5BMIA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmiA00
4OZBA 2ZW1A 1HZ5A 5HHDG 2LGIA 2JU6X 5BMGA 1HZ6A 2IGDA 1P7EA 2ZW0A 1XCQL 3FILB 1GB1A 1MI0A 2J53A 1K50A 4GLSC 1C9FA 2JXTA 1K51A 1K53A 2K0PA 2KACA 4KGSA 4WH4A 2NMQA 1F2RC 2GB1A 2JZPA 2KWDA 1IGDA 2JWUA 2LHEA 4HJGE 2PW9A 2I38A 1MPEA 2J52A 1PGXA 2IGHA 2IGGA 1XF5L 1JMLA 1MVKA 4KGRA 5HG2A 2OEDA 1XCTL 5BMIA 1FCLA 2KN4A 2N7JA 2LUMA 2PTLA 1YNTE 1GB4A 3V3XA 3GB1A 2LHDA 1P7FA 2N9LA 4OZCA 5HI1A 3UI3A 2KDMA 1IBXB 1MHHE 2N9KA 1IBXA 2EELA 2GI9A 2ON8A 2QSDA 1FCCC 4KGTA 1F2RI 1QKZA 1MHXA 1KH0A 2QMTA 1UWXA 1Q10A 1YMHE 2RPVA 1EM7A 2KQ4X 4OZAA 1FD6A 2PLPA 1D4BA 4MACA 5BMHA 3MP9A 1HEZE 1PGBA 4HKZE 2RMMA 3FILA 1IGCA 2JSVX 5JXVA 2I2YA 1K52A 4IKGA 1ZXHA 4IOIE 5HFYA 4D2KA 2ONQA 1PGAA
chains in the Genus database with same CATH superfamily
1E8XA 4C4VB 2KQSA 3VTUA 4EKUA 1AWDA 2KANA 4MJSB 5HHDG 2LGIA 3VQIA 3AE6B 1N62A 2LUEA 4RM8A 2GOWA 1FPYA 4YXDB 3AU5A 4OVVA 2ZNVB 2ICIA 5AUKA 3AEBB 1C9FA 2B3AA 1D6EC 4DDID 1ZW7A 1LQBA 2KWUB 5DPSA 2HTHA 4RFBA 3AEDB 1F52A 3AULA 3DHIC 3SDLC 1R4NB 5LLIA 1ISNA 2N7JA 1WJNA 3W5UB 5LXHA 1ACCA 1XT9B 1JCKB 1P1AA 4X57B 2KWVB 1GB4A 1BMLC 1V6EA 3GB1A 3V60A 3CSTA 3ZNGC 2LHDA 1P7FA 4OZCA 1T0RC 3Q3MC 4NAWA 5HI1A 2KDMA 3BVZA 2UYZB 3UGBB 2QEJC 4AS1A 3VFKA 1P9DU 3N30A 4LNIA 2LVPA 3AE9B 2CJOA 2A4ZA 2BBCA 2WXQA 2L0TA 1VR9A 1I4XA 2RPVA 4YTPB 4P7IA 4ZRJA 4WQMA 4GGQA 2WHIA 1RYJA 1HXYD 4BAXA 1NI3A 1WE6A 3N9YC 3APCA 2KO3A 2KX0A 3UIPB 3PRPB 1FFUA 3PTFC 2KDFB 3QA8A 3W2DA 2WNMA 2DX5B 1TS4A 1VZ8A 2KFJA 4WJQA 4RNAA 4DBGA 1WX7A 2H88B 3DBSA 1KRHA 3SD5A 3JSVA 4IKGA 4IOIE 1TKGA 3SHQA 4WURA 2JY6A 1TZ1A 4F8CB 1PGAA 4IDIA 3VAWA 