  3VER A;  2D0P A;  3UKU B;  3ULE B;  5BRE A;  3LL3 A;  4H5W A;  3CI5 A;  3KHY A;  1T6C A;  3CJB A;  2CGJ A;  4H0O A;  4IJN A;  3M1F A;  2FF6 A;  3LDQ A;  5BRF A;  4M7Y A;  3ZET A;  3HI0 A;  3LDP A;  2ASP A;  2F9T A;  2YI1 A;  3KVG A;  3IMX A;  1E4F T;  2ZF5 O;  1TUY A;  1TUU A;  3FLC O;  4H0V B;  4ISF A;  3I8B A;  5AQJ A;  2E1Z A;  1DEJ A;  2V7Y A;  4JN4 A;  2P9P A;  3H6E A;  3H1V X;  4FPB A;  3A8Y A;  3CQY A;  2J4R A;  4H0X B;  2QWR A;  3WXK A;  3UKR A;  5AFU H;  4BRO A;  3B8A X;  3DXK A;  4WQ4 C;  4JD2 A;  2GUP A;  2I7P A;  3A5N C;  3TU5 A;  5JLF A;  1D4X A;  3BP8 A;  4A2A A;  4EFH A;  1BG3 A;  1GLC G;  5F0X A;  4JNE A;  1H1V A;  2GWJ A;  4CZE A;  1EQY A;  5FPM A;  1BU6 O;  5BPN A;  1NGE A;  2P9S A;  1ZC6 A;  1NLV A;  4CZK A;  3JXU A;  3QBX A;  5AQK A;  2PBD A;  2Q97 A;  3O1W A;  2PAV A;  4FSV A;  4O5F A;  4BRG A;  2QXL A;  1NGH A;  2ITM A;  4CBW A;  1C0G A;  3WXI A;  5AZJ B;  5EXW A;  2VWB A;  3SJH A;  3LDL A;  1NGA A;  4FL9 A;  4DCH A;  3HZ6 A;  4BGB A;  4HTL A;  2A40 A;  5AQZ A;  1IG8 A;  3C7N B;  4DB3 A;  3GDQ A;  4WYB A;  4FPA A;  3DWL A;  1P8Z A;  3WXL A;  4BQL A;  2FF3 B;  2YCH A;  5LJW A;  3ZEU B;  4BRI A;  5F1X A;  3IUC A;  3J8A A;  3VEZ A;  5AQU A;  2GEL A;  4B1Z A;  4BRH A;  2FXU A;  4WQ4 A;  1XC3 A;  1T6D A;  1HUX A;  5E84 A;  3DXM A; 
#chains in the Genus database with same CATH topology
 2DFE A;  2NRX A;  3M6G A;  4BG8 A;  4MLE A;  4XEI A;  4JKE A;  5KQ8 A;  4UQG A;  1W2B M;  3LDS A;  1KD1 O;  3VGM A;  3RR8 A;  3E66 A;  3KLH A;  4JK8 A;  3CPW M;  2ZJP L;  4AIL C;  4KHW A;  5FRM A;  1E4G T;  3VPZ A;  2UXB K;  4HHT A;  1WAJ A;  5JMV A;  3OYC A;  3DLH A;  1XQS C;  3OS0 A;  2HF4 A;  2RHK A;  3FGU A;  1WSE A;  4CJP A;  1N8R O;  2GEM A;  3OYF A;  2A6A A;  4BVP A;  4K42 A;  4X64 K;  3RSE A;  4F3O A;  2RF2 A;  2OTJ N;  2P9K A;  1S6P A;  4CJ7 A;  4CFA A;  5C15 A;  4DQI A;  4CW7 B;  3FR0 A;  3WNH A;  3TAG A;  4MLH A;  1GLA G;  2YNH A;  1EX4 A;  4O0I A;  4B9V A;  2AP1 A;  4M3Y A;  3ZX3 A;  5M1F A;  3VET A;  3TI0 A;  3L2V A;  4FOE A;  3C95 A;  3PX4 A;  2Q36 A;  5AQT A;  2Z1J A;  3GBT A;  3R8E A;  3R6M A;  4OKK A;  4DSL A;  4LY7 A;  2GX9 A;  3RRH A;  4L8R B;  1BWF O;  1QZ6 A;  3F9M A;  4BR4 A;  3L2Q A;  3L2U A;  2ZWH A;  4H5R A;  1XNR K;  1NU0 A;  4GKJ K;  4LF9 K;  3OBY A;  3ID8 A;  1BGX T;  5IT9 O;  3DMJ A;  4BRM A;  5JLH A;  1U49 A;  1BOT O;  3L2R A;  2BE2 A;  5AQG A;  1RCH A;  1NKC A;  4CJE A;  1NMD A;  1QVF M;  5JIC A;  4FWQ A;  3AA4 A;  3HK2 A;  4CVN E;  1GOC A;  3K9K A;  4KTQ A;  2YKN A;  1Q86 O;  3DOK A;  5DMR A;  4IG0 A;  3SBT A;  1VSK A;  3TSU A;  1ATN A;  4OPJ A;  1RBU A;  2E2P A;  4BG9 A;  1NGB A;  1KAX A;  3NDK A;  3MX2 A;  3AVC A;  3DXK B;  3C6H A;  4CIG A;  3ID6 A;  4CK1 A;  1IBM K;  4JKD A;  1M1K O;  2HNZ A;  5FPD A;  1XI1 A;  3CET A;  1LCU A;  4KV8 A;  1BDG A;  3SQ1 A;  2LSN A;  5J2Q A;  3AVJ A;  4FW1 A;  1WBD A;  4G1Q A;  1A5X A;  2NNW A;  5SWM A;  2H3G X;  2KZM A;  4GMJ B;  2GUI A;  1IJJ A;  2NRV A;  4BR7 A;  4CEC A;  1RDA A;  1BI4 A;  2WOM A;  3HPO A;  5C10 A;  4BRN A;  1HPZ A;  3ZSY A;  3IFR A;  1NJW A;  3TR8 A;  1T05 A;  4NYN A;  4M63 C;  4BDP A;  3V1R A;  5C42 A;  2HBK A;  3RWU A;  4DF4 A;  3ZSW A;  4GV9 A;  3FZK A;  3VEN A;  3PSI A;  3V1Q A;  1HNI A;  4CZL A;  1TK0 A;  1OKJ A;  4CK2 A;  2W6K A;  3CC7 N;  3D45 A;  4CJ3 A;  3KJV A;  3L8B A;  4AM6 A;  2A1R A;  4I2Q A;  4CJS A;  3KK7 A;  4E7H A;  3VF6 A;  5KGW A;  3NF9 A;  4J2A A;  1Q18 A;  5DK5 A;  4HUE A;  2KFZ A;  5AQV A;  2P9N B;  2W40 A;  3GOI A;  4LFC K;  1RGI A;  3I8D A;  2OA8 A;  1RBT A;  1U04 A;  4H0P A;  2KTQ A;  4DTM A;  2P9I B;  4M45 A;  1DTQ A;  4PKH A;  3ZX0 A;  1D9F A;  5I42 A;  3U4L A;  4A62 A;  3MAQ A;  2Y1J A;  3BEX A;  1QQM A;  4DV4 K;  5C2F A;  4CJW A;  3SV4 A;  4FWP A;  4FWM A;  3LDN A;  3MWT A;  1QZ5 A;  1XNQ K;  3TAQ A;  3O4N A;  3CCE N;  1UAX A;  1IKX A;  2ZE2 A;  3O9Q A;  1O13 A;  2A3Z A;  2D0C A;  4QAG