5BMGA

Nitroxide spin labels in protein gb1: e15 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGCTTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
total genus 14
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmgA00
1K50A 4OZAA 2NMQA 1YMHE 2OEDA 1Q10A 1XF5L 3GB1A 2EELA 1P7EA 2GB1A 2JSVX 2J53A 1PGAA 2PTLA 2IGDA 2KACA 1HZ6A 1IBXB 1MI0A 1MHXA 4D2KA 1C9FA 2JZPA 1HEZE 2QSDA 4HKZE 2N9LA 4GLSC 2RMMA 2LHDA 1FCLA 1XCQL 1HZ5A 1IGDA 1IBXA 2I2YA 1K53A 5HG2A 1GB1A 1F2RC 5BMIA 2IGHA 1MHHE 2GI9A 2PLPA 2JU6X 5HI1A 2KN4A 4KGRA 2JWUA 1KH0A 5BMGA 2ZW1A 1PGBA 2JXTA 4WH4A 1QKZA 2ZW0A 1MVKA 2KQ4X 4IOIE 4KGSA 2ON8A 2PW9A 1UWXA 2KWDA 2I38A 1YNTE 1ZXHA 2LHEA 4MACA 2N7JA 2RPVA 1XCTL 3UI3A 2KDMA 2K0PA 4OZBA 2LGIA 1EM7A 1K51A 1FCCC 1K52A 3FILA 4KGTA 3V3XA 5HFYA 1JMLA 2IGGA 4OZCA 1MPEA 1FD6A 2N9KA 3FILB 2J52A 5JXVA 5HHDG 2QMTA 1F2RI 1IGCA 1PGXA 1D4BA 5BMHA 4HJGE 4IKGA 2ONQA 1P7FA 2LUMA 1GB4A 3MP9A
chains in the Genus database with same CATH superfamily
2KFKA 5EE1A 4N9F4 4G11A 2KTFA 4HDQA 3TL5A 2BWES 2EKIA 2QDFA 4MJSA 4JGHB 4B0MA 4XWTA 1C77A 2L8JA 2RR9A 4JWUC 1L0YB 5IA7A 3KVFB 3BVMA 1N5WA 1JWBD 4B9KA 1PQSA 4BFRA 1I4XA 2L32A 2QSDA 2DENB 3U30A 4HROA 2RDHA 4NJCA 2LHDA 1JW9D 3CMMB 1Z2MA 3VRAB 2NPTB 3M3JA 2MBOA 4KDIC 4OVZA 2V0GA 1IPGA 3AE9B 3TSSA 5AZGA 2L0FA 4P1BC 4DXAB 3PVLA 4FJVB 4YTNB 1WXQA 2AQ3B 1U4AA 4W9CA 2MWSB 1D6EC 2WXLA 1ET9A 3RN9C 3VUYA 3MC9A 2MRPA 2INCC 3BWUD 1JRPA 1G6JA 2L7RA 2XK5A 3ZO5B 2HDEA 2IJ0A 4RF0A 1YN3A 1E0ZA 2R2QA 4ZOHC 4HPLB 2WGSA 2BKFA 4I6PA 3M95A 2ZEQA 2C9WB 1YQ3B 2FUHB 1YX6B 3QWZB 5TSSA 4JL9A 3NS1A 4ZHPA 3MP9A 3KH0A 2FIFA 2GOWA 3JSVA 3Q3FA 2M8SA 2L05A 5E6NA 4GN1A 3M63B 4XYCA 3SD5A 2WXNA 2SEBD 3B2GA 2BYVE 2IGDA 2KNBA 3L08A 1DOIA 5IAAC 2CU3A 2D3CA 2UYZB 4X57B 5LNK1 1WY8A 2NR2A 1J8CA 2MH7A 3ZNZB 3CF6E 1EU4A 2V4LA 2L83A 1SE4A 5EE0A 1GUAB 2QIEB 1E7UA 3CIRB 1NYQA 2W3SA 3ETRA 1V1OA 2DYBA 1XCQL 4UDUC 3Q8CA 4GOCA 3ZJUA 3A9JB 1FPYA 1WX9A 3RZWC 2KXJA 1F9JA 3JYUA 2KN4A 4FJZA 3UQBA 1FFVA 1QKZA 2L00B 2E6XA 4IOIE 1AN8A 1KTKA 3I5JC 1TIFA 3IHPC 1B9RA 1I4HA 4YXDB 4MGYE 2I38A 4LJPB 2MJ3A 1NBFC 5E6JA 2ZVOA 2DYOA 1QOAA 4R3DA 3MHZA 1YN5A 2MCNB 1WE7A 2LJIA 3KLSX 3VUXA 4WJQA 2CU1A 3RFZB 4RGTA 1VD2A 2AQ2B 4DBGA 2ZVNA 2BBCA 2N0SB 3N3KB 4KDLB 1NI3A 4W9EA 4IWPA 2BS2B 5L95C 2K9XA 2O2VB 4KIKB 1N61A 3HK0A 1WJ4A 3LXFA 1XD3B 2NMQA 3VTWA 3N9YC 2R61A 3P4RB 2MBBB 4B95A 2C7MB 4HWIB 2LJ5A 4IM0A 3Q14C 1JWMD 2BYTA 2D3BA 4LLGM 1LM8B 2K39A 3VQIA 4W9LA 3TEYA 1FXAA 1SE3A 2FUG1 2BYEA 1T6BX 1JWSD 4ACFA 2Z59B 2AL3A 2N9XA 4BOZB 3TJPA 2VH2A 1WMHB 3CSTA 4KSLC 4JIOU 4DXGA 1FCLA 3K9OB 3Q8BA 4TUUA 2WDQB 3T8MA 3RT3B 2JYTA 2M1MA 3VDZA 3QCAA 2NTTA 1WRIA 2WU2B 3T9LA 1P98A 1UZXB 4YT0B 2WX1A 3NS8A 4PYUA 1WH3A 5L83A 4A90A 2C5LC 1UH6A 3Q69A 2LASA 2MEKA 3A1QB 3ALBA 3Q3NC 1E9MA 2PKOA 2HJ8A 3U52E 3DBLB 3KUDB 3HM6X 3DVGX 1TS3A 1OGWA 4II2B 3E56A 4L1BA 4MGKE 2RPQA 5BYRA 3IAM1 3ZUNA 4OZCA 4TKNA 3ZNHB 2G4SA 2NVUI 1V97A 3C0RB 2D2QA 3PRZA 3AXCA 2KFJA 3Q3JA 3N32A 2I1KA 2JWZA 3QC8B 2G1EA 4WWNA 2ONQA 4NQLB 1K50A 1ZGUB 1ISNA 1N62A 1ZE3D 2WDTB 1Q10A 5KHQA 2MBHA 2W9NA 3DBRB 2PVOD 2BB6A 3DBRI 2OHFA 4NNJB 2A4ZA 4DHZE 3AE4B 1QF6A 3C19A 4IM2A 4ZYSA 1DOYA 3ZJTA 1E6EB 1C4PA 3DOWA 1WXVA 1IUEA 1KF6B 2WHIA 4MM3B 3C8YA 2LRUA 4K1RB 2ZJDA 4ICVA 4DK5A 2GBMA 4PT5A 4HCPB 3ZXRA 2Y5CA 1K53A 3BVZA 5C2TB 5IP4D 4M0WA 1SGHA 4LDTB 4HDOA 4NPNA 2KTRB 3AE2B 3Q2AC 1XQQA 2N1VA 4G0NB 5G55A 2FCSA 1KLGD 3R7RA 1SBBB 1C3TA 2LGXA 3SR6A 4XE0A 1AARA 2K22A 1BT0A 2KDMA 4RMAA 2W54A 1I42A 1FCCC 4EZJA 2X38A 4C7ZA 3AB5A 1MPEA 2JYEA 2WXMA 2LXCA 2MQJA 3HRDD 4PS7A 4F7ZA 5JHBA 2QMTA 2HTME 1QQRA 4XGAB 2JRHA 4GDLB 1RWSA 2M19A 1SIFA 1WX8A 2AX5A 4WWOA 1C4CA 2AQ1B 2D10A 2MHJA 4ANWA 3Q3OC 3QARA 3MC0B 2N7EA 3EUB2 3APDA 4W9HA 1IBXB 3NVZA 2JZPA 1GNUA 3NHEB 2K1FA 1STEA 4GLSC 3LDZE 4C00A 3AEFB 1WXMA 2NPTA 4AJYB 1EO6A 5AUKA 2L76A 1PDXA 3GE8C 3ML8A 2HE7A 4LNNA 2KLGA 1WZ3A 1D5XC 2GI9A 2Z0DB 2MP2B 4AWJA 4FADA 4XC2A 3APFA 1RM6C 1JWAD 4DXFA 3DBSA 2J0MA 3Q6BA 4RGNA 1C1YB 4ZHOA 3AE6B 4LK0M 1VCBA 4BKSD 5J17A 1T0YA 2KQ4X 1YJ1A 1X1MA 1WYWB 1V1PB 2PW9A 1XLQA 1K8RB 3R3MA 1JALA 3N20C 2BB5A 1IYFA 3MHSD 2KK8A 2JVCA 4MACA 4TQ1A 3ZGZA 4A9AA 5BYSA 1EF1A 4LJOB 3RNCC 2ZZPB 4K7UA 2K8HA 2MW5A 1KLVA 3H7PB 5C23A 4DDGD 4TMAB 2G4DB 1MFWA 1D3ZA 1L2NA 4ICUA 2LUMA 4RM9A 2KX0A 2LXAA 3U7ZA 2DBYA 4URKA 1RRBA 3ECIA 4P7IA 2N9EB 2LVOA 3PRMB 2EELA 1QOGA 2WXKA 2KANA 4FHJA 5FKAC 5G5GA 1TBEA 3EFCA 2B3AA 1HZ6A 3UIOB 3V61A 4CYEA 1OQQA 4NQKE 4LDTD 2AYOB 4RGOS 1TT5B 2J0JA 2V3SA 1RYJA 4ANUA 3B0AA 3I9V1 2RMMA 3GS2A 3OJ3A 4DQOC 3VTVA 2DYMA 3A9JA 1TJEA 5D3DA 4OHJA 1E90A 2G9HD 2KQSA 4HEA1 1N5XA 4KGRA 3PZ8A 3VXWA 2O6VD 5FK9C 3HM3A 1FMAD 1WFYA 3BIID 3ZNGC 2UU7A 5CX3A 2L0TA 4HPPA 2WQYB 2L52A 4YWGG 2ZCCA 3HHMA 4C56C 1TS4A 4S0RA 1DGJA 2BS3B 1CJEA 1WM3A 4J3OD 3SFEB 1TKEA 1WGKA 4WWPA 3NG0A 2PMVA 1EM7A 1TY0A 1K52A 2LWPA 4KGTA 1V81A 1N6ZA 2NBUA 4W9JA 3FILB 2R2OA 3MTNB 2GLSA 3NUHB 3VHTC 3ABVB 1XO3A 5HHDG 4HJKA 2VZKB 3PZ7A 3A9KB 1KRHA 4GSWA 2LVPA 3QAQA 1WE6A 3AI5A 2FE8A 2V3NA 2K6QA 3A4SC 3NY5A 2W82A 4W9IA 1HTOA 1P7EA 3DVGY 3RNGC 2GB1A 1C76A 5BO4B 2DZJA 1SE2A 4WJPA 3U2SC 5HKHA 3RNAC 1EWCA 2WDRB 1UF0A 1NI2A 3PREA 2KJRA 2KMAA 4LCDE 2DLBA 1WMHA 