1M94A 2K39A 3RI7C 2PVOD 4BVUC 2ACZB 2HDEA 3VUWA 4MT5A 1NI2A 4NJ7A 5J18A 1DOIA 2W82A 5E6PA 3GS2A 4DXFA 4W9CA 4KGSA 5KHOA 1MJDA 3EA6A 5G2NA 3HM6X 1SF0A 4WAAA 4LNNA 4YWGG 1PGXA 2KTRB 2O6VA 4DXGA 4JWSC 3BVGA 1FXAA 2J42A 1WJUA 1WXQA 2G3QB 3ZTDA 4FN2A 2M56B 2K25A 1Q1OA 2WXIA 2KNBA 5EE3A 4XX5A 4K1RB 1ZE3D 4AWJA 1E8WA 2K5PA 4A9AA 4AOFA 1WH3A 2XEWA 2J0MA 3I9V1 2WDQB 3VTVA 1QT9A 3VDZA 4M01A 4DK5A 1SSNA 3Q2AC 5G5HA 1TBEA 2MA9B 4MJSA 1R7SA 3RN9C 4ACFA 3QAQA 1Q5WB 2RDBC 1KFYB 1YD8U 3AECB 2KKCA 5JXVA 4AJYB 1ZXHA 3M63B 3OLMD 3VRAB 3N1XC 2V4LA 1SIJA 5T8IA 4LNKA 3R7QA 3ECIA 2AQ3B 3B2FA 2FNJB 1WGYA 1ZDVA 2BYVE 3ZJUA 2JZ3B 2DZMA 3AB5A 3U2SC 5HKHA 3SR6A 4A20A 2FBWB 4ICVA 2DWQA 5GXGB 2VZKD 3QIJA 4LJOB 4HCPB 2QIEB 4KZCA 3AN1A 4DHJB 2JZPA 1HQRD 2FIDA 2KMAA 5L95C 2NBWB 2I38A 1XLQA 2MEKA 2BW2A 2IGHA 1V1OA 2BYEA 4OVUA 2KJHB 2MWSB 3ZRFA 2BPSA 3Q8CA 3KUDB 4CQNA 2LUMA 4IWPA 3A1QB 3A9KA 3W1SC 4LNOA 3NS1A 2V3PA 2N9KA 3Q8FA 1TY2A 1V8CA 2W9NA 1MHXA 1J0GA 4HROA 3ZNID 3GOEA 1QILA 2JPHA 3LYYA 3PHXB 2PJHA 2KQ4X 3ZNZB 3ML9A 4C7ZA 1E8ZA 1T6BX 2DYOA 3VH3B 2MBHA 5D2MB 3O13A 2N7DA 2WGSA 5I4DA 2EKIA 2INCC 2W3RA 1B1ZA 1BUIC 3PS6A 4YSYB 2RR9A 2KVRA 2CHZA 5IAAC 2D07B 2ZEQA 2GBKA 4KIKB 2QILA 1UH6A 2JU6X 1GC7A 2NPTB 3L54A 4NZLB 2KTRA 3FILB 4MH8A 3BWUD 2VH2A 3NVYA 4WAFA 2DNFA 3P4RB 3IFWB 3BINA 3CSFA 3VVWB 3Q6BA 4ZRKA 2GB1A 3QCAA 5IKCM 5TR5A 2K8HA 3A4RA 4K7UA 3S2AA 1SJED 3DQVA 3EUB2 4ANVA 2J52A 3KUCB 2FE8A 4JQWC 4XC2A 1FIQA 1OTRB 1BXTA 1I4PA 3IT4B 3KLSX 1IUEA 3H7SA 4LDTB 4NJCA 4KSLC 2N1WA 3BZDB 1WSPA 4P6VF 4IWOA 1I4HA 3T3OA 4DWFA 2BB5A 1NENB 1D5XC 3RZWC 3RNEC 2BT6A 3ALBA 1J7CA 1V97A 5D94A 4IG7B 1IBXB 2C7HA 