A;  3L4I A;  3SV3 A;  1HX1 A;  1JLB A;  3MXJ A;  2NRH A;  3PLA A;  4FW2 A;  4C8K A;  1KSP A;  4I9Q A;  1DLO A;  2D0A A;  4CGJ A;  5AQH A;  3K5L A;  3V4I A;  1V4T A;  5I9E B;  3DLE A;  4WFA L;  4DKW A;  3MDQ A;  4RW8 A;  1XHX A;  1LW0 A;  1RT7 A;  5AQL A;  2QA4 N;  1G15 A;  1JLG A;  4WQ5 C;  2YNG A;  1RBR A;  1RT6 A;  4I6M A;  4OPK A;  4IEI A;  1VSL A;  2OCE A;  3EZW A;  2NUB A;  1Q9Y A;  1RT4 A;  4BRP A;  1VQL N;  1B92 A;  1W97 L;  2ZGZ A;  3J81 O;  1LWF A;  3N4P A;  5IWA K;  4O44 A;  1TAU A;  2I5J A;  3THY B;  5J2P A;  4PY5 A;  4Q0B A;  4K43 A;  1JXE A;  3LAN A;  3MED A;  5AQR A;  3P5J A;  1RDU A;  3PO5 A;  1JCF A;  3L4Q A;  1TKD A;  4FK0 A;  1J53 A;  2E1Y A;  4A5B A;  4RW6 A;  3EKS A;  3ZX2 A;  2F7T A;  4B3M K;  4RW4 A;  4YDU A;  4KHS A;  2DPN A;  3QIN A;  4CIE A;  1ATS A;  4B9T A;  3HBT A;  4I9L A;  3NAE A;  4Z4G A;  4X65 K;  3LP1 A;  1DKG D;  2ZJR L;  2VGM A;  1U45 A;  1GLB G;  3ZSO A;  4XH4 A;  4FWL A;  3TAM A;  1RNH A;  4ISE A;  2PFU A;  2OZM A;  4BWM A;  3HP6 A;  3CC4 N;  2VCP A;  4JS4 A;  4E7K A;  1EXQ A;  2FBV A;  5KI6 A;  4JAX A;  2IVO A;  4DSE A;  4XH1 A;  1TKZ A;  3CD6 N;  2O8C A;  3CJC A;  1XMO K;  1VQP N;  2YJE A;  2QWL A;  1NBW A;  3T1A A;  1NK9 A;  1N32 K;  3F2K A;  4DR7 K;  4BC4 A;  3MX5 A;  3H1Q A;  1C0F A;  3PX6 A;  1JL2 A;  2OPP A;  3HT3 A;  4M41 A;  3OYD A;  4M3Z A;  4CJ4 A;  5FRN A;  1ASW A;  3EE8 A;  2V52 B;  4DLG A;  4HUG A;  3KWG A;  3M8R A;  4WF9 L;  4AM7 A;  2NLX A;  5AZI A;  1HYZ A;  1J6Z A;  1VQM N;  2HHH K;  3CJ9 A;  5ADX H;  4HCB A;  1J5E K;  3KK3 A;  4CF2 A;  3ITH A;  3WEE B;  1VHX A;  2HF3 A;  5C24 A;  3OVN A;  1T8E A;  2QWM A;  3KLI A;  4PKI A;  3RMB A;  4O4G A;  3VER A;  4FZX C;  2D0P A;  4LH5 A;  3LL3 A;  3CI5 A;  3TWH A;  1K6Y A;  2QEX N;  3NVK A;  1VQ4 N;  3C6A A;  4DV1 K;  2HVI A;  3LDP A;  3AV9 A;  1JL1 A;  3AVH A;  2F9T A;  2YI1 A;  2ZF5 O;  1ILY A;  3FLC O;  1IBK K;  4H0V B;  1SKS A;  5AQJ A;  5HRN A;  2P9P A;  3WXK A;  4BRO A;  5AFU H;  4WQ4 C;  1KRP A;  3L3U A;  5J1E A;  3Q7C A;  3SYZ A;  1D4X A;  4NCA A;  1CLQ A;  1H1V A;  2VGN A;  4CE9 A;  1BU6 O;  3CF5 L;  3OYK A;  4KI6 A;  1HNV A;  4DTO A;  3CFR A;  4CHQ A;  3LWL A;  4H4M A;  3WXI A;  1S1U A;  2VWB A;  3WNF A;  3TAF A;  4JKH A;  4BGB A;  4HTL A;  4DFP A;  3C7N B;  3BGR A;  3GDQ A;  3HP9 A;  4FPA A;  2HMI A;  1QE1 A;  2FF3 B;  2YCH A;  5LJW A;  3ZEU B;  2WBN A;  3AVN A;  4ILG B;  4E7L A;  4JKG A;  3EYZ A;  3CCU N;  2XRI A;  1T6D A;  4KB0 A;  1XHZ A;  5E84 A;  1X9W A;  4JKA A;  1I3A A;  2E88 A;  2ASO A;  4CEO A;  1GLE G;  2YHB A;  1HQE A;  1BHL A;  1YF5 L;  2HND A;  4CZJ A;  3CME N;  1NG9 A;  3E9P A;  5M1P A;  4C23 A;  3OYN A;  1BIU A;  1S3X A;  4C1N I;  4FM2 A;  1Z05 A;  4DV0 K;  5HOO A;  3QIP A;  4EAH D;  3ZYY X;  3TPQ A;  3NGI A;  1ESV A;  4IZ9 A;  1NGJ A;  1CZA N;  5AQW A;  2X74 A;  4CF8 A;  4PL8 A;  1VSI A;  3D2F A;  3K2P A;  1LW2 A;  1RBV A;  1VQ8 N;  2G8W A;  1WUA A;  2Q2R A;  4B9Q A;  2NZT A;  4IXC A;  1X9S A;  3MMV A;  2Q0U A;  2UUC K;  4FLV A;  4EHT A;  1KVC A;  1FXX A;  3O3H A;  3AVA A;  1D8Y A;  2P5G A;  1C1C A;  1Y64 A;  3MN5 A;  3O6W A;  4DLE A;  5EVZ A;  3DJC A;  1HJO A;  3QNO A;  1O1W A;  4MQ3 A;  2WTU A;  3S9H A;  2IS3 A;  3SUP A;  5DM7 L;  4JKF A;  1TV6 A;  3D2E A;  3OJU A;  4K0K K;  2D4W A;  4YNQ A;  5KRS A;  1HYS A;  3MWP A;  3U3G A;  3B6P A;  2XY5 A;  1QSY A;  1BQM A;  3RMC A;  4IDH A;  3MXI A;  3AVF A;  1K8K A;  5AQP A;  3D0P A;  4W5R A;  5HRR A;  4O5B A;  3VEW A;  1KLN A;  5C0Y A;  3THW B;  1GLL O;  1QHT A;  2YX6 A;  4C8M A;  2UUA K;  1LAW A;  2VWK A;  4A2B A;  1YJW N;  3DAW A;  5CYM A;  3GG4 A;  3CQX A;  3IS9 A;  1K9M O;  1RTH A;  4J2D A;  3J7A P;  3DI6 A;  3ASM A;  2E20 A;  4U67 L;  3SBG A;  3VQE A;  1T7P A;  2AA4 A;  4C8O A;  4C1N K;  4DSK A;  4FJL A;  4PHT X;  2P1J A;  4M7X A;  4CJF A;  1DTT A;  1HYV A;  3MN6 A;  4AHV A;  2VWJ A;  4KAZ A;  2ZQB A;  4DHY A;  1NK0 A;  2I7N A;  