2W55A 2IY0B 3RNFC 1HEZE 2J42A 2OJWA 4GU2A 1P0RA 3KWLA 1WGRA 3WAOA 1HZ5A 2FAZA 1XT9B 2KD0A 1YQBA 4FULA 4B6WA 3R8BA 4C4VA 1I7HA 2M4NA 2PLPA 2JU6X 3I3TB 3GOEA 2H89B 2YLMA 1ZDXA 2IDYA 3A1QA 1HQRD 3P4SB 1I4GA 1L4DB 3HIZA 2B76B 3VR8B 2KWDA 2Z8LA 3ZJVA 4ANXA 2RGFA 3IBEA 3L54A 1PUTA 2LRWA 4EE2A 2JPHA 4A55A 2WP9B 1ZUD2 3TBLD 4FLHA 1E8WA 3VVWB 1C79A 2M17A 2D5GA 4GIVA 3DHGC 4N58A 4ZRPA 3ZRCA 3TUOA 1XLNA 1SE9A 4MJSB 4W9GA 2INDC 4ZRQA 1PGXA 3P4PB 3UGBB 1VLBA 4O1NA 4RNAA 2LD9A 3UF8A 3H8HA 5J2RA 1V86A 3RYTA 1V6EA 1DOXA 5C1ZA 1TYGB 1L6VA 3Q8EA 3AE3B 2ICIA 1J19A 2JXXA 2BGFA 4HKQA 3PPAA 4L2YA 1E10A 3PHWB 2JX5A 2KWCA 1E7VA 4A3OA 4YTPB 3B08A 5AUIA 1UUPA 1FRRA 4YTMB 1VZ8A 5DCNA 3A4RA 3OG5A 2I2YA 4M02A 2WXHA 3NVVA 1J7AA 4I6NB 4TSSA 3GZNB 1E8XA 3GZNI 3NVWA 2XK5B 5CHVC 2Y5BB 4A8XC 2BKRB 2BVCA 2GBNA 2JXTA 1FXTB 4IG7B 4KGSA 1TTNA 3P42A 1SF0A 2ON8A 3KUCB 1WXAA 2EMTA 3R2IA 1WIAA 2WWZA 3OAWA 4LNOA 3W5UB 4BAXA 2AL6A 2VZKD 4OZBA 1I35A 2KAJA 1FM0D 5HFYA 3HUIA 2I1JA 1YJJA 4XDCA 3JSVB 3R7QA 1QZEA 3ZRFA 2KDFB 5LXIB 2REXA 2IYDB 1PYWD 2IO2B 1A5RA 4GDLA 3DBHB 4QAYA 3DBHI 3OLMD 3L4PA 2KWVB 3DBLI 4US8A 1WGHA 4GGQA 5DPWA 1I4QA 3EFUA 4HXDA 5D7GA 5EDSA 1WGGA 2CHZA 1VZ6A 2X8XX 1Z5SB 2PTLA 3ZKJC 4GDKA 4WAFA 2QC8A 2PVGC 3TEZA 2TSSA 3IT6B 4PS3A 3IAS1 4HVBA 3SDLC 3L0WB 4MEMA 2FCNA 2LI5A 2N9LA 1ESFA 2GRIA 5J18A 3NRZA 2DX5B 5JHAA 1I4RA 4FHKA 4JX1C 3CWIA 2ACZB 5IKCM 1HTQA 3UIPB 2MA9B 4CO7A 4S17A 4P16A 1H8CA 3RNBC 3U4EG 2KN5A 3AULA 2MX2A 3SFDB 1WR6E 3BYYB 1F0ZA 1FEHA 2KKCA 4JE3B 4REZA 4XZ4A 2WYQA 1F52A 1E5WA 3DHIC 3NZ3A 1M94A 1TS5A 3FAHA 1R4MB 3H7SA 1R4MI 4MSMB 1YN4A 2LHEA 4KZCA 1NENB 2G3QB 2CKHB 1OEYA 1L7YA 4EEWA 1UELA 3V05A 3Q8FA 4A20A 3EECA 3B1LX 3PGEA 2K3UA 1GOZA 4KKIA 1JWUD 3H7PA 3KWVA 5JXVA 2DZMA 2AWTA 3NJTA 3N1ZC 3RD2A 1IGCA 2DAFA 5GMVA 4IC7B 2D11A 4HJGE 4XWWA 3PS6A 1NEKB 2WU5B 5CTRC 5G5HA 2DZIA 1JRUA 2O6VB 2LUEA 2M0AA 1V9JA 3DWMA 3TIXA 3AH7A 5AZFA 1KLUD 3AU5A 2KVZA 2N7DA 3ZIMA 2JQRB 2BT6A 2VRRB 4D2KA 5DPTA 2IBIB 4RM8A 4HLEA 1CQVA 3VTUA 4C80A 2NBVB 3PLUA 4YSYB 1KM7A 2MJEA 1WX7A 3KW5B 2QILA 2WXRA 2BYFA 1YOVB 2C7HA 4M8MA 3PHXB 3QA8A 2BF8B 2WXQA 1V5OA 1FRDA 1ACCA 1ZW7A 2XN9C 1Y8RC 2QEJC 3PSEB 3VFKA 3ZTCA 5MPOA 3J9CA 1R4NB 3P2BA 1R4NI 4KX6B 5IOIA 1MVKA 3BINA 1VZ7A 1F1HA 1TZOA 4HK2A 2J7QB 3AEDB 4PK1A 1YIWA 4EZLA 1WJUA 2WLBA 1WGDA 4ZYNA 1FO4A 2N7JA 2RPVA 5IN7A 3AEGB 4DHJD 4KZ0A 2BQQA 4NAMA 3V3XA 1WI0A 3FILA 1T0QC 2IGGA 2KMMA 3AE8B 2DZKA 1T0SC 3NZSA 1QOBA 3A9KA 1WWTA 4A3PA 3APCA 4ARCA 5H92C 2PPHA 2BW2A 3T3OA 2FCMA 4C7YA 2AEHA 3VR9B 3QHTA 2LZ6A 4WJNA 1YMHE 5FR6A 1AW7A 2OEDA 1SB3C 3P1MA 3GB1A 2V9HA 2YEPF 2QHOA 1WYGA 4K3CA 2IO3B 5E6OA 3TMPB 3NZUA 5I4DA 2KO3A 2J53A 5C3JB 3EA6A 5AZHA 3AEBB 1ZOYB 3IFWB 3ZDMC 3D32A 1MI0A 4MH0E 1V49A 4M0WB 3BK2A 1C9FA 3ZTDA 3I57A 1KFYB 2KC2A 3WALA 4HKZE 1TS2A 5G2NA 2WXFA 3UINB 4JQWC 1QOFA 4E71A 1WM2A 2WXJA 2CJNA 1IGDA 3WAMA 2WDVB 1CMXB 1E7PB 1H4RA 3P4QB 4BKGA 3MC8A 2QJLA 2MLBA 2BTEA 2ZW1A 1PGBA 1FNVA 2KHWB 4II3B 4F1SA 4WH4A 1ZKHA 4OVVA 3JW0X 4M01A 1C78A 2OJRA 3ZLZA 3PRPB 2PE9A 4FN2A 2PEAA 1ZXIA 2N4FA 1ROEA 3W1SC 2XBBC 1E8YA 1VRAB 4DWFA 3UI3A 3H1UA 1EF5A 2JF5A 2WXOA 4JLCA 3ZVVA 3IT4B 1ZPSA 4BBNC 4TV3A 2KJHB 1BUIC 2CJOA 1UD7A 2WNMA 4AJWA 2JT4B 2KZRA 1SEBD 1MG8A 1LO5D 5EE3A 1F77A 1ZP0B 1SJED 4US9A 1D4BA 3X23A 2NS5A 1NVID 3KYCD 4G3XB 3KQ4A 5D2MB 1GB4A 1WJ6A 5LXHA 3RMKC 3VRBB 5CHFA 2JUOA 4MSQB 3AEAB 4W9DA 1GC6A 2Q5WD 1J7CA 2WX0A 2Z0EB 2C7NB 2JSVX 4RFBA 3SU8X 1ENFA 2HTHA 2LGYA 3IXSA 3H9DA 2ZCBA 4IM3A 2SAKA 4FJYA 2O2VA 4KIKA 3U7DA 3MJ5A 5FR3A 2N1WA 3LYYA 4N59A 4B0EA 1EU3A 1A70A 4N6EB 1QILA 4GB9A 2FBWB 1WSPA 4DHZB 1WZ0A 4ZRJA 2KDBA 2M56B 4E3CA 3QIJA 1I4PA 3DHHC 2RSUA 3AV8A 2INPE 4HRSA 4K7WA 5HG2A 4LTUA 4WJOA 2WXIA 4W9FA 4YSZB 4MDKE 4KKJA 1RLFA 4WWMA 4WIPA 2V4IB 1NDDA 3WAPA 3EHVA 4USAA 4PYZA 1L5PA 2L1AA 3TEXA 2ZPNA 1D5ZC 1P1AA 3RULA 2LFIA 2E3TA 3VH3B 4MGIE 4NJ6A 4I6LB 1VR9A 4KVGB 4P6VF 2ZPYA 4NJ7A 2YVCA 1OFFA 2N9KA 3DPDA 3TEWA 2DAJA 2WXPA 2J52A 3HVZA 4BVUC 3TCAA 1TZ1A 5AEKB 4NAWB 5BYQA 2UWQA 3R2TA 1KJTA 4K7SA 3ZQ4A 4ANVA 4BKSA 4MGZE 3L17A 3AE5B 4F8CB 4AQ7A 2L3ZA 4LNIA 3L10B 1FXIA 1OEYJ 3VH4B 2INNE 2KFKB 1XLOA 3O13A 3O65B 1MJDA 4AP4C 4BKTA 4M8NA 2WS3B 1DYQA 3W1SA 4H2AA 3QX1A 2ZNVB 2KOXA 1PFDA 2D07B 2LGSA 4MH8A 3QJZA 1GAQB 2KACA 2NTSA 2XEWA 1EWYC 2FNJB 1CZPA 2H88B 3N30A 3VUWA 2Y5PA 2IZVB 5T8IA 2K6DB 4WURA 3Q3MC 4YL8A 3ZNID 3N1XC 4ITKA 1V8CA 2K8BA 3AM9A 1UGMA 4WQOB 2K8CA 3PTFC 3E9SA 4RF1A 1UGJA 1AYFA 1GG3A 4MM3A 2V3PA 4EOYA 2KWUB 2Y3AA 1TKYA 2EKEC 1SJHD 3U8ZA 3AMZA 3L16A 2FCQA 2JWUA 2ZW0A 2HD5B 3KYDD 1C4AA 5TR5A 1UWXA 3ML9A 3ONSA 1RFAA 3LJ3A 2VH1A 2KQ7A 2KDEB 3T3NA 1Q1OA 3V6CB 1LFDA 2KTRA 5H8YE 2BWFA 3V6EB 3RNEC 2CR5A 1YD8U 1WRDB 2NBWB 3PV1A 1UBQA 3V60A 4NY0A 1F2RI 5IO9A 1XXGA 3JVZX 5BMHA 1VDVA 4HPMB 2K5PA 2MBQA 3PT2B 4RCOA 2O6VA 1P7FA 3MFGA 2IY1B 1AWDA 1YJIA 2D3AA 4HCNB 3KUZA 4KV2A 3IG3A 1YQ4B 2IO1B 5D3IB 4GMVA 1SSNA 1R7SA 1D5MC 2V1YA 2LMCA 3PZDA 4A6QA 3DVNU 1FNWA 2DHZA 4PS8A 4DHJB 3B2FA 1MHXA 4IWQA 3WIMA 1IP9A 4C4VB 3SHQA 4W9KA 2CHWA 2J0KA 1P3QU 4BOSC 4L23A 3BVGA 4FXCA 1SIJA 1M4VA 3W2DA 1IBXA 4Q2JA 1GPXA 3X0WA 1LGRA 1B1ZA 2IGHA 2CS4A 1V5TA 3M62B 1P9DU 4GXBA 5JZEB 4CQNA 3GE3C 4MELA 4AOFA 4OW0A 