4N9F4 5DPWA 2LJIA 4HLEA 2L0FA 1H4RA 1H8CA 3RNAC 2IBIB 3N3KB 2W54A 1DOXA 2QMTA 3VTWA 3O65B 2L00B 2M4NA 3ZGZA 2O2VB 4MM3B 3MP9A 3AE4B 1UELA 4BBNC 1EO6A 2IY0B 2OHFA 5IP4D 1KLVA 3TBLD 5H92C 1V81A 4G3XB 1CJEA 2KXJA 5TSSA 1GNUA 3M62B 4ZRPA 2A5UA 3EECA 3MHZA 3U7ZA 1G6JA 1WYGA 2J0KA 2D3CA 1E7VA 2LVQA 2X8XX 3A4SC 1QQRA 2BB6A 2JYEA 3L4PA 4RM9A 2KLGA 1GB1A 4L1BA 1XLNA 4ANUA 2KYWA 4B95A 1SBBB 3OWEB 4TUUA 1FMAD 1E7UA 3A1QA 3BIID 4JL9A 1UGMA 1I4QA 4US8A 1LXDA 2K8BA 5D6JB 1C77A 2EMTA 3NS8A 2M8SA 1WR6E 1A70A 3OAWA 3KYCD 1MFWA 1DYQA 4M02A 1YJJA 1EUVB 1UF0A 3TSSA 3WALA 4W9IA 2LGDA 2J7QB 3TEYA 4FBJB 2WLBA 1OQQA 1FNVA 3P2BA 2WXPA 2G4DB 2L1AA 2V1YA 3KVFB 4EZLA 2K6DB 3WANA 2N9XA 2KAJA 3R7RA 2XN9C 1UWXA 1AYFA 3TEZA 1EF5A 1NEKB 2ZNVC 1GAQB 4WQOB 1EM7A 2WS3B 4GU2A 2FUG1 3H8HA 3DBRB 2NS5A 5BO4B 1WMHA 3DVNV 2IO0B 5BMHA 2WYQA 1FRDA 2JYTA 1KJTA 3FILA 4K7SA 2K9XA 3BVMA 4MEMA 2JSVX 1L4DB 1U4AA 1C4PA 5E6JA 2PVGC 3R2TA 3DOWA 2V0GA 1M4VA 2BKFA 1EU3A 3PPAA 1MI0A 1F77A 1RM6C 1YJ1A 1CQVA 2DHZA 3CWIA 3GP7A 1B9RA 2L32A 1WGRA 2O6VD 1WIAA 1JWAD 1ZOYB 2GLSA 3R66C 1N60A 4E71A 1SE4A 2NTSA 2WWZA 2GMIC 3ZIMA 3HK0A 2IDYA 2RGFA 2M0XA 4HRSA 3AEGB 4W9GA 3IAS1 2LVOA 1I35A 4LLGM 2W55A 3HHMA 2GBNA 2DZJA 3UF8A 1L4ZB 2CKHB 5BMIA 1TKEA 1Z5SB 1E90A 3SEBA 4ANXA 1DGJA 2LGXA 3ZXRA 3PHWB 1YJIA 3EFUA 1HE8A 3DBHB 3NY5A 2LGYA 2NR2A 3VR9B 3ZQ4A 2PE6B 3Q3JA 3B9JA 2KHWB 4G50A 1N5WA 3TEXA 3CMMB 1QOFA 3L0WB 3AE3B 3RD2A 3H1UA 1QZEA 1WGHA 1S1QB 3H6NA 2CU3A 4BBNF 4XE0A 2PLPA 4GIVA 4WIPA 2MHJA 1WXVA 2ZCBA 2HD5B 3H7PB 2MBEA 1E10A 4URKA 3ZUNA 3LB8C 4HPLB 4S17A 1AN8A 2KFKA 3T3NA 1CZPA 3DVNU 2SAKA 3FC4A 1JWUD 1HA5A 1E9MA 4MGZE 