2HNY A;  4G9Z A;  3SPY A;  1NK6 A;  2O8F B;  4B3O A;  1UWB A;  2F8T A;  4CJR A;  2FBX A;  1RTI A;  3VOV A;  3P39 A;  1SKW A;  3KK2 A;  3LP0 A;  5AQX A;  3FFI A;  5BN9 A;  5AJ3 K;  3OS2 A;  4AHS A;  4OKE A;  3IRX A;  4F9O A;  3QIO A;  1QSL A;  5BN8 A;  4B1V A;  4DQR A;  4EHU A;  4RCH A;  2KKZ A;  3H08 A;  3UE5 A;  4HCC A;  3EKU A;  2D1K A;  4FJN A;  3HJF A;  4XH5 A;  3HM8 A;  1CXU A;  4KHU A;  2D5R A;  5GIN A;  1MDU B;  4FLY A;  3CQ8 A;  5HLF A;  2P9U A;  5LL6 Z;  4J2E A;  5JVH L;  4DV7 K;  1YTU A;  2OAN A;  3QFU A;  3OYE A;  1L3V A;  4DTS A;  4BVO A;  4FJ5 A;  4KRF A;  1S1X A;  4JHD A;  1VQK N;  5HRP A;  2XO7 A;  3DXM B;  4JI5 K;  3AO4 A;  5GAE P;  4BDY A;  3O3F A;  3CCJ N;  2YV0 X;  5FPN A;  1IKV A;  1T44 A;  4BRL A;  5M1K A;  1RT3 A;  4DQS A;  5C2D A;  2G8U A;  4OJR A;  3UKU A;  1FKO A;  1LV5 A;  2ITG A;  2UYT A;  1S72 N;  3CMA N;  1VQO N;  1IG9 A;  3PY8 A;  3KIO A;  3QES A;  2PYL A;  3TSP A;  4IOX A;  2RPI A;  4NO7 A;  1N6Q A;  4JEP A;  4E7I A;  3FZM A;  3RSE B;  4AF1 A;  3G71 N;  3HSC A;  2P9K B;  4WFB L;  4BY9 C;  5C25 A;  3AA5 X;  4V19 S;  1ZYQ A;  5EY4 A;  2HVH A;  3C65 A;  1JLQ A;  4CJU A;  3VQ8 A;  1J54 A;  3SUQ A;  1EWQ A;  1GLF O;  3PUF A;  1NMN A;  1IH7 A;  3BF3 A;  4CZF A;  3VF2 A;  5FPE A;  1VRT A;  2X6S A;  3LM9 A;  4H0Y B;  3CM6 A;  2FC0 A;  4JK9 A;  4AHU A;  3EZ5 A;  4QOZ B;  1EO1 A;  3PIP L;  3N4Q A;  1E3M A;  5HL7 L;  2XY6 A;  2X6N A;  1L3S A;  5JS1 A;  4DF8 A;  4J2B A;  3ENO A;  4QS8 A;  2B4J A;  3D7E O;  3FZF A;  4FJ9 A;  2QM1 A;  2YNF A;  5GIO A;  2PZS A;  3QEX A;  4CJV A;  4E1N A;  1ASV A;  4YFU A;  3VES A;  3OY9 A;  4B9U A;  4CJK A;  3WUH A;  1LWE A;  3UB5 A;  4ISG A;  3HXM A;  4BRE A;  1C1A A;  5AR0 A;  3CJA A;  3ENB A;  1RT2 A;  1GOB A;  3S3M A;  1JLC A;  1R59 O;  2O8B A;  1NOY A;  1VSJ A;  3ENH A;  4IBN A;  4BRK A;  4FJI A;  3AVI A;  1HJR A;  4KTW A;  3EO3 A;  4KHY A;  3K5M A;  3ALY A;  4MO5 A;  3HTV A;  3LM2 A;  3RMD A;  1OVQ A;  1TYQ A;  2YHA A;  1T3V A;  3AO1 A;  3AAR A;  5F2R A;  1HMV A;  3AGK A;  4AHR A;  4DU4 A;  2G8F A;  3VTH A;  4CHY A;  4OGC A;  1QSS A;  3CC2 N;  1WAF A;  4DR4 K;  4BRF A;  3AA2 A;  3ATV A;  3SQ0 A;  4H0T B;  3E1Y A;  4NXN K;  5BR8 K;  4W5Q A;  4EP5 A;  3ZSQ A;  2WON A;  1B9D A;  3JYT A;  1W7A A;  3THX A;  1WOQ A;  4RTF D;  4YY3 K;  1JLF A;  4QCL A;  4A61 A;  2P51 A;  4YOW A;  3OYJ A;  1YIJ N;  1F21 A;  2KFN A;  4BC2 A;  1S1T A;  2E2O A;  3LZI A;  1ITG A;  1NK8 A;  4CEF A;  1X1P A;  4DR2 K;  3NVM A;  1OH6 A;  4B8A B;  4FK2 A;  5M1N A;  3V6D A;  3MN9 A;  4GNI A;  4B9S A;  4CF9 A;  3VEO A;  3SI6 A;  1Z6R A;  1BI4 B;  5LMN K;  1UA0 A;  3PX0 A;  1MWK A;  3AVG A;  3AO3 A;  4DU1 A;  4XIU A;  3P38 A;  4Z0U A;  4YHH K;  3I55 N;  5HP1 A;  4JI3 K;  4MFB A;  3P83 D;  1TK5 A;  3NMU A;  3GL1 A;  5B8H A;  3O4W A;  3SAG A;  5ELZ A;  2E8A A;  1EWR A;  1YUW A;  3O9U A;  3QET A;  2QKK A;  3L6Q A;  4CGH A;  4DV2 K;  4ILJ A;  4FOI A;  3NF7 A;  2YJF A;  4FJM A;  3JS6 A;  4B1U B;  4ZTF A;  1WBB A;  3DYA A;  4DR6 K;  1NJX A;  4GW6 A;  2IVP A;  2O8D A;  4K8X A;  1NKB A;  5E26 A;  2IIR A;  1QQC A;  3CYM A;  5BRE A;  2ZJQ L;  4IDK A;  3CJB A;  4JRQ A;  4H0O A;  5HRO A;  3QLH A;  4IJN A;  3LDQ A;  3MEG A;  4CHN A;  3ZET A;  4BE0 A;  3NGY A;  2QKB A;  1S1V A;  2X78 A;  4CFB A;  3NCI A;  4EZ6 A;  4ISF A;  2VQF K;  2E1Z A;  1DEJ A;  2V7Y A;  4KO0 A;  2UXD K;  4CIF A;  4FPB A;  4H0X B;  4LF6 K;  2B6A A;  3B6O A;  3T19 A;  4O0J A;  4FJ8 A;  4JD2 A;  2GUP A;  4DQQ A;  2I7P A;  3A5N C;  3ZSR A;  5JLF A;  4E19 A;  3BP8 A;  4FJ7 A;  1KQS M;  3NFA A;  2GWJ A;  5M1O A;  3TAP A;  2QXF A;  1NGE A;  2P9S A;  1NLV A;  4BDZ A;  4JI4 K;  1NJY A;  2HB5 A;  3S3O A;  2Q97 A;  3O1W A;  3V9X A;  4OLB A;  2PAV A;  4FSV A;  1A5V A;  4BRG A;  1NGH A;  4WCE L;  3RRG A;  1KCF A;  3LDL A;  3HZ6 A;  3O9T A;  3IAY A;  4DB3 A;  1IG8 A;  1NK7 A;  4HVJ A;  4E7J A;  3WXL A;  1WLJ A;  2RN2 A;  4KB1 A;  1WSH A;  