4FBJB 1KH0A 1XEEA 1RAXA 1T5XD 1UWMA 1CK1A 5CHWA 3Q8AA 1YNTE 3R66C 2W3RA 4M00A 4NZLB 4EKUA 2MP2A 4IUMB 1VJKA 4K3BA 3W5VB 4K81A 3AU4A 1OQYA 3BYTB 4IWOA 1J7BA 1BMLC 1SXTA 3DVNV 1V1PA 3BY4B 4MT5A 3S2AA 3WA0A 2M0XA 1TKGA 2DNFA 1GJZA 2LGDA 4ZRKA 4DDID 2ASQA 4RGMA 1L4ZB 1UNSA 2BPSA 3OJ4B 4IKGA 2G45B 3AN1A 2JY6A 4LNKA 4IW0A 2YEPB 3SEBA 1Q5WB 2A5UA 1WJNA 5E6PA 1XF5L 3V62A 2MJDA 2K25A 3RPFC 1OTRB 2IPKD 2GBJA 4E74A 1JQ4A 4YSXB 1PGAA 3FC4A 3B9JA 2GMIC 3FKYA 3H6NA 4AUQC 5KHOA 2PIAA 1FNUA 5DPRA 4EUTA 3AE1B 1TGZB 2KT7A 3LB8C 1QLBB 3PO0A 3ENEA 3NOBA 5D94A 5LLIA 1RFKA 3DDCB 3UQAA 3HVDA 4J6IA 2D3GA 3AEEB 1GB1A 3AECB 4IDIA 1XLPA 1UBIA 3GP7A 5HI1A 3CSFA 3OWEB 5BMGA 2RDBC 1WGYA 3QK0A 4ARIA 1WR1A 1Q0WB 2KMCA 3W1YA 3ZDTA 2KJ6A 4XDDA 3K9PB 4JPSA 2RD0A 4ZRIA 1MG4A 4OVUA 4KSKC 2DWQA 1E8ZA 2ZNVC 1ZXHA 3RZFA 1JROA 2PE6B 2WXGA 5D6JB 1XCTL 2LEKA 3AE7B 3DQVA 2LGIA 1K51A 1QT9A 3EGRA 1N63A 3URYA 3ZXVA 1L0XB 2EMSA 4BZAA 2JRIB 2KX3A 4TQ0A 3L13A 2N9PC 3ZYYX 4GDKB 1HE8A 2KVRA 4FA6A 3BK1A 4OZAA 2KYWA 4WQMA 1HA5A 4BBNF 4CHKA 2RDGA 1BXTA 1TY2A 2KLCA 4EZKA 1GC7A 5GXGB 1V2YA 1ZDVA 2JZZA 3RI7C 2GBKA 1Y56A 2XNAC 2FIDA 1WF9A 1LQBA 3QQ8B 3EC8A 4EFOA 3I63C 1V80A 3BZDB 3ZW3A 4RH6A 2OOBB 1KOTA 1N60A 1ET6A 3N1YC 2IO0B 1T3QA 3WCQA 4ASWC 3VAWA 2MBEA 4G50A 1F2RC 3A33B 5BMIA 1MHHE 1T0RC 3NVYA 2MSED 3RCZA 2KC1A 3PLVA 2NCNA 1HXYD 4JWSC 1OQRA 4P1CC 3IVFA 2LVQA 4AS1A 2J4XA 4LNFA 1FFUA 2JZ3B 2BS4B 5DPSA 5EE9A 1L0VB 1EUVB 1S3SG 1WXSA 2HJ1A 1JCKB 3WANA 1S1QB 2CHXA 2K0PA 2PJHA 2C60A 1L6UA 1LXDA 1JMLA 3P63A 1FD6A 2QCZA 4WAAA 5JH5C 4NAWA 1NYRA 1J0GA 3RUIB 4ZDVA 3MJWA 1FIQA 3DCGA 2GBRA 4XX5A 2KDIA 3W9CB 1YX5B 3DWGC
chains in the Genus database with same CATH topology
3AE5B 5EE1A 4AQ7A 1I4QA 2AX5A 1C4CA 1FXIA 2AQ1B 5D7GA 2INNE 1XLOA 3O13A 1VZ6A 2EKIA 2WS3B 1DYQA 3W1SA 4H2AA 1PFDA 4MH8A 3MC0B 4B0MA 1GAQB 2PTLA 2KACA 4WAFA 2NTSA 2PVGC 3EUB2 4XWTA 1EWYC 3TEZA 1IBXB 2TSSA 1C77A 1CZPA 2H88B 3NVZA 4JWUC 1L0YB 3IT6B 3IAS1 2JZPA 3BVMA 1N5WA 1JWBD 2Y5PA 5T8IA 1I4XA 2L32A 2QSDA 1STEA 2N9LA 4GLSC 1ESFA 4WURA 2GRIA 4HROA 3NRZA 2RDHA 3AEFB 4NJCA 4ITKA 2LHDA 1JW9D 1V8CA 1I4RA 3AM9A 4JX1C 3CWIA 2ACZB 5AUKA 3E9SA 1PDXA 4RF1A 1UGJA 3VRAB 4P16A 1AYFA 4OVZA 2V0GA 3AE9B 1D5XC 2GI9A 2V3PA 3U4EG 2Y3AA 3TSSA 1TKYA 1SJHD 1RM6C 3AMZA 1JWAD 3SFDB 4DXFA 3BYYB 2JWUA 4RGNA 4ZHOA 3AE6B 4LK0M 1F0ZA 2ZW0A 1FEHA 2KQ4X 4JE3B 4YTNB 1V1PB 2PW9A 4REZA 1WXQA 1C4AA 2AQ3B 1XLQA 3NZ3A 1UWXA 1JALA 1TS5A 3FAHA 1D6EC 2WXLA 2BB5A 1ET9A 1YN4A 2LHEA 4MACA 1NENB 3BWUD 1JRPA 3T3NA 4TQ1A 3ZGZA 2HDEA 2IJ0A 3V05A 4A9AA 4RF0A 3Q8FA 5BYSA 5H8YE 1YN3A 1E0ZA 2K3UA 1GOZA 4ZOHC 4KKIA 1JWUD 3KWVA 5JXVA 1F2RI 1IGCA 1YQ3B 1XXGA 5BMHA 1VDVA 4TMAB 5TSSA 2K5PA 4HJGE 4RCOA 3NS1A 4ZHPA 4XWWA 1NEKB 1P7FA 2LUMA 3MFGA 2WU5B 3MP9A 5G5HA 3U7ZA 2DBYA 1AWDA 1YJIA 2M0AA 5D3IB 1YQ4B 3DWMA 3AH7A 2EELA 1KLUD 1SSNA 1QOGA 2WXKA 1R7SA 1D5MC 5FKAC 2WXNA 2LMCA 5G5GA 4A6QA 2SEBD 3B2GA 1FNWA 2IGDA 2JQRB 1HZ6A 2BT6A 1DOIA 2CU3A 3B2FA 1OQQA 1MHXA 4D2KA 5LNK1 1CQVA 4C80A 2MH7A 1EU4A 2L83A 1SE4A 4YSYB 5EE0A 2QIEB 4RGOS 2MJEA 1RYJA 3CIRB 2QILA 2WXRA 2RMMA 3GS2A 3I9V1 3BVGA 1NYQA 2W3SA 4L23A 4DQOC 3ETRA 1V1OA 4FXCA 1SIJA 1M4VA 1XCQL 3W2DA 2DYMA 4UDUC 1IBXA 1TJEA 2WXQA 3Q8CA 1FRDA 4Q2JA 1GPXA 1ACCA 1B1ZA 2IGHA 5D3DA 3ZJUA 4OHJA 2XN9C 2G9HD 2QEJC 4CQNA 4HEA1 1N5XA 2KN4A 3J9CA 4KGRA 5MPOA 4OW0A 1KH0A 3PZ8A 1FFVA 4KX6B 1QKZA 5FK9C 1MVKA 2E6XA 1FMAD 1VZ7A 4IOIE 3BIID 1AN8A 1KTKA 1XEEA 1B9RA 1T5XD 1TZOA 1UWMA 1I4HA 4YXDB 1CK1A 3AEDB 3Q8AA 2I38A 2WQYB 1YNTE 2L52A 2W3RA 2MJ3A 4YWGG 5E6JA 4NZLB 2WLBA 4C56C 1TS4A 1FO4A 1DGJA 2N7JA 2RPVA 2BS3B 1VJKA 3W5VB 2DYOA 1CJEA 1QOAA 4J3OD 3SFEB 1TKEA 3AEGB 3MHZA 1YN5A 1WGKA 4R3DA 3BYTB 2PMVA 1EM7A 1TY0A 4NAMA 1K52A 3V3XA 3FILA 4KGTA 1J7BA 1BMLC 2IGGA 1SXTA 2KMMA 1V1PA 2LJIA 4MT5A 3KLSX 3FILB 3AE8B 1QOBA 1TKGA 3NUHB 3RFZB 3ABVB 1XO3A 4RGTA 5HHDG 1WWTA 2AQ2B 2BBCA 2N0SB 2VZKB 3PZ7A 1NI3A 1KRHA 2BS2B 4RGMA 4ARCA 5H92C 1L4ZB 1UNSA 2BW2A 4IKGA 2K9XA 3T3OA 3AN1A 1N61A 4C7YA 2FE8A 2YEPB 3SEBA 2V3NA 3LXFA 3VR9B 2NMQA 1YMHE 1AW7A 2OEDA 1SB3C 2W82A 1XF5L 3P1MA 3GB1A 2YEPF 1P7EA 2MJDA 3N9YC 1WYGA 2R61A 2GB1A 3P4RB 1C76A 1SE2A 3RPFC 5I4DA 2IPKD 1JQ4A 3U2SC 2J53A 1JWMD 2BYTA 4YSXB 4LLGM 1EWCA 1PGAA 2WDRB 5C3JB 3VQIA 3EA6A 3FC4A 3AEBB 1ZOYB 3B9JA 3TEYA 1MI0A 1FXAA 1SE3A 2FUG1 1T6BX 1JWSD 2DLBA 3BK2A 1C9FA 3I57A 1KFYB 2PIAA 2W55A 1FNUA 1HEZE 4HKZE 2J42A 1TS2A 3AE1B 3PO0A 3LB8C 1QLBB 2WXFA 4DXGA 1FCLA 3KWLA 1QOFA 3Q8BA 1RFKA 2WXJA 2CJNA 3HVDA 1HZ5A 1IGDA 2WDVB 2WDQB 3AEEB 2JYTA 1E7PB 1GB1A 3AECB 3P4QB 3R8BA 2QJLA 4IDIA 1XLPA 2NTTA 1WRIA 1I7HA 2WU2B 3GP7A 2PLPA 2JU6X 4YT0B 5HI1A 2H89B 3OWEB 2BTEA 5BMGA 1ZDXA 2ZW1A 1PGBA 1FNVA 4WH4A 4A90A 2IDYA 1HQRD 3Q69A 3P4SB 4ARIA 1I4GA 1C78A 1L4DB 4XDDA 4JPSA 2MEKA 1E9MA 2B76B 3VR8B 2KWDA 2PKOA 2DWQA 2Z8LA 3ZJVA 1ZXHA 1ZXIA 1JROA 1ROEA 3U52E 2WXGA 1PUTA 1VRAB 4EE2A 1XCTL 3UI3A 4A55A 2WP9B 1TS3A 1ZUD2 2LEKA 3AE7B 3E56A 2LGIA 2WXOA 4L1BA 1C79A 1K51A 1ZPSA 3IT4B 1QT9A 5BYRA 2D5GA 3IAM1 1BUIC 2CJOA 4OZCA 4ZRPA 2WNMA 4N58A 3EGRA 1N63A 3URYA 1V97A 1SEBD 1L0XB 1LO5D 5EE3A 3TUOA 1XLNA 1F77A 1ZP0B 1SJED 4US9A 4ZRQA 4TQ0A 1PGXA 2G1EA 3P4PB 1D4BA 3ZYYX 1VLBA 4GDKB 1NVID 4O1NA 2ONQA 4RNAA 3KQ4A 1GB4A 1K50A 3BK1A 4OZAA 3VRBB 1N62A 3H8HA 4WQMA 1ZE3D 1HA5A 3AEAB 1Q10A 2RDGA 1BXTA 1TY2A 1DOXA 2Q5WD 1TYGB 1L6VA 1J7CA 3Q8EA 3AE3B 2PVOD 2ICIA 2BB6A 2JSVX 2OHFA 4RFBA 4HKQA 5GXGB 1ENFA 3AE4B 4L2YA 1QF6A 3IXSA 1E10A 2SAKA 1ZDVA 2JX5A 4ZYSA 1Y56A 3MJ5A 5FR3A 1DOYA 2XNAC 3ZJTA 1E6EB 3LYYA 1C4PA 4N59A 4B0EA 1EU3A 1A70A 4N6EB 1IUEA 1KF6B 1QILA 4MM3B 3BZDB 2FBWB 1WSPA 3C8YA 4RH6A 4YTPB 5AUIA 1N60A 1UUPA 1ET6A 1FRRA 4YTMB 2M56B 1T3QA 1VZ8A 3WCQA 4PT5A 1I4PA 2Y5CA 2I2YA 1K53A 3BVZA 3AV8A 2INPE 2WXHA 4HRSA 5HG2A 3NVVA 1F2RC 5BMIA 5C2TB 1J7AA 4LTUA 4M0WA 1MHHE 2WXIA 4TSSA 4YSZB 4KKJA 3NVYA 3NVWA 4WWMA 4A8XC 4WIPA 2V4IB 3AE2B 2JXTA 4JWSC 1HXYD 4USAA 1OQRA 4KGSA 1L5PA 3P42A 1SF0A 2ON8A 2L1AA 4AS1A 2J4XA 1FFUA 3TEXA 1D5ZC 2BS4B 5EE9A 1L0VB 2LFIA 2E3TA 1KLGD 1SBBB 3R2IA 3SR6A 4XE0A 1JCKB 2K22A 3W5UB 1VR9A 2KDMA 2VZKD 4P6VF 2K0PA 4OZBA 2KAJA 1L6UA 2W54A 1FCCC 1FM0D 5HFYA 3HUIA 2X38A 4C7ZA 1JMLA 1YJJA 3AB5A 3P63A 1MPEA 2JYEA 2WXMA 4XDCA 1FD6A 1OFFA 2N9KA 3TEWA 3HRDD 2WXPA 2J52A 3HVZA 1NYRA 4NAWB 1FIQA 1PYWD 2HTME 2QMTA 5BYQA 3R2TA 1QQRA 3L4PA 3ZQ4A 4US8A 3W9CB 4GDLB 3DWGC 1RWSA 2M19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K50 A;  4OZA A;  2NMQ A;  1YMH E;  2OED A;  1Q10 A;  1XF5 L;  3GB1 A;  2EEL A;  1P7E A;  2GB1 A;  2JSV X;  2J53 A;  1PGA A;  2PTL A;  2IGD A;  2KAC A;  1HZ6 A;  1IBX B;  1MI0 A;  1MHX A;  4D2K A;  1C9F A;  2JZP A;  1HEZ E;  2QSD A;  4HKZ E;  2N9L A;  4GLS C;  2RMM A;  2LHD A;  1FCL A;  1XCQ L;  1HZ5 A;  1IGD A;  1IBX A;  2I2Y A;  1K53 A;  5HG2 A;  1GB1 A;  1F2R C;  5BMI A;  2IGH A;  1MHH E;  2GI9 A;  2PLP A;  2JU6 X;  5HI1 A;  2KN4 A;  4KGR A;  2JWU A;  1KH0 A;  5BMG A;  2ZW1 A;  1PGB A;  2JXT A;  4WH4 A;  1QKZ A;  2ZW0 A;  1MVK A;  2KQ4 X;  4IOI E;  4KGS A;  2ON8 A;  2PW9 A;  1UWX A;  2KWD A;  2I38 A;  1YNT E;  1ZXH A;  2LHE A;  4MAC A;  2N7J A;  2RPV A;  1XCT L;  3UI3 A;  2KDM A;  2K0P A;  4OZB A;  2LGI A;  1EM7 A;  1K51 A;  1FCC C;  1K52 A;  3FIL A;  4KGT A;  3V3X A;  5HFY A;  1JML A;  2IGG A;  4OZC A;  1MPE A;  1FD6 A;  2N9K A;  3FIL B;  2J52 A;  5JXV A;  5HHD G;  2QMT A;  1F2R I;  1IGC A;  1PGX A;  1D4B A;  5BMH A;  4HJG E;  4IKG A;  2ONQ A;  1P7F A;  2LUM A;  1GB4 A;  3MP9 A; 
#chains in the Genus database with same CATH topology
 2KFK A;  5EE1 A;  4N9F 4;  4G11 A;  2KTF A;  4HDQ A;  3TL5 A;  2BWE S;  2EKI A;  2QDF A;  4MJS A;  4JGH B;  4B0M A;  4XWT A;  1C77 A;  2L8J A;  2RR9 A;  4JWU C;  1L0Y B;  5IA7 A;  3KVF B;  3BVM A;  1N5W A;  1JWB D;  4B9K A;  1PQS A;  4BFR A;  1I4X A;  2L32 A;  2QSD A;  2DEN B;  3U30 A;  4HRO A;  2RDH A;  4NJC A;  2LHD A;  1JW9 D;  3CMM B;  1Z2M A;  3VRA B;  2NPT B;  3M3J A;  2MBO A;  4KDI C;  4OVZ A;  2V0G A;  1IPG A;  3AE9 B;  3TSS A;  5AZG A;  2L0F A;  4P1B C;  4DXA B;  3PVL A;  4FJV B;  4YTN B;  1WXQ A;  2AQ3 B;  1U4A A;  4W9C A;  2MWS B;  1D6E C;  2WXL A;  1ET9 A;  3RN9 C;  3VUY A;  3MC9 A;  2MRP A;  2INC C;  3BWU D;  1JRP A;  1G6J A;  2L7R A;  2XK5 A;  3ZO5 B;  2HDE A;  2IJ0 A;  4RF0 A;  1YN3 A;  1E0Z A;  2R2Q A;  4ZOH C;  4HPL B;  2WGS A;  2BKF A;  4I6P A;  3M95 A;  2ZEQ A;  2C9W B;  1YQ3 B;  2FUH B;  1YX6 B;  3QWZ B;  5TSS A;  4JL9 A;  3NS1 A;  4ZHP A;  3MP9 A;  3KH0 A;  2FIF A;  2GOW A;  3JSV A;  3Q3F A;  2M8S A;  2L05 A;  5E6N A;  4GN1 A;  3M63 B;  4XYC A;  3SD5 A;  2WXN A;  2SEB D;  3B2G A;  2BYV E;  2IGD A;  2KNB A;  3L08 A;  1DOI A;  5IAA C;  2CU3 A;  2D3C A;  2UYZ B;  4X57 B;  5LNK 1;  1WY8 A;  2NR2 A;  1J8C A;  2MH7 A;  3ZNZ B;  3CF6 E;  1EU4 A;  2V4L A;  2L83 A;  1SE4 A;  5EE0 A;  1GUA B;  2QIE B;  1E7U A;  3CIR B;  1NYQ A;  2W3S A;  3ETR A;  1V1O A;  2DYB A;  1XCQ L;  4UDU C;  3Q8C A;  4GOC A;  3ZJU A;  3A9J B;  1FPY A;  1WX9 A;  3RZW C;  2KXJ A;  1F9J A;  3JYU A;  2KN4 A;  4FJZ A;  3UQB A;  1FFV A;  1QKZ A;  2L00 B;  2E6X A;  4IOI E;  1AN8 A;  1KTK A;  3I5J C;  1TIF A;  3IHP C;  1B9R A;  1I4H A;  4YXD B;  4MGY E;  2I38 A;  4LJP B;  2MJ3 A;  1NBF C;  5E6J A;  2ZVO A;  2DYO A;  1QOA A;  4R3D A;  3MHZ A;  1YN5 A;  2MCN B;  1WE7 A;  2LJI A;  3KLS X;  3VUX A;  4WJQ A;  2CU1 A;  3RFZ B;  4RGT A;  1VD2 A;  2AQ2 B;  4DBG A;  2ZVN A;  2BBC A;  2N0S B;  3N3K B;  4KDL B;  1NI3 A;  4W9E A;  4IWP A;  2BS2 B;  5L95 C;  2K9X A;  2O2V B;  4KIK B;  1N61 A;  3HK0 A;  1WJ4 A;  3LXF A;  1XD3 B;  2NMQ A;  3VTW A;  3N9Y C;  2R61 A;  3P4R B;  2MBB B;  4B95 A;  2C7M B;  4HWI B;  2LJ5 A;  4IM0 A;  3Q14 C;  1JWM D;  2BYT A;  2D3B A;  4LLG M;  1LM8 B;  2K39 A;  3VQI A;  4W9L A;  3TEY A;  1FXA A;  1SE3 A;  2FUG 1;  2BYE A;  1T6B X;  1JWS D;  4ACF A;  2Z59 B;  2AL3 A;  2N9X A;  4BOZ B;  3TJP A;  2VH2 A;  1WMH B;  3CST A;  4KSL C;  4JIO U;  4DXG A;  1FCL A;  3K9O B;  3Q8B A;  4TUU A;  2WDQ B;  3T8M A;  3RT3 B;  2JYT A;  2M1M A;  3VDZ A;  3QCA A;  2NTT A;  1WRI A;  2WU2 B;  3T9L A;  1P98 A;  1UZX B;  4YT0 B;  2WX1 A;  3NS8 A;  4PYU A;  1WH3 A;  5L83 A;  4A90 A;  2C5L C;  1UH6 A;  3Q69 A;  2LAS A;  2MEK A;  3A1Q B;  3ALB A;  3Q3N C;  1E9M A;  2PKO A;  2HJ8 A;  3U52 E;  3DBL B;  3KUD B;  3HM6 X;  3DVG X;  1TS3 A;  1OGW A;  4II2 B;  3E56 A;  4L1B A;  4MGK E;  2RPQ A;  5BYR A;  3IAM 1;  3ZUN A;  4OZC A;  