5AQU A;  2GEL A;  3M8Q A;  1BL3 A;  2FXU A;  2FBT A;  4ZHR A;  4B9L A;  4N76 A;  4OPA A;  3K58 A;  4JI7 K;  4FVM A;  3G6E N;  2FSJ A;  3QER A;  4CZI A;  3OYM A;  5AQI A;  3SMS A;  1NK4 A;  5AQM A;  4JI8 K;  4KHP K;  1QHA A;  4EIA A;  1C1B A;  1SV5 A;  3C94 A;  1YI2 N;  3T69 A;  3TSQ A;  4Z4C A;  3WNE A;  3AA3 A;  5KPZ A;  3HVT A;  3DRS A;  3OBW A;  3NHG A;  1YIT N;  2BDP A;  5BPM A;  2QWN A;  3IDH A;  5BR9 A;  3RVC A;  2GBZ A;  1NK5 A;  2KLA A;  4ELU A;  2IDO A;  3L3V A;  4ID1 A;  4E1J A;  2NRR A;  3HOS A;  2O8C B;  3OJS A;  2YNI A;  3WEE A;  3K0S A;  3SQ4 A;  1HR0 K;  4IO9 L;  3HST B;  3KKS A;  3CCV N;  3VGK A;  3O5B A;  4LSL A;  4FLZ A;  3VQP A;  3CM5 A;  1DT9 A;  3MK6 A;  1BCO A;  3M3Z A;  4KTZ A;  3BY5 A;  3A5O C;  4DQ8 A;  4CGG A;  4CHO A;  2Z1I A;  4CK3 A;  1C0T A;  2Q1N A;  3SMP A;  1JJ2 M;  3QB0 A;  5C12 A;  2IOC A;  1FKP A;  5AZI B;  3KD1 E;  4JLH A;  2HOE A;  3UIQ A;  1L3T A;  4KH4 A;  5FDL A;  4CGD A;  3T3F A;  1YJN N;  1BUP A;  2Z1G A;  3OHR A;  4DUY K;  2HHX A;  4QS7 A;  3O9S A;  3THV A;  4C8N A;  4F8R A;  4JI6 K;  1X9J A;  4HWI A;  3CG7 A;  4C8L A;  4FJG A;  4MDB A;  2A41 A;  4A5A A;  4DTU A;  3LP2 A;  3MEE A;  4IFV A;  2P9L B;  4WE1 A;  5ADX A;  2WUS A;  1YHQ N;  3ZSZ A;  1U2V A;  4DTJ A;  3OTO K;  3LPT A;  4DV6 K;  3VEV A;  4NCB A;  2FLO A;  4DFK A;  5LY3 A;  2Q0R A;  3FZL A;  5H1S Q;  3HRG A;  4PA1 A;  4OGE A;  1QTM A;  2P9P B;  1HNZ K;  3G4S N;  4E1M A;  4Q5V A;  1KC8 O;  4N47 A;  1XWL A;  1RIL A;  4WFN L;  2R7Y A;  1C0U A;  2FSK A;  1Q7Y O;  1YAG A;  4CF1 A;  2WC9 A;  1ATR A;  3M5R A;  4A59 A;  1QS4 A;  2BTF A;  3ZLJ A;  3SUN A;  4K8Z A;  2D0O A;  1X9M A;  1EP4 A;  4FYD A;  3DM2 A;  2F96 A;  3WXJ A;  2BAN A;  4BC3 A;  1K8A O;  5AFU A;  2B5J A;  1NGC A;  4DV5 K;  1IKY A;  3K5N A;  4CEE A;  3VA0 A;  4NLB A;  5KGX A;  3ISN C;  3QEI A;  4YOV A;  4O55 A;  4GVM A;  2O8E A;  4KPY A;  4E0D A;  4CJT A;  4BR9 A;  4KH6 A;  4MO4 A;  4HTU A;  1CZB A;  1RT5 A;  3AVL A;  4JKG B;  1BO5 O;  1WSG A;  4DFM A;  2NRZ A;  1RDB A;  4B1W B;  2HBM A;  1X3M A;  3PO4 A;  4JI2 K;  3U8X A;  3SCX A;  4RWT A;  4AH9 A;  4AQY K;  2ZD1 A;  4JS5 A;  3MCA B;  4N5S A;  3ULE A;  4IG3 A;  4ZTJ A;  5HBM A;  5GIP A;  3NF6 A;  4FK4 A;  2IVN A;  2JLE A;  3RR7 A;  1ZXO A;  4X66 K;  3VQC A;  4QS9 A;  3I56 N;  3OA9 A;  1M90 O;  4JI1 K;  4OKJ A;  3H3O B;  3MN7 A;  1U6Z A;  1QQN A;  4E89 A;  1JKH A;  1C0M A;  1NNE A;  1SUQ A;  3EY1 A;  3SJJ A;  3VQA A;  2BUP A;  3D2F B;  5KPT A;  4DTX A;  1T03 A;  3EE9 A;  4LFB K;  1WSF A;  3V9W A;  4Y1D A;  4FWS A;  1S9G A;  3TAB A;  1HQU A;  3DLL L;  4HUF A;  4M3U A;  4YOY A;  3BZK A;  4NXM K;  2OYQ A;  4X62 K;  3OYG A;  3KD5 E;  4YDU C;  3I0S A;  3BZC A;  3KLG A;  5AQF A;  3BUZ B;  1HNW K;  3OS1 A;  3D2E B;  3AGR A;  1BA1 A;  1SS6 A;  2YKM A;  5KPR A;  1A5W A;  5AZJ A;  3AAP A;  4BWJ A;  3V81 A;  4BRQ A;  1K8K B;  3LP3 A;  5LJV A;  1HKB A;  3OYA A;  4E3S A;  2DY4 A;  3DLR A;  1JCE A;  3AO5 A;  4B1Y B;  1U48 A;  3H3N O;  3UKR B;  1OH5 A;  5FLX O;  1XUP O;  2KQ2 A;  3VQ4 A;  2XHB A;  4FVU A;  1S22 A;  2A5X A;  3LWM A;  3BF1 A;  1GLD G;  3VGL A;  1IV0 A;  4H5T A;  3O08 A;  2O4G A;  1Q82 O;  4PWD A;  1S6Q A;  5D3G A;  4CD3 A;  3QBW A;  1L3U A;  4OPH A;  3Q7B A;  4WQ5 A;  3T1Y K;  4ILH A;  1GLJ O;  3SQ2 A;  2JWL A;  4CJ5 A;  3G0Z A;  3MEC A;  4CFD A;  3QO9 A;  2F9W A;  4NCG A;  4CF0 A;  1VSE A;  2YHX A;  1VSD A;  2G8H A;  4M3T A;  2QI2 A;  2IC3 A;  5AQY A;  4FJX A;  4DSJ A;  2QWO A;  3ZT0 A;  5LMU K;  4FCY A;  3VQ9 A;  4Z94 A;  4W5O A;  1BA0 A;  4H4O A;  2FSN A;  3CFP A;  1KFD A;  1KAY A;  2QWQ A;  1VSF A;  4M42 A;  1SZ2 A;  4N41 A;  2P9U B;  2KZZ A;  2VG6 A;  3KWI A;  3TTF A;  5CY4 A;  4ELV A;  4LSN A;  1I39 A;  4LF4 K;  4Z4I A;  1RT1 A;  3P4I A;  1N34 K;  4KFB A;  1D9D A;  3W0L A;  2BH1 A;  1QVG M;  1KAZ A;  3G25 A;  4JHD B;  3ATU A;  1TGO A;  1MA9 B;  4FM0 A;  4Z4H A;  3ZT4 A;  4CED A;  2E2N