4TKN A;  3ZNH B;  2G4S A;  2NVU I;  1V97 A;  3C0R B;  2D2Q A;  3PRZ A;  3AXC A;  2KFJ A;  3Q3J A;  3N32 A;  2I1K A;  2JWZ A;  3QC8 B;  2G1E A;  4WWN A;  2ONQ A;  4NQL B;  1K50 A;  1ZGU B;  1ISN A;  1N62 A;  1ZE3 D;  2WDT B;  1Q10 A;  5KHQ A;  2MBH A;  2W9N A;  3DBR B;  2PVO D;  2BB6 A;  3DBR I;  2OHF A;  4NNJ B;  2A4Z A;  4DHZ E;  3AE4 B;  1QF6 A;  3C19 A;  4IM2 A;  4ZYS A;  1DOY A;  3ZJT A;  1E6E B;  1C4P A;  3DOW A;  1WXV A;  1IUE A;  1KF6 B;  2WHI A;  4MM3 B;  3C8Y A;  2LRU A;  4K1R B;  2ZJD A;  4ICV A;  4DK5 A;  2GBM A;  4PT5 A;  4HCP B;  3ZXR A;  2Y5C A;  1K53 A;  3BVZ A;  5C2T B;  5IP4 D;  4M0W A;  1SGH A;  4LDT B;  4HDO A;  4NPN A;  2KTR B;  3AE2 B;  3Q2A C;  1XQQ A;  2N1V A;  4G0N B;  5G55 A;  2FCS A;  1KLG D;  3R7R A;  1SBB B;  1C3T A;  2LGX A;  3SR6 A;  4XE0 A;  1AAR A;  2K22 A;  1BT0 A;  2KDM A;  4RMA A;  2W54 A;  1I42 A;  1FCC C;  4EZJ A;  2X38 A;  4C7Z A;  3AB5 A;  1MPE A;  2JYE A;  2WXM A;  2LXC A;  2MQJ A;  3HRD D;  4PS7 A;  4F7Z A;  5JHB A;  2QMT A;  2HTM E;  1QQR A;  4XGA B;  2JRH A;  4GDL B;  1RWS A;  2M19 A;  1SIF A;  1WX8 A;  2AX5 A;  4WWO A;  1C4C A;  2AQ1 B;  2D10 A;  2MHJ A;  4ANW A;  3Q3O C;  3QAR A;  3MC0 B;  2N7E A;  3EUB 2;  3APD A;  4W9H A;  1IBX B;  3NVZ A;  2JZP A;  1GNU A;  3NHE B;  2K1F A;  1STE A;  4GLS C;  3LDZ E;  4C00 A;  3AEF B;  1WXM A;  2NPT A;  4AJY B;  1EO6 A;  5AUK A;  2L76 A;  1PDX A;  3GE8 C;  3ML8 A;  2HE7 A;  4LNN A;  2KLG A;  1WZ3 A;  1D5X C;  2GI9 A;  2Z0D B;  2MP2 B;  4AWJ A;  4FAD A;  4XC2 A;  3APF A;  1RM6 C;  1JWA D;  4DXF A;  3DBS A;  2J0M A;  3Q6B A;  4RGN A;  1C1Y B;  4ZHO A;  3AE6 B;  4LK0 M;  1VCB A;  4BKS D;  5J17 A;  1T0Y A;  2KQ4 X;  1YJ1 A;  1X1M A;  1WYW B;  1V1P B;  2PW9 A;  1XLQ A;  1K8R B;  3R3M A;  1JAL A;  3N20 C;  2BB5 A;  1IYF A;  3MHS D;  2KK8 A;  2JVC A;  4MAC A;  4TQ1 A;  3ZGZ A;  4A9A A;  5BYS A;  1EF1 A;  4LJO B;  3RNC C;  2ZZP B;  4K7U A;  2K8H A;  2MW5 A;  1KLV A;  3H7P B;  5C23 A;  4DDG D;  4TMA B;  2G4D B;  1MFW A;  1D3Z A;  1L2N A;  4ICU A;  2LUM A;  4RM9 A;  2KX0 A;  2LXA A;  3U7Z A;  2DBY A;  4URK A;  1RRB A;  3ECI A;  4P7I A;  2N9E B;  2LVO A;  3PRM B;  2EEL A;  1QOG A;  2WXK A;  2KAN A;  4FHJ A;  5FKA C;  5G5G A;  1TBE A;  3EFC A;  2B3A A;  1HZ6 A;  3UIO B;  3V61 A;  4CYE A;  1OQQ A;  4NQK E;  4LDT D;  2AYO B;  4RGO S;  1TT5 B;  2J0J A;  2V3S A;  1RYJ A;  4ANU A;  3B0A A;  3I9V 1;  2RMM A;  3GS2 A;  3OJ3 A;  4DQO C;  3VTV A;  2DYM A;  3A9J A;  1TJE A;  5D3D A;  4OHJ A;  1E90 A;  2G9H D;  2KQS A;  4HEA 1;  1N5X A;  4KGR A;  3PZ8 A;  3VXW A;  2O6V D;  5FK9 C;  3HM3 A;  1FMA D;  1WFY A;  3BII D;  3ZNG C;  2UU7 A;  5CX3 A;  2L0T A;  4HPP A;  2WQY B;  2L52 A;  4YWG G;  2ZCC A;  3HHM A;  4C56 C;  1TS4 A;  4S0R A;  1DGJ A;  2BS3 B;  1CJE A;  1WM3 A;  4J3O D;  3SFE B;  1TKE A;  1WGK A;  4WWP A;  3NG0 A;  2PMV A;  1EM7 A;  1TY0 A;  1K52 A;  2LWP A;  4KGT A;  1V81 A;  1N6Z A;  2NBU A;  4W9J A;  3FIL B;  2R2O A;  3MTN B;  2GLS A;  3NUH B;  3VHT C;  3ABV B;  1XO3 A;  5HHD G;  4HJK A;  2VZK B;  3PZ7 A;  3A9K B;  1KRH A;  4GSW A;  2LVP A;  3QAQ A;  1WE6 A;  3AI5 A;  2FE8 A;  2V3N A;  2K6Q A;  3A4S C;  3NY5 A;  2W82 A;  4W9I A;  1HTO A;  1P7E A;  3DVG Y;  3RNG C;  2GB1 A;  1C76 A;  5BO4 B;  2DZJ A;  1SE2 A;  4WJP A;  3U2S C;  5HKH A;  3RNA C;  1EWC A;  2WDR B;  1UF0 A;  1NI2 A;  3PRE A;  2KJR A;  2KMA A;  4LCD E;  2DLB A;  1WMH A;  2W55 A;  2IY0 B;  3RNF C;  1HEZ E;  2J42 A;  2OJW A;  4GU2 A;  1P0R A;  3KWL A;  1WGR A;  3WAO A;  1HZ5 A;  2FAZ A;  1XT9 B;  2KD0 A;  1YQB A;  4FUL A;  4B6W A;  3R8B A;  4C4V A;  1I7H A;  2M4N A;  2PLP A;  2JU6 X;  3I3T B;  3GOE A;  2H89 B;  2YLM A;  1ZDX A;  2IDY A;  3A1Q A;  1HQR D;  3P4S B;  1I4G A;  1L4D B;  3HIZ A;  2B76 B;  3VR8 B;  2KWD A;  2Z8L A;  3ZJV A;  4ANX A;  2RGF A;  3IBE A;  3L54 A;  1PUT A;  2LRW A;  4EE2 A;  2JPH A;  4A55 A;  2WP9 B;  1ZUD 2;  3TBL D;  4FLH A;  1E8W A;  3VVW B;  1C79 A;  2M17 A;  2D5G A;  4GIV A;  3DHG C;  4N58 A;  4ZRP A;  3ZRC A;  3TUO A;  1XLN A;  1SE9 A;  4MJS B;  4W9G A;  2IND C;  4ZRQ A;  1PGX A;  3P4P B;  3UGB B;  1VLB A;  4O1N A;  4RNA A;  2LD9 A;  3UF8 A;  3H8H A;  5J2R A;  1V86 A;  3RYT A;  1V6E A;  1DOX A;  5C1Z A;  1TYG B;  1L6V A;  3Q8E A;  3AE3 B;  2ICI A;  1J19 A;  2JXX A;  2BGF A;  4HKQ A;  3PPA A;  4L2Y A;  1E10 A;  3PHW B;  2JX5 A;  2KWC A;  1E7V A;  4A3O A;  4YTP B;  3B08 A;  5AUI A;  1UUP A;  1FRR A;  4YTM B;  1VZ8 A;  5DCN A;  3A4R A;  3OG5 A;  2I2Y A;  4M02 A;  2WXH A;  3NVV A;  1J7A A;  4I6N B;  4TSS A;  3GZN B;  1E8X A;  3GZN I;  3NVW A;  2XK5 B;  5CHV C;  2Y5B B;  4A8X C;  2BKR B;  2BVC A;  2GBN A;  2JXT A;  1FXT B;  4IG7 B;  4KGS A;  1TTN A;  3P42 A;  1SF0 A;  2ON8 A;  3KUC B;  1WXA A;  2EMT A;  3R2I A;  1WIA A;  2WWZ A;  3OAW A;  4LNO A;  3W5U B;  4BAX A;  2AL6 A;  2VZK D;  4OZB A;  1I35 A;  2KAJ A;  1FM0 D;  5HFY A;  3HUI A;  2I1J A;  1YJJ A;  4XDC A;  3JSV B;  3R7Q A;  1QZE A;  3ZRF A;  2KDF B;  5LXI B;  2REX A;  2IYD B;  1PYW D;  2IO2 B;  1A5R A;  4GDL A;  3DBH B;  4QAY A;  3DBH I;  3OLM D;  3L4P A;  2KWV B;  3DBL I;  4US8 A;  1WGH A;  4GGQ A;  5DPW A;  1I4Q A;  3EFU A;  4HXD A;  5D7G A;  5EDS A;  1WGG A;  2CHZ A;  1VZ6 A;  2X8X X;  1Z5S B;  2PTL A;  3ZKJ C;  4GDK A;  4WAF A;  2QC8 A;  2PVG C;  3TEZ A;  2TSS A;  3IT6 B;  4PS3 A;  3IAS 1;  4HVB A;  3SDL C;  3L0W B;  4MEM A;  2FCN A;  2LI5 A;  2N9L A;  1ESF A;  2GRI A;  5J18 A;  3NRZ A;  2DX5 B;  5JHA A;  1I4R A;  4FHK A;  4JX1 C;  3CWI A;  2ACZ B;  5IKC M;  1HTQ A;  3UIP B;  2MA9 B;  4CO7 A;  4S17 A;  4P16 A;  1H8C A;  3RNB C;  3U4E G;  2KN5 A;  3AUL A;  2MX2 A;  3SFD B;  1WR6 E;  3BYY B;  1F0Z A;  1FEH A;  2KKC A;  4JE3 B;  4REZ A;  4XZ4 A;  2WYQ A;  1F52 A;  1E5W A;  3DHI C;  3NZ3 A;  1M94 A;  1TS5 A;  3FAH A;  1R4M B;  3H7S A;  1R4M I;  4MSM B;  1YN4 A;  2LHE A;  4KZC A;  1NEN B;  2G3Q B;  2CKH B;  1OEY A;  1L7Y A;  4EEW A;  1UEL A;  3V05 A;  3Q8F A;  4A20 A;  3EEC A;  3B1L X;  3PGE A;  2K3U A;  1GOZ A;  4KKI A;  1JWU D;  3H7P A;  3KWV A;  5JXV A;  2DZM A;  2AWT A;  3NJT A;  3N1Z C;  3RD2 A;  1IGC A;  2DAF A;  5GMV A;  4IC7 B;  2D11 A;  4HJG E;  4XWW A;  3PS6 A;  1NEK B;  2WU5 B;  5CTR C;  5G5H A;  2DZI A;  1JRU A;  2O6V B;  2LUE A;  2M0A A;  1V9J A;  3DWM A;  3TIX A;  3AH7 A;  5AZF A;  1KLU D;  3AU5 A;  2KVZ A;  2N7D A;  3ZIM A;  2JQR B;  2BT6 A;  2VRR B;  4D2K A;  5DPT A;  2IBI B;  4RM8 A;  4HLE A;  1CQV A;  3VTU A;  4C80 A;  2NBV B;  3PLU A;  4YSY B;  1KM7 A;  2MJE A;  1WX7 A;  3KW5 B;  2QIL A;  2WXR A;  2BYF A;  1YOV B;  2C7H A;  4M8M A;  3PHX B;  3QA8 A;  2BF8 B;  2WXQ A;  1V5O A;  1FRD A;  1ACC A;  1ZW7 A;  2XN9 C;  1Y8R C;  2QEJ C;  3PSE B;  3VFK A;  3ZTC A;  5MPO A;  3J9C A;  1R4N B;  3P2B A;  1R4N I;  4KX6 B;  5IOI A;  1MVK A;  3BIN A;  1VZ7 A;  1F1H A;  1TZO A;  4HK2 A;  2J7Q B;  3AED B;  4PK1 A;  1YIW A;  4EZL A;  1WJU A;  2WLB A;  1WGD A;  4ZYN A;  1FO4 A;  2N7J A;  2RPV A;  5IN7 A;  3AEG B;  4DHJ D;  4KZ0 A;  2BQQ A;  4NAM A;  3V3X A;  1WI0 A;  3FIL A;  1T0Q C;  2IGG A;  2KMM A;  3AE8 B;  2DZK A;  1T0S C;  3NZS A;  1QOB A;  3A9K A;  1WWT A;  4A3P A;  3APC A;  4ARC A;  5H92 C;  2PPH A;  2BW2 A;  3T3O A;  2FCM A;  4C7Y A;  2AEH A;  3VR9 B;  3QHT A;  2LZ6 A;  4WJN A;  1YMH E;  5FR6 A;  1AW7 A;  2OED A;  1SB3 C;  3P1M A;  3GB1 A;  2V9H A;  2YEP F;  2QHO A;  1WYG A;  4K3C A;  2IO3 B;  5E6O A;  3TMP B;  3NZU A;  5I4D A;  2KO3 A;  2J53 A;  5C3J B;  3EA6 A;  5AZH A;  3AEB B;  1ZOY B;  3IFW B;  3ZDM C;  3D32 A;  1MI0 A;  4MH0 E;  1V49 A;  4M0W B;  3BK2 A;  1C9F A;  3ZTD A;  3I57 A;  1KFY B;  2KC2 A;  3WAL A;  4HKZ E;  1TS2 A;  5G2N A;  2WXF A;  3UIN B;  4JQW C;  1QOF A;  4E71 A;  1WM2 A;  2WXJ A;  2CJN A;  1IGD A;  3WAM A;  2WDV B;  1CMX B;  1E7P B;  1H4R A;  3P4Q B;  4BKG A;  3MC8 A;  2QJL A;  2MLB A;  2BTE A;  2ZW1 A;  1PGB A;  1FNV A;  2KHW B;  4II3 B;  4F1S A;  4WH4 A;  1ZKH A;  4OVV A;  3JW0 X;  4M01 A;  1C78 A;  2OJR A;  3ZLZ A;  3PRP B;  2PE9 A;  4FN2 A;  2PEA A;  1ZXI A;  2N4F A;  1ROE A;  3W1S C;  2XBB C;  1E8Y A;  1VRA B;  4DWF A;  3UI3 A;  3H1U A;  1EF5 A;  2JF5 A;  2WXO A;  4JLC A;  3ZVV A;  3IT4 B;  1ZPS A;  4BBN C;  4TV3 A;  2KJH B;  1BUI C;  2CJO A;  1UD7 A;  2WNM A;  4AJW A;  2JT4 B;  2KZR A;  1SEB D;  1MG8 A;  1LO5 D;  5EE3 A;  1F77 A;  1ZP0 B;  1SJE D;  4US9 A;  1D4B A;  3X23 A;  2NS5 A;  1NVI D;  3KYC D;  4G3X B;  3KQ4 A;  5D2M B;  1GB4 A;  1WJ6 A;  5LXH A;  3RMK C;  3VRB B;  5CHF A;  2JUO A;  4MSQ B;  3AEA B;  4W9D A;  1GC6 A;  2Q5W D;  1J7C A;  2WX0 A;  2Z0E B;  2C7N B;  2JSV X;  4RFB A;  3SU8 X;  1ENF A;  2HTH A;  2LGY A;  3IXS A;  3H9D A;  2ZCB A;  4IM3 A;  2SAK A;  4FJY A;  2O2V A;  4KIK A;  3U7D A;  3MJ5 A;  5FR3 A;  2N1W A;  3LYY A;  4N59 A;  4B0E A;  1EU3 A;  1A70 A;  4N6E B;  1QIL A;  4GB9 A;  2FBW B;  1WSP A;  4DHZ B;  1WZ0 A;  4ZRJ A;  2KDB A;  2M56 B;  4E3C A;  3QIJ A;  1I4P A;  3DHH C;  2RSU A;  3AV8 A;  2INP E;  4HRS A;  4K7W A;  5HG2 A;  4LTU A;  4WJO A;  2WXI A;  4W9F A;  4YSZ B;  4MDK E;  4KKJ A;  1RLF A;  4WWM A;  4WIP A;  2V4I B;  1NDD A;  3WAP A;  3EHV A;  4USA A;  4PYZ A;  1L5P A;  2L1A A;  3TEX A;  2ZPN A;  1D5Z C;  1P1A A;  3RUL A;  2LFI A;  2E3T A;  3VH3 B;  4MGI E;  4NJ6 A;  4I6L B;  1VR9 A;  4KVG B;  4P6V F;  2ZPY A;  4NJ7 A;  2YVC A;  1OFF A;  2N9K A;  3DPD A;  3TEW A;  2DAJ A;  2WXP A;  2J52 A;  3HVZ A;  4BVU C;  3TCA A;  1TZ1 A;  5AEK B;  4NAW B;  5BYQ A;  2UWQ A;  3R2T A;  1KJT A;  4K7S A;  3ZQ4 A;  4ANV A;  4BKS A;  4MGZ E;  3L17 A;  3AE5 B;  4F8C B;  4AQ7 A;  2L3Z A;  4LNI A;  3L10 B;  1FXI A;  1OEY J;  3VH4 B;  2INN E;  2KFK B;  1XLO A;  3O13 A;  3O65 B;  1MJD A;  4AP4 C;  4BKT A;  4M8N A;  2WS3 B;  1DYQ A;  3W1S A;  4H2A A;  3QX1 A;  2ZNV B;  2KOX A;  1PFD A;  2D07 B;  2LGS A;  4MH8 A;  3QJZ A;  1GAQ B;  2KAC A;  2NTS A;  2XEW A;  1EWY C;  2FNJ B;  1CZP A;  2H88 B;  3N30 A;  3VUW A;  2Y5P A;  2IZV B;  5T8I A;  2K6D B;  4WUR A;  3Q3M C;  4YL8 A;  3ZNI D;  3N1X C;  4ITK A;  1V8C A;  2K8B A;  3AM9 A;  1UGM A;  4WQO B;  2K8C A;  3PTF C;  3E9S A;  4RF1 A;  1UGJ A;  1AYF A;  1GG3 A;  4MM3 A;  2V3P A;  4EOY A;  2KWU B;  2Y3A A;  1TKY A;  2EKE C;  1SJH D;  3U8Z A;  3AMZ A;  3L16 A;  2FCQ A;  2JWU A;  2ZW0 A;  2HD5 B;  3KYD D;  1C4A A;  5TR5 A;  1UWX A;  3ML9 A;  3ONS A;  1RFA A;  3LJ3 A;  2VH1 A;  2KQ7 A;  2KDE B;  3T3N A;  1Q1O A;  3V6C B;  1LFD A;  