A;  1BIS A;  1VSH A;  1CXQ A;  4FLX A;  1Z26 A;  1NGI A;  1B9F A;  3KKR A;  2IGI A;  4B3R K;  4B08 A;  4IFE A;  5HRS A;  3LAK A;  1ZBL A;  3E01 A;  5I3U A;  1V4S A;  3EEQ A;  4KHN A;  3UKU B;  3ULD A;  4B3S K;  4H5W A;  2QTD A;  4A57 A;  3P31 A;  1T6C A;  1ZBU A;  3M1F A;  2FF6 A;  1ZBI A;  4M7Y A;  3HI0 A;  3VQB A;  2GV9 A;  3L2W A;  4DSF A;  2ASP A;  1SL1 A;  3KVG A;  3IMX A;  1E4F T;  3M8S A;  1J5O A;  4BE1 A;  2PY5 A;  2VQE K;  4IOC L;  3QEP A;  3QEW A;  3KLF A;  1P90 A;  4JN4 A;  4CJQ A;  3H6E A;  3A8Y A;  3J7Z O;  4JRP A;  2J4R A;  3DLG A;  3SZ2 A;  3DXK A;  3G10 A;  3R1X A;  2KW4 A;  3TU5 A;  3VTI A;  4A2A A;  4F3T A;  4EFH A;  1BG3 A;  3DRR A;  1WB9 A;  3J7Y P;  2EX3 A;  3V9Z A;  1GLC G;  1HRH A;  5F0X A;  1UA1 A;  1IKW A;  4CZE A;  1EQY A;  3NH0 A;  5BPN A;  1VAZ A;  3E9O A;  1ZC6 A;  1BQN A;  4BAC A;  4LFA K;  3QBX A;  4YOR A;  4FXD A;  4CER A;  1I94 K;  4O5F A;  4CCH A;  3CCR N;  4N56 A;  5EXW A;  3VQD A;  1TKX A;  1NGA A;  4FL9 A;  3S3N A;  2Q3S A;  2A40 A;  1TL3 A;  4DTN A;  3CCL N;  4JK7 A;  3C6U A;  4WYB A;  1W9H A;  1P8Z A;  1LWC A;  1VK0 A;  2E6L A;  4BRI A;  1FW6 A;  3R3L A;  3LZJ A;  3J8A A;  3VEZ A;  3NH2 A;  4BRH A;  2O8B B;  4WQ4 A;  2UUB K;  1XC3 A;  3VN5 A;  4DS4 A;  1HUX A;  1YVU A;  3TAE A;  4W5N A;  3DLB A;  4FLU A;  4CBX A;  1VQ7 N;  4DR5 K;  4CGF A;  3CFO A;  1RBS A;  4UY8 O;  3CXC M;  1RFQ A;  1TYQ B;  1HNX K;  2P9N A;  2JWK A;  1VQ5 N;  3E9L A;  2DFF A;  3OYB A;  3QML A;  3ZT3 A;  3A2F A;  4LH4 A;  1QQO A;  2V7Z A;  3NE6 A;  2GWK A;  2P9I A;  1OVY A;  3QFP A;  3CCM N;  1YVN A;  3GE1 A;  2W42 A;  4ID5 A;  4F2R A;  2XY7 A;  3THX B;  4R5P A;  5DM6 L;  2G8I A;  5BRD A;  4DV3 K;  1S5J A;  4DQP A;  4IFY A;  4FJH A;  3LPU A;  5MLC Q;  1NM1 A;  3U6F A;  2Z1H A;  2A42 A;  4M3R A;  4LF7 K;  4FWN A;  5CYQ A;  1Q8I A;  3O1B A;  4I7F A;  4H5N A;  1NGG A;  3WNG A;  5GAD P;  5GAH P;  2HHS A;  4FJK A;  5J2M A;  1TAQ A;  2HMP A;  3PV8 A;  4DFJ A;  3WQT A;  4CHP A;  5SZT A;  3O9R A;  3WXM B;  4GV6 A;  4KKO A;  1WNS A;  3C0B A;  3TTC A;  2QK9 A;  4J8F A;  1SL2 A;  2HHW A;  2NRW A;  3CER A;  1LAV A;  3VQ5 A;  4JYA K;  3FFK B;  2HBJ A;  1N36 K;  1WSJ A;  1MWM A;  4PL7 A;  3EL2 A;  5EOY A;  1HLU A;  2DTU A;  1UOC A;  1BCM A;  3QIC A;  4DR1 K;  2O8D B;  1L5U A;  4FLT A;  3THY A;  4OVL A;  4PUO A;  1VSM A;  2JGU A;  4IEE A;  3CJ7 A;  2HW3 A;  3SAH A;  4JI0 K;  2IAJ A;  4Z4F A;  4B9N A;  3OYL A;  3VEX A;  4R79 A;  2OTL N;  1YXQ A;  3OYH A;  5KQD A;  2YHW A;  4BR2 A;  4CGI A;  1XC9 A;  1FK9 A;  3ZET B;  3A5M C;  4CZG A;  4BRD A;  2A1S A;  2HHQ A;  4NYF A;  5BPL A;  3L0Q A;  3O4Q A;  2BGG A;  3PSF A;  4BRA A;  4DS5 A;  3SUO A;  4I6M B;  4KI4 A;  5CZ1 A;  1OH7 A;  3PIO L;  4GKK K;  2ATQ A;  1RDW X;  4YOU A;  1KVB A;  3DOL A;  5CE3 A;  3KLE A;  4IWV A;  4JD2 B;  1D5A A;  1SAZ A;  3RTV A;  3RMA A;  2Q31 A;  4BC5 A;  4EZ9 A;  2W41 A;  3EN9 A;  2UXC K;  1J9A A;  2E4L A;  2V51 B;  4FWK A;  2OPR A;  4H8K A;  2P9S B;  2HHV A;  5EU7 A;  4M3X A;  4FZY A;  4NB4 A;  4YOX A;  1MU2 A;  1C6V A;  2QWP A;  3ZSX A;  3V1O A;  3WQU A;  3KTQ A;  4BRC A;  2Y1I A;  3SAF A;  2HHU A;  3O3G A;  3MCP A;  4B9M A;  5CHI A;  3LAM A;  1U4B A;  3K5O A;  4FM1 A;  1X3N A;  3KK1 A;  3ZT2 A;  3S41 A;  4GV3 A;  3VEY A;  3J80 O;  4JV5 K;  5A2Q O;  5AQN A;  5M1Q A;  1LOT B;  4FZZ A;  2VYP A;  3AY9 A;  4KH5 A;  1W0H A;  4BGA A;  2D0B A;  4JKC A;  4Y1C A;  3NH1 A;  4DUZ K;  4MDA A;  4IJA A;  2NRT A;  3KZB A;  4CBU A;  3DRP A;  4BR5 A;  3WT0 A;  3QEV A;  3F73 A;  3NBP A;  2WFB A;  1TK8 A;  5JVG L;  3AVB A;  4JKB A;  1G99 A;  2PYJ A;  4DMN A;  4O8U A;  4Z4E A;  4IO8 A;  3CHW A;  1NJI O;  3M8P A;  1NOZ A;  4B8C A;  3CJ1 A;  4B1X B;  1Q81 O;  5TKY A;  3VQ7 A;  4BQZ A;  5TKW A;  1DGK N;  4LC9 B;  1ASU A;  4IOA L;  4KBO A;  1XMQ K;  1RDD A;  4RG8 A;  4GY2 B;  3BDP A;  3FE1 A;  1IBL K;  5AQO A;  1NGD A;  4OLA A;  4DU3 A;  3H46 O;  3SLC A;  3TAN