2KTR A;  5H8Y E;  2BWF A;  3V6E B;  3RNE C;  2CR5 A;  1YD8 U;  1WRD B;  2NBW B;  3PV1 A;  1UBQ A;  3V60 A;  4NY0 A;  1F2R I;  5IO9 A;  1XXG A;  3JVZ X;  5BMH A;  1VDV A;  4HPM B;  2K5P A;  2MBQ A;  3PT2 B;  4RCO A;  2O6V A;  1P7F A;  3MFG A;  2IY1 B;  1AWD A;  1YJI A;  2D3A A;  4HCN B;  3KUZ A;  4KV2 A;  3IG3 A;  1YQ4 B;  2IO1 B;  5D3I B;  4GMV A;  1SSN A;  1R7S A;  1D5M C;  2V1Y A;  2LMC A;  3PZD A;  4A6Q A;  3DVN U;  1FNW A;  2DHZ A;  4PS8 A;  4DHJ B;  3B2F A;  1MHX A;  4IWQ A;  3WIM A;  1IP9 A;  4C4V B;  3SHQ A;  4W9K A;  2CHW A;  2J0K A;  1P3Q U;  4BOS C;  4L23 A;  3BVG A;  4FXC A;  1SIJ A;  1M4V A;  3W2D A;  1IBX A;  4Q2J A;  1GPX A;  3X0W A;  1LGR A;  1B1Z A;  2IGH A;  2CS4 A;  1V5T A;  3M62 B;  1P9D U;  4GXB A;  5JZE B;  4CQN A;  3GE3 C;  4MEL A;  4AOF A;  4OW0 A;  4FBJ B;  1KH0 A;  1XEE A;  1RAX A;  1T5X D;  1UWM A;  1CK1 A;  5CHW A;  3Q8A A;  1YNT E;  3R66 C;  2W3R A;  4M00 A;  4NZL B;  4EKU A;  2MP2 A;  4IUM B;  1VJK A;  4K3B A;  3W5V B;  4K81 A;  3AU4 A;  1OQY A;  3BYT B;  4IWO A;  1J7B A;  1BML C;  1SXT A;  3DVN V;  1V1P A;  3BY4 B;  4MT5 A;  3S2A A;  3WA0 A;  2M0X A;  1TKG A;  2DNF A;  1GJZ A;  2LGD A;  4ZRK A;  4DDI D;  2ASQ A;  4RGM A;  1L4Z B;  1UNS A;  2BPS A;  3OJ4 B;  4IKG A;  2G45 B;  3AN1 A;  2JY6 A;  4LNK A;  4IW0 A;  2YEP B;  3SEB A;  1Q5W B;  2A5U A;  1WJN A;  5E6P A;  1XF5 L;  3V62 A;  2MJD A;  2K25 A;  3RPF C;  1OTR B;  2IPK D;  2GBJ A;  4E74 A;  1JQ4 A;  4YSX B;  1PGA A;  3FC4 A;  3B9J A;  2GMI C;  3FKY A;  3H6N A;  4AUQ C;  5KHO A;  2PIA A;  1FNU A;  5DPR A;  4EUT A;  3AE1 B;  1TGZ B;  2KT7 A;  3LB8 C;  1QLB B;  3PO0 A;  3ENE A;  3NOB A;  5D94 A;  5LLI A;  1RFK A;  3DDC B;  3UQA A;  3HVD A;  4J6I A;  2D3G A;  3AEE B;  1GB1 A;  3AEC B;  4IDI A;  1XLP A;  1UBI A;  3GP7 A;  5HI1 A;  3CSF A;  3OWE B;  5BMG A;  2RDB C;  1WGY A;  3QK0 A;  4ARI A;  1WR1 A;  1Q0W B;  2KMC A;  3W1Y A;  3ZDT A;  2KJ6 A;  4XDD A;  3K9P B;  4JPS A;  2RD0 A;  4ZRI A;  1MG4 A;  4OVU A;  4KSK C;  2DWQ A;  1E8Z A;  2ZNV C;  1ZXH A;  3RZF A;  1JRO A;  2PE6 B;  2WXG A;  5D6J B;  1XCT L;  2LEK A;  3AE7 B;  3DQV A;  2LGI A;  1K51 A;  1QT9 A;  3EGR A;  1N63 A;  3URY A;  3ZXV A;  1L0X B;  2EMS A;  4BZA A;  2JRI B;  2KX3 A;  4TQ0 A;  3L13 A;  2N9P C;  3ZYY X;  4GDK B;  1HE8 A;  2KVR A;  4FA6 A;  3BK1 A;  4OZA A;  2KYW A;  4WQM A;  1HA5 A;  4BBN F;  4CHK A;  2RDG A;  1BXT A;  1TY2 A;  2KLC A;  4EZK A;  1GC7 A;  5GXG B;  1V2Y A;  1ZDV A;  2JZZ A;  3RI7 C;  2GBK A;  1Y56 A;  2XNA C;  2FID A;  1WF9 A;  1LQB A;  3QQ8 B;  3EC8 A;  4EFO A;  3I63 C;  1V80 A;  3BZD B;  3ZW3 A;  4RH6 A;  2OOB B;  1KOT A;  1N60 A;  1ET6 A;  3N1Y C;  2IO0 B;  1T3Q A;  3WCQ A;  4ASW C;  3VAW A;  2MBE A;  4G50 A;  1F2R C;  3A33 B;  5BMI A;  1MHH E;  1T0R C;  3NVY A;  2MSE D;  3RCZ A;  2KC1 A;  3PLV A;  2NCN A;  1HXY D;  4JWS C;  1OQR A;  4P1C C;  3IVF A;  2LVQ A;  4AS1 A;  2J4X A;  4LNF A;  1FFU A;  2JZ3 B;  2BS4 B;  5DPS A;  5EE9 A;  1L0V B;  1EUV B;  1S3S G;  1WXS A;  2HJ1 A;  1JCK B;  3WAN A;  1S1Q B;  2CHX A;  2K0P A;  2PJH A;  2C60 A;  1L6U A;  1LXD A;  1JML A;  3P63 A;  1FD6 A;  2QCZ A;  4WAA A;  5JH5 C;  4NAW A;  1NYR A;  1J0G A;  3RUI B;  4ZDV A;  3MJW A;  1FIQ A;  3DCG A;  2GBR A;  4XX5 A;  2KDI A;  3W9C B;  1YX5 B;  3DWG C; 
#chains in the Genus database with same CATH homology
 3AE5 B;  5EE1 A;  4AQ7 A;  1I4Q A;  2AX5 A;  1C4C A;  1FXI A;  2AQ1 B;  5D7G A;  2INN E;  1XLO A;  3O13 A;  1VZ6 A;  2EKI A;  2WS3 B;  1DYQ A;  3W1S A;  4H2A A;  1PFD A;  4MH8 A;  3MC0 B;  4B0M A;  1GAQ B;  2PTL A;  2KAC A;  4WAF A;  2NTS A;  2PVG C;  3EUB 2;  4XWT A;  1EWY C;  3TEZ A;  1IBX B;  2TSS A;  1C77 A;  1CZP A;  2H88 B;  3NVZ A;  4JWU C;  1L0Y B;  3IT6 B;  3IAS 1;  2JZP A;  3BVM A;  1N5W A;  1JWB D;  2Y5P A;  5T8I A;  1I4X A;  2L32 A;  2QSD A;  1STE A;  2N9L A;  4GLS C;  1ESF A;  4WUR A;  2GRI A;  4HRO A;  3NRZ A;  2RDH A;  3AEF B;  4NJC A;  4ITK A;  2LHD A;  1JW9 D;  1V8C A;  1I4R A;  3AM9 A;  4JX1 C;  3CWI A;  2ACZ B;  5AUK A;  3E9S A;  1PDX A;  4RF1 A;  1UGJ A;  3VRA B;  4P16 A;  1AYF A;  4OVZ A;  2V0G A;  3AE9 B;  1D5X C;  2GI9 A;  2V3P A;  3U4E G;  2Y3A A;  3TSS A;  1TKY A;  1SJH D;  1RM6 C;  3AMZ A;  1JWA D;  3SFD B;  4DXF A;  3BYY B;  2JWU A;  4RGN A;  4ZHO A;  3AE6 B;  4LK0 M;  1F0Z A;  2ZW0 A;  1FEH A;  2KQ4 X;  4JE3 B;  4YTN B;  1V1P B;  2PW9 A;  4REZ A;  1WXQ A;  1C4A A;  2AQ3 B;  1XLQ A;  3NZ3 A;  1UWX A;  1JAL A;  1TS5 A;  3FAH A;  1D6E C;  2WXL A;  2BB5 A;  1ET9 A;  1YN4 A;  2LHE A;  4MAC A;  1NEN B;  3BWU D;  1JRP A;  3T3N A;  4TQ1 A;  3ZGZ A;  2HDE A;  2IJ0 A;  3V05 A;  4A9A A;  4RF0 A;  3Q8F A;  5BYS A;  5H8Y E;  1YN3 A;  1E0Z A;  2K3U A;  1GOZ A;  4ZOH C;  4KKI A;  1JWU D;  3KWV A;  5JXV A;  1F2R I;  1IGC A;  1YQ3 B;  1XXG A;  5BMH A;  1VDV A;  4TMA B;  5TSS A;  2K5P A;  4HJG E;  4RCO A;  3NS1 A;  4ZHP A;  4XWW A;  1NEK B;  1P7F A;  2LUM A;  3MFG A;  2WU5 B;  3MP9 A;  5G5H A;  3U7Z A;  2DBY A;  1AWD A;  1YJI A;  2M0A A;  5D3I B;  1YQ4 B;  3DWM A;  3AH7 A;  2EEL A;  1KLU D;  1SSN A;  1QOG A;  2WXK A;  1R7S A;  1D5M C;  5FKA C;  2WXN A;  2LMC A;  5G5G A;  4A6Q A;  2SEB D;  3B2G A;  1FNW