A;  2VG5 A;  3AVK A;  1WSI A;  2GTD A;  1RTD A;  2RKI A;  1EKE A;  3TAR A;  2ASM A;  4CI6 A;  1KVA A;  3HPH A;  3ZCM A;  3QNN A;  5GAG P;  2P9L A;  2E2Q A;  3VA3 A;  3VF4 A;  3R9P A;  3C6T A;  3H45 C;  3LAL A;  2AJQ A;  2OPS A;  4RW9 A;  2F4V K;  4DWI A;  2CH5 A;  1KXP A;  4FJJ A;  5EX5 A;  2HST A;  2OPQ A;  5KTQ A;  2QW9 A;  4F2S A;  4H5V A;  3SPZ A;  3C7N A;  4YOT A;  4CEQ A;  2KHO A;  1R0A A;  4W5T A;  4ICL A;  4DTP A;  3ZEU A;  3P1G A;  1K73 O;  3DLK A;  1JXB A;  4F4K A;  1HPM A;  3OW2 M;  2CH6 A;  1ZBH A;  5KRT A;  1BIZ A;  3OYI A;  3NGZ A;  4FWO A;  3W3D A;  3ZSV A;  3SNN A;  4H03 B;  2CGK A;  4CEZ A;  1HKC A;  1SL0 A;  2ETJ A;  1U2V B;  5AQS A;  3HPG A;  4EP4 A;  3U9D A;  1YT3 A;  1JLA A;  3HYF A;  4U7B A;  4BR0 A;  2P5O A;  1VQ9 N;  3HM9 A;  3CIP A;  3V9S A;  5CR4 A;  1HKG A;  4TSX A;  3SK3 A;  4FWR A;  3HVR A;  1NGF A;  3A0I X;  4CD1 A;  3V9U A;  1S1W A;  4PKG A;  2UU9 K;  3FZH A;  3LDO A;  1Q9X A;  1ZBS A;  4Y0W A;  4IKF A;  3A5L C;  4ELT A;  3O80 A;  1Z25 A;  4FO0 A;  4K25 A;  4CEB A;  5AQQ A;  4KRE A;  1EET A;  1VQN N;  3F9K A;  4GVE A;  3U9Z A;  4L3Q A;  4M3W A;  1N5Y A;  4AHC A;  1U47 A;  4NLC A;  1GOA A;  2XY8 A;  4LF8 K;  4OX9 K;  2F8S A;  2HBL A;  3IG1 A;  2YHY A;  3VQQ A;  4DR3 K;  1Y97 A;  1NWK A;  3VMF B;  3T7Z A;  4B3T K;  3AVM A;  5K14 A;  1VRU A;  1JCG A;  2EWS A;  2ZGY A;  3HL8 A;  2O8E B;  3HOT A;  1TKT A;  5JS2 A;  2EHG A;  1TVR A;  4K41 A;  3CCS N;  4CZH A;  4LD0 A;  4LF5 K;  1ZBF A;  2CGL A;  4CZM A;  3O8M A;  4BE2 A;  2DFH A;  3QDK A;  1KLM A;  2E6M A;  5T7B A;  3K59 A;  3THW A;  1VQ6 N;  5BRH A;  3I33 A;  1N33 K;  4O8K A;  1SQK A;  1JLE A;  5J2N A;  4OO1 J;  3AAQ A;  1KTQ A;  4CFC A;  4I2P A;  3ULE B;  3U3Y A;  3KHY A;  2CGJ A;  2G8K A;  4DG1 A;  3K57 A;  4CHZ A;  5BRF A;  4CJL A;  4CES A;  1NKE A;  1YJ9 N;  3VQ6 A;  3JAM O;  4KHQ A;  3ZT1 A;  2G8V A;  2O4I A;  1RTJ A;  1TUY A;  1TUU A;  3IKM A;  3T1H K;  3I8B A;  2ZM6 K;  2VG7 A;  1RDC A;  1TL1 A;  3H1V X;  3CQY A;  2QWR A;  3UKR A;  3B8A X;  1FJG K;  2O8F A;  3HO1 A;  2W6L A;  3D6R A;  3AO2 A;  4DSI A;  3NF8 A;  4JNE A;  1IO2 A;  3I0R A;  5FPM A;  1OH8 A;  3MXM A;  1KFS A;  1S9E A;  4CEA A;  4RW7 A;  3JSM A;  3K9J A;  3CPE A;  4CZK A;  3JXU A;  3CCQ N;  1WN7 A;  4PQU A;  5AQK A;  4FLW A;  2PBD A;  1REV A;  3TTD A;  2QXL A;  2ITM A;  1SKR A;  5CZ2 A;  4CBW A;  1C0G A;  2HHT A;  5AZJ B;  2RE2 A;  3SJH A;  1YTA A;  4DCH A;  4AHT A;  1CZ9 A;  4DTR A;  5AQZ A;  3F5T A;  2OZS A;  3DWL A;  4BQL A;  2FBY A;  2E5L K;  5F1X A;  3IUC A;  5E41 A;  4B1Z A;  1NJZ A;  5FRO A;  3DXM A; 
#chains in the Genus database with same CATH homology
 4CBX A;  1VQ7 N;  3G6E N;  2FSJ A;  4JKA A;  2NRX A;  2E88 A;  2ASO A;  4CZI A;  3M6G A;  1GLE G;  4UY8 O;  4BG8 A;  5AQI A;  4MLE A;  1RFQ A;  1TYQ B;  4XEI A;  3SMS A;  3CXC M;  1YF5 L;  2P9N A;  4JKE A;  5AQM A;  2JWK A;  1QHA A;  4CZJ A;  5KQ8 A;  3CME N;  1W2B M;  1VQ5 N;  1KD1 O;  3E9L A;  3VGM A;  4EIA A;  3E9P A;  3E66 A;  5M1P A;  4C23 A;  1YI2 N;  4JK8 A;  3QML A;  3CPW M;  2ZJP L;  3T69 A;  3TSQ A;  1E4G T;  1S3X A;  3VPZ A;  4C1N I;  1Z05 A;  5JMV A;  1QQO A;  5HOO A;  1XQS C;  2V7Z A;  5KPZ A;  2HF4 A;  4EAH D;  3ZYY X;  2GWK A;  2P9I A;  2RHK A;  3OBW A;  1OVY A;  3QFP A;  3TPQ A;  1YIT N;  3CCM N;  3FGU A;  2QWN A;  5BPM A;  1N8R O;  1YVN A;  3GE1 A;  1ESV A;  3IDH A;  2GEM A;  4IZ9 A;  2A6A A;  1NGJ A;  4BVP A;  1CZA N;  5AQW A;  5BR9 A;  4K42 A;  5DM6 L;  5BRD A;  3RVC A;  4PL8 A;  3RSE A;  2KLA A;  3D2F A;  2OTJ N;  4E1J A;  5MLC Q;  1NM1 A;  2P9K A;  2NRR A;  3HOS A;  4CJ7 A;  5C15 A;  1VQ8 N;  2A42 A;  1WUA A;  2Q2R A;  3WEE A;  4B9Q A;  4IO9 L;  3FR0 A;  4FWN A;  2NZT A;  4IXC A;  3VGK A;  3CCV N;  3O5B A;  3MMV A;  3O1B A;  4H5N A;  1NGG A;  2Q0U A;  1DT9 A;  5GAD P;  5GAH P;  3MK6 A;  4MLH A;  1GLA G;  3M3Z A;  4EHT A;  2HMP A;  3WQT A;  1Y64 A;  3MN5 A;  3A5O C;  3O6W A;  4DQ8 A;  3O9R A;  3DJC A;  1HJO A;  5EVZ A;  2AP1 A;  3WXM B;  3ZX3 A;  5M1F A;  3VET A;  4GV6 A;  2Q1N A;  3SMP A;  3C0B A;  3TTC A;  1JJ2 M;  4J8F A;  4FOE A;  2Q36 A;  5AQT A;  3QB0 A;  5DM7 L;  4JKF A;  2NRW A;  3GBT A;  3R8E A;  3D2E A;  3R6M A;  5C12 A;  3CER A;  5AZI B;  2GX9 A;  2HOE A;  3FFK B;  2HBJ A;  2D4W A;  1BWF O;  1QZ6 A;  4KH4 A;  3F9M A;  4BR4 A;  3MWP A;  1MWM A;  1YJN N;  1BUP A;  3OHR A;  2ZWH A;  4H5R A;  4PL7 A;  4IDH A;  3EL2 A;  1K8K A;  5AQP A;  4QS7 A;  5EOY A;  3O9S A;  3OBY A;  3ID8 A;  3VEW A;  1HLU A;  5C0Y A;  1GLL O;  2YX6 A;  4BRM A;  5JLH A;  3QIC A;  1X9J A;  4HWI A;  1BOT O;  4MDB A;  2A41 A;  4A5A A;  4A2B A;  1YJW N;  3DAW A;  4IEE A;  3GG4 A;  5AQG A;  3CJ7 A;  3SAH A;  3CQX A;  3VEX A;  4R79 A;  2OTL N;  1K9M O;  1YXQ A;  1NMD A;  5KQD A;  2P9L B;  1QVF M;  2YHW A;  4BR2 A;  5ADX A;  2WUS A;  4FWQ A;  3ZET B;  5JIC A;  1YHQ N;  1U2V A;  3A5M C;  4CZG A;  3K9K A;  4BRD A;  2E20 A;  3VEV A;  4U67 L;  3SBG A;  2AA4 A;  2FLO A;  5LY3 A;  4C1N K;  1Q86 O;  2Q0R A;  3FZL A;  5H1S Q;  3HRG A;  3L0Q A;  5BPL A;  3SBT A;  4BRA A;  3TSU A;  1ATN A;  4PHT X;  4I6M B;  4M7X A;  2E2P A;  4BG9 A;  2P9P B;  1NGB A;  1KAX A;  3MN6 A;  3G4S N;  3PIO L;  1RDW X;  3MX2 A;  4YOU A;  4DHY A;  2I7N A;  1KC8 O;  5CE3 A;  3DXK B;  4IWV A;  4G9Z A;  4JD2 B;  1SAZ A;  3C6H A;  2Q31 A;  4BC5 A;  3ID6 A;  4WFN L;  3VOV A;  2FSK A;  4JKD A;  1Q7Y O;  1YAG A;  3P39 A;  1M1K O;  2W41 A;  3EN9 A;  5FPD A;  2WC9 A;  3CET A;  1ATR A;  5AQX A;  3M5R A;  4A59 A;  1LCU A;  2BTF A;  1BDG A;  2V51 B;  4FWK A;  5BN9 A;  2D0O A;  2P9S B;  2NNW A;  4NB4 A;  4YOX A;  2H3G X;  3WXJ A;  4F9O A;  2QWP A;  5BN8 A;  1IJJ A;  2NRV A;  3WQU A;  4B1V A;  4BR7 A;  4BRC A;  4RCH A;  2KKZ A;  3UE5 A;  4BC3 A;  4EHU A;  5AFU A;  1K8A O;  3EKU A;  3SAF A;  1NGC A;  2D1K A;  5C10 A;  4BRN A;  4XH5 A;  3HM8 A;  4NLB A;  3IFR A;  5GIN A;  1MDU B;  3MCP A;  5CHI A;  4M63 C;  4YOV A;  2P9U A;  1X3N A;  2HBK A;  3S41 A;  5JVH L;  4GV3 A;  3VEY A;  4GV9 A;  3FZK A;  2OAN A;  3VEN A;  3QFU A;  5AQN A;  5M1Q A;  1LOT B;  4BR9 A;  4CZL A;  2VYP A;  3AY9 A;  1OKJ A;  4KH5 A;  4BVO A;  4BGA A;  4KH6 A;  4JKC A;  4MO4 A;  3CC7 N;  4AM6 A;  4JHD A;  4MDA A;  1VQK N;  4JKG B;  1BO5 O;  4IJA A;  2NRT A;  3KK7 A;  3KZB A;  3DXM B;  2NRZ A;  3VF6 A;  4CBU A;  4B1W B;  1Q18 A;  4BR5 A;  2HBM A;  5GAE P;  1X3M A;  3U8X A;  3WT0 A;  4RWT A;  3CCJ N;  5FPN A;  5AQV A;  1T44 A;  2P9N B;  4BRL A;  2WFB A;  2W40 A;  5M1K A;  3GOI A;  5JVG L;  4JKB A;  3MCA B;  1RGI A;  5C2D A;  1G99 A;  3ULE A;  3UKU A;  4O8U A;  4IO8 A;  5GIP A;  3CHW A;  2UYT A;  1S72 N;  3CMA N;  4H0P A;  1NJI O;  2IVN A;  1ZXO A;  3CJ1 A;  4B1X B;  1VQO N;  1Q81 O;  2P9I B;  4QS9 A;  5TKY A;  3I56 N;  3OA9 A;  1M90 O;  4BQZ A;  3H3O B;  3MN7 A;  4PKH A;  1DGK N;  1U6Z A;  5TKW A;  3TSP A;  3U4L A;  3ZX0 A;  4LC9 B;  4A62 A;  1QQN A;  4IOA L;  4KBO A;  3BEX A;  4IOX A;  4NO7 A;  1QQM A;  5C2F A;  4JEP A;  4FWP A;  3FZM A;  4FWM A;  4GY2 B;  3FE1 A;  3LDN A;  3RSE B;  2BUP A;  1QZ5 A;  3MWT A;  3HSC A;  4AF1 A;  3D2F B;  5KPT A;  3G71 N;  3CCE N;  2P9K B;  5AQO A;  4WFB L;  4BY9 C;  3O9Q A;  1O13 A;  3EE9 A;  1NGD A;  5EY4 A;  3C65 A;  3H46 O;  3SLC A;  2A3Z A;  3L4I A;  1HX1 A;  1GLF O;  4FWS A;  2GTD A;  2NRH A;  3BF3 A;  3PLA A;  4CZF A;  2ASM A;  4CI6 A;  3DLL L;  3VF2 A;  5FPE A;  4YOY A;  3LM9 A;  4H0Y B;  5GAG P;  2P9L A;  2E2Q A;  4JK9 A;  4YDU C;  3VF4 A;  3PIP L;  3N4Q A;  1EO1 A;  3R9P A;  5AQH A;  5HL7 L;  1V4T A;  5I9E B;  4WFA L;  3H45 C;  4DKW A;  3MDQ A;  5AQF A;  5AQL A;  3BUZ B;  2QA4 N;  3ENO A;  4QS8 A;  3FZF A;  3D7E O;  2CH5 A;  3D2E B;  1KXP A;  3AGR A;  1BA1 A;  1SS6 A;  2QM1 A;  5EX5 A;  4WQ5 C;  4I6M A;  5GIO A;  5KPR A;  4IEI A;  2HST A;  5AZJ A;  3EZW A;  3AAP A;  3VES A;  2QW9 A;  4BRQ A;  4H5V A;  4BRP A;  1K8K B;  1VQL N;  1W97 L;  3C7N A;  