A;  2IGD A;  2JQR B;  1HZ6 A;  2BT6 A;  1DOI A;  2CU3 A;  3B2F A;  1OQQ A;  1MHX A;  4D2K A;  5LNK 1;  1CQV A;  4C80 A;  2MH7 A;  1EU4 A;  2L83 A;  1SE4 A;  4YSY B;  5EE0 A;  2QIE B;  4RGO S;  2MJE A;  1RYJ A;  3CIR B;  2QIL A;  2WXR A;  2RMM A;  3GS2 A;  3I9V 1;  3BVG A;  1NYQ A;  2W3S A;  4L23 A;  4DQO C;  3ETR A;  1V1O A;  4FXC A;  1SIJ A;  1M4V A;  1XCQ L;  3W2D A;  2DYM A;  4UDU C;  1IBX A;  1TJE A;  2WXQ A;  3Q8C A;  1FRD A;  4Q2J A;  1GPX A;  1ACC A;  1B1Z A;  2IGH A;  5D3D A;  3ZJU A;  4OHJ A;  2XN9 C;  2G9H D;  2QEJ C;  4CQN A;  4HEA 1;  1N5X A;  2KN4 A;  3J9C A;  4KGR A;  5MPO A;  4OW0 A;  1KH0 A;  3PZ8 A;  1FFV A;  4KX6 B;  1QKZ A;  5FK9 C;  1MVK A;  2E6X A;  1FMA D;  1VZ7 A;  4IOI E;  3BII D;  1AN8 A;  1KTK A;  1XEE A;  1B9R A;  1T5X D;  1TZO A;  1UWM A;  1I4H A;  4YXD B;  1CK1 A;  3AED B;  3Q8A A;  2I38 A;  2WQY B;  1YNT E;  2L52 A;  2W3R A;  2MJ3 A;  4YWG G;  5E6J A;  4NZL B;  2WLB A;  4C56 C;  1TS4 A;  1FO4 A;  1DGJ A;  2N7J A;  2RPV A;  2BS3 B;  1VJK A;  3W5V B;  2DYO A;  1CJE A;  1QOA A;  4J3O D;  3SFE B;  1TKE A;  3AEG B;  3MHZ A;  1YN5 A;  1WGK A;  4R3D A;  3BYT B;  2PMV A;  1EM7 A;  1TY0 A;  4NAM A;  1K52 A;  3V3X A;  3FIL A;  4KGT A;  1J7B A;  1BML C;  2IGG A;  1SXT A;  2KMM A;  1V1P A;  2LJI A;  4MT5 A;  3KLS X;  3FIL B;  3AE8 B;  1QOB A;  1TKG A;  3NUH B;  3RFZ B;  3ABV B;  1XO3 A;  4RGT A;  5HHD G;  1WWT A;  2AQ2 B;  2BBC A;  2N0S B;  2VZK B;  3PZ7 A;  1NI3 A;  1KRH A;  2BS2 B;  4RGM A;  4ARC A;  5H92 C;  1L4Z B;  1UNS A;  2BW2 A;  4IKG A;  2K9X A;  3T3O A;  3AN1 A;  1N61 A;  4C7Y A;  2FE8 A;  2YEP B;  3SEB A;  2V3N A;  3LXF A;  3VR9 B;  2NMQ A;  1YMH E;  1AW7 A;  2OED A;  1SB3 C;  2W82 A;  1XF5 L;  3P1M A;  3GB1 A;  2YEP F;  1P7E A;  2MJD A;  3N9Y C;  1WYG A;  2R61 A;  2GB1 A;  3P4R B;  1C76 A;  1SE2 A;  3RPF C;  5I4D A;  2IPK D;  1JQ4 A;  3U2S C;  2J53 A;  1JWM D;  2BYT A;  4YSX B;  4LLG M;  1EWC A;  1PGA A;  2WDR B;  5C3J B;  3VQI A;  3EA6 A;  3FC4 A;  3AEB B;  1ZOY B;  3B9J A;  3TEY A;  1MI0 A;  1FXA A;  1SE3 A;  2FUG 1;  1T6B X;  1JWS D;  2DLB A;  3BK2 A;  1C9F A;  3I57 A;  1KFY B;  2PIA A;  2W55 A;  1FNU A;  1HEZ E;  4HKZ E;  2J42 A;  1TS2 A;  3AE1 B;  3PO0 A;  3LB8 C;  1QLB B;  2WXF A;  4DXG A;  1FCL A;  3KWL A;  1QOF A;  3Q8B A;  1RFK A;  2WXJ A;  2CJN A;  3HVD A;  1HZ5 A;  1IGD A;  2WDV B;  2WDQ B;  3AEE B;  2JYT A;  1E7P B;  1GB1 A;  3AEC B;  3P4Q B;  3R8B A;  2QJL A;  4IDI A;  1XLP A;  2NTT A;  1WRI A;  1I7H A;  2WU2 B;  3GP7 A;  2PLP A;  2JU6 X;  4YT0 B;  5HI1 A;  2H89 B;  3OWE B;  2BTE A;  5BMG A;  1ZDX A;  2ZW1 A;  1PGB A;  1FNV A;  4WH4 A;  4A90 A;  2IDY A;  1HQR D;  3Q69 A;  3P4S B;  4ARI A;  1I4G A;  1C78 A;  1L4D B;  4XDD A;  4JPS A;  2MEK A;  1E9M A;  2B76 B;  3VR8 B;  2KWD A;  2PKO A;  2DWQ A;  2Z8L A;  3ZJV A;  1ZXH A;  1ZXI A;  1JRO A;  1ROE A;  3U52 E;  2WXG A;  1PUT A;  1VRA B;  4EE2 A;  1XCT L;  3UI3 A;  4A55 A;  2WP9 B;  1TS3 A;  1ZUD 2;  2LEK A;  3AE7 B;  3E56 A;  2LGI A;  2WXO A;  4L1B A;  1C79 A;  1K51 A;  1ZPS A;  3IT4 B;  1QT9 A;  5BYR A;  2D5G A;  3IAM 1;  1BUI C;  2CJO A;  4OZC A;  4ZRP A;  2WNM A;  4N58 A;  3EGR A;  1N63 A;  3URY A;  1V97 A;  1SEB D;  1L0X B;  1LO5 D;  5EE3 A;  3TUO A;  1XLN A;  1F77 A;  1ZP0 B;  1SJE D;  4US9 A;  4ZRQ A;  4TQ0 A;  1PGX A;  2G1E A;  3P4P B;  1D4B A;  3ZYY X;  1VLB A;  4GDK B;  1NVI D;  4O1N A;  2ONQ A;  4RNA A;  3KQ4 A;  1GB4 A;  1K50 A;  3BK1 A;  4OZA A;  3VRB B;  1N62 A;  3H8H A;  4WQM A;  1ZE3 D;  1HA5 A;  3AEA B;  1Q10 A;  2RDG A;  1BXT A;  1TY2 A;  1DOX A;  2Q5W D;  1TYG B;  1L6V A;  1J7C A;  3Q8E A;  3AE3 B;  2PVO D;  2ICI A;  2BB6 A;  2JSV X;  2OHF A;  4RFB A;  4HKQ A;  5GXG B;  1ENF A;  3AE4 B;  4L2Y A;  1QF6 A;  3IXS A;  1E10 A;  2SAK A;  1ZDV A;  2JX5 A;  4ZYS A;  1Y56 A;  3MJ5 A;  5FR3 A;  1DOY A;  2XNA C;  3ZJT A;  1E6E B;  3LYY A;  1C4P A;  4N59 A;  4B0E A;  1EU3 A;  1A70 A;  4N6E B;  1IUE A;  1KF6 B;  1QIL A;  4MM3 B;  3BZD B;  2FBW B;  1WSP A;  3C8Y A;  4RH6 A;  4YTP B;  5AUI A;  1N60 A;  1UUP A;  1ET6 A;  1FRR A;  4YTM B;  2M56 B;  1T3Q A;  1VZ8 A;  3WCQ A;  4PT5 A;  1I4P A;  2Y5C A;  2I2Y A;  1K53 A;  3BVZ A;  3AV8 A;  2INP E;  2WXH A;  4HRS A;  5HG2 A;  3NVV A;  1F2R C;  5BMI A;  5C2T B;  1J7A A;  4LTU A;  4M0W A;  1MHH E;  2WXI A;  4TSS A;  4YSZ B;  4KKJ A;  3NVY A;  3NVW A;  4WWM A;  4A8X C;  4WIP A;  2V4I B;  3AE2 B;  2JXT A;  4JWS C;  1HXY D;  4USA A;  1OQR A;  4KGS A;  1L5P A;  3P42 A;  1SF0 A;  2ON8 A;  2L1A A;  4AS1 A;  2J4X A;  1FFU A;  3TEX A;  1D5Z C;  2BS4 B;  5EE9 A;  1L0V B;  2LFI A;  2E3T A;  1KLG D;  1SBB B;  3R2I A;  3SR6 A;  4XE0 A;  1JCK B;  2K22 A;  3W5U B;  1VR9 A;  2KDM A;  2VZK D;  4P6V F;  2K0P A;  4OZB A;  2KAJ A;  1L6U A;  2W54 A;  1FCC C;  1FM0 D;  5HFY A;  3HUI A;  2X38 A;  4C7Z A;  1JML A;  1YJJ A;  3AB5 A;  3P63 A;  1MPE A;  2JYE A;  2WXM A;  4XDC A;  1FD6 A;  1OFF A;  2N9K A;  3TEW A;  3HRD D;  2WXP A;  2J52 A;  3HVZ A;  1NYR A;  4NAW B;  1FIQ A;  1PYW D;  2HTM E;  2QMT A;  5BYQ A;  3R2T A;  1QQR A;  3L4P A;  3ZQ4 A;  4US8 A;  3W9C B;  4GDL B;  3DWG C;  1RWS A;  2M19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...