3WUH A;  5LJV A;  2ZGZ A;  4YOT A;  1HKB A;  3UB5 A;  1JCE A;  2KHO A;  4ISG A;  4B1Y B;  4BRE A;  3H3N O;  3N4P A;  5AR0 A;  3ZEU A;  3CJA A;  3ENB A;  3UKR B;  1K73 O;  1R59 O;  4K43 A;  1HPM A;  3OW2 M;  2CH6 A;  5AQR A;  1XUP O;  1RDU A;  3ENH A;  1JCF A;  3L4Q A;  4FWO A;  3W3D A;  4BRK A;  4H03 B;  2CGK A;  4FVU A;  1HKC A;  3EO3 A;  2E1Y A;  4A5B A;  1S22 A;  2A5X A;  3EKS A;  3ZX2 A;  4MO5 A;  3BF1 A;  2F7T A;  3HTV A;  3LM2 A;  1GLD G;  1U2V B;  3VGL A;  4YDU A;  1TYQ A;  2DPN A;  5AQS A;  1ATS A;  4H5T A;  1T3V A;  3AAR A;  3O08 A;  5F2R A;  3AGK A;  3U9D A;  1Q82 O;  3VTH A;  3HBT A;  4CD3 A;  3QBW A;  1DKG D;  4U7B A;  4BR0 A;  3CC2 N;  4BRF A;  3ATV A;  2VGM A;  2ZJR L;  1VQ9 N;  3CIP A;  1GLB G;  4H0T B;  3Q7B A;  1HKG A;  4OPH A;  4WQ5 A;  5CR4 A;  4FWR A;  1GLJ O;  1NGF A;  3E1Y A;  4ILH A;  2JWL A;  4XH4 A;  3A0I X;  4FWL A;  4ISE A;  4CD1 A;  2PFU A;  4PKG A;  3FZH A;  3LDO A;  3CC4 N;  2VCP A;  1ZBS A;  2F9W A;  4Y0W A;  1WOQ A;  3A5L C;  4RTF D;  4JAX A;  2YHX A;  2IVO A;  4A61 A;  4XH1 A;  2QI2 A;  4YOW A;  3CD6 N;  3O80 A;  1YIJ N;  4FO0 A;  3CJC A;  5AQY A;  4K25 A;  1VQP N;  2QWO A;  5AQQ A;  2YJE A;  2QWL A;  1NBW A;  2E2O A;  4BC2 A;  4Z94 A;  1VQN N;  3U9Z A;  4GVE A;  4L3Q A;  3NVM A;  4NLC A;  1BA0 A;  3F2K A;  5M1N A;  3MN9 A;  4GNI A;  3VEO A;  4BC4 A;  2HBL A;  3MX5 A;  1Z6R A;  1C0F A;  2FSN A;  2YHY A;  3H1Q A;  1MWK A;  1NWK A;  3VMF B;  3T7Z A;  3P38 A;  1KAY A;  3I55 N;  1JCG A;  2EWS A;  2QWQ A;  3EE8 A;  1SZ2 A;  2V52 B;  2ZGY A;  2P9U B;  3NMU A;  3KWI A;  3GL1 A;  3TTF A;  5B8H A;  3HOT A;  3O4W A;  3SAG A;  3KWG A;  4K41 A;  3CCS N;  4WF9 L;  5ELZ A;  2E8A A;  1YUW A;  3P4I A;  3O9U A;  2NLX A;  4AM7 A;  5AZI A;  3W0L A;  2BH1 A;  1QVG M;  4CZH A;  1J6Z A;  2CGL A;  3L6Q A;  4CZM A;  1KAZ A;  3G25 A;  4JHD B;  1VQM N;  3ATU A;  3CJ9 A;  4ILJ A;  1MA9 B;  3O8M A;  5ADX H;  4FOI A;  2YJF A;  3QDK A;  3JS6 A;  2E2N A;  4B1U B;  1NGI A;  1VQ6 N;  3WEE B;  4IFE A;  2IVP A;  5BRH A;  2HF3 A;  3I33 A;  2QWM A;  5E26 A;  4O8K A;  1SQK A;  2IIR A;  1V4S A;  4PKI A;  3AAQ A;  3VER A;  4OO1 J;  2D0P A;  3UKU B;  3ULE B;  5BRE A;  3LL3 A;  4H5W A;  3CI5 A;  2ZJQ L;  2QTD A;  3KHY A;  2QEX N;  3NVK A;  1VQ4 N;  4A57 A;  3P31 A;  1T6C A;  3CJB A;  2CGJ A;  4H0O A;  3C6A A;  4IJN A;  3M1F A;  2FF6 A;  3LDQ A;  5BRF A;  4M7Y A;  3ZET A;  3HI0 A;  1YJ9 N;  3LDP A;  2ASP A;  2F9T A;  2YI1 A;  3KVG A;  3IMX A;  1E4F T;  2ZF5 O;  1TUY A;  1TUU A;  3IKM A;  1ILY A;  3FLC O;  4IOC L;  4H0V B;  4ISF A;  3I8B A;  1P90 A;  5AQJ A;  2E1Z A;  1DEJ A;  2V7Y A;  4JN4 A;  2P9P A;  3H6E A;  3H1V X;  4FPB A;  3A8Y A;  3SK3 A;  3CQY A;  2J4R A;  4H0X B;  3J7Z O;  2QWR A;  3WXK A;  3UKR A;  5AFU H;  4BRO A;  3B8A X;  3DXK A;  3R1X A;  4WQ4 C;  4JD2 A;  2GUP A;  2I7P A;  3A5N C;  3TU5 A;  5JLF A;  3VTI A;  3Q7C A;  1D4X A;  3BP8 A;  3D6R A;  4A2A A;  4EFH A;  1BG3 A;  1GLC G;  5F0X A;  4JNE A;  1H1V A;  1KQS M;  2GWJ A;  2VGN A;  5M1O A;  4CZE A;  1EQY A;  5FPM A;  1BU6 O;  5BPN A;  1VAZ A;  1NGE A;  2P9S A;  3E9O A;  1ZC6 A;  1NLV A;  3CF5 L;  3K9J A;  3CPE A;  4CZK A;  3JXU A;  3CCQ N;  3QBX A;  4YOR A;  5AQK A;  2PBD A;  2Q97 A;  3O1W A;  2PAV A;  4FSV A;  4O5F A;  3TTD A;  4BRG A;  2QXL A;  1NGH A;  2ITM A;  3CCR N;  4CBW A;  1C0G A;  3WXI A;  5AZJ B;  2RE2 A;  5EXW A;  2VWB A;  4WCE L;  3SJH A;  3LDL A;  1NGA A;  4FL9 A;  4DCH A;  3HZ6 A;  4JKH A;  4BGB A;  4HTL A;  2A40 A;  3O9T A;  5AQZ A;  1IG8 A;  3C7N B;  4JK7 A;  4DB3 A;  3GDQ A;  3CCL N;  3F5T A;  4FPA A;  4WYB A;  3DWL A;  1P8Z A;  3WXL A;  4BQL A;  2FF3 B;  2YCH A;  5LJW A;  3ZEU B;  4BRI A;  5F1X A;  3IUC A;  2WBN A;  3R3L A;  3J8A A;  3VEZ A;  5AQU A;  2GEL A;  4B1Z A;  4ILG B;  4BRH A;  2FXU A;  4WQ4 A;  1XC3 A;  4JKG A;  3CCU N;  1T6D A;  1HUX A;  4OPA A;  5E84 A;  3DXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...