2QJLA 4P1BC 2K1FA 3RNBC 3ZTCA 2D2QA 3DHGC 3WA0A 3B1LX 2D3AA 4D2KA 1L6UA 4RF1A 3LDZE 5AZHA 2KLCA 2KN5A 4K81A 2ZW1A 2TSSA 2J4XA 4R3DA 1N5XA 4MELA 1LM8B 4J3OD 4NY0A 1FRRA 4XDCA 3VRBB 3R2IA 2LFIA 2KWCA 1XLOA 1LGRA 5AEKB 1K53A 2NMQA 3PV1A 3RMKC 2KWDA 4AUQC 1E7PB 2AYOB 2BS4B 2OJWA 3RULA 4EZJA 4LCDE 5D3DA 5BYQA 3P4PB 1C3TA 1JMLA 4HXDA 3UQAA 3PZDA 5HG2A 4JE3B 4P1CC 2IO3B 2BKRB 2QHOA 2Y5CA 4YTNB 5DPRA 3RFZB 1SB3C 2Z0DB 3VUYA 1V1PA 5EE9A 1J7AA 4OW0A 4EZKA 2MQJA 3NG0A 4FJVB 4JPSA 3TJPA 3AEAB 1P0RA 1F2RI 2GBJA 1WXSA 2DYMA 4OVZA 1E5WA 1D5ZC 1WJ6A 1HTQA 1QOGA 3OJ4B 1HTOA 1ROEA 4IWQA 3V6CB 5C23A 2JVCA 3NJTA 2R2QA 2ZCCA 2C60A 5J2RA 2Y3AA 4E74A 2FAZA 1L5PA 1E0ZA 4A8XC 1PGBA 3PRZA 2E3TA 3APFA 1V2YA 3B08A 3DBRI 5AUIA 1D3ZA 3K9PB 2ZPNA 2IZVB 4HDOA 4C4VA 2N1VA 5CTRC 2KMMA 3IBEA 3QWZB 2IGDA 5E6OA 1P7EA 2ZW0A 3A9JB 4XZ4A 3QC8B 4W9LA 1UZXB 3ML8A 4FULA 3KWVA 1AW7A 2WXGA 2MH7A 2JZZA 2JXTA 3ZDMC 3L13A 3TIXA 2M17A 2LHEA 2V3NA 4AJWA 2V3SA 1IPGA 2G4SA 4RF0A 4N6EB 2JWZA 2OOBB 4A6QA 1T0YA 2C9WB 1TTNA 2KK8A 2RPQA 2WXLA 1VCBA 4ARCA 2OEDA 1N6ZA 4B9KA 5JHBA 1V5TA 3I5JC 4I6PA 3TEWA 1JROA 5IN7A 3TUOA 1OEYJ 5IO9A 1WXMA 3EC8A 3V3XA 3HVZA 4ZDVA 1VZ6A 4KSKC 2WX1A 1XLPA 2QDFA 4ANWA 3M3JA 4BKGA 3Q8EA 1RFAA 5FK9C 3KW5B 2DZKA 3X23A 3V61A 4KKIA 4FLHA 3DBHI 2Z0EB 1WFYA 1J19A 1YN3A 4LJPB 1D4BA 4MACA 2BF8B 4DHJD 1HEZE 3ZVVA 3DDCB 1XXGA 3ONSA 1KTKA 4JIOU 3MFGA 4M0WB 1YIWA 2HJ8A 1ZDXA 2KC2A 3V6EB 1K52A 1FEHA 1OQYA 1RWSA 2WXKA 5CHWA 2CU1A 5HFYA 3KYDD 1RAXA 3DBLB 3HVDA 3N20C 5EE0A 3RT3B 4IW0A 2L05A 5CHFA 2PKOA 3KQ4A 1MG8A 4F7ZA 4KVGB 3AMZA 3RNCC 4YL8A 5IA7A 4P16A 1K51A 3JYUA 3JVZX 4HEA1 2MX2A 2XK5B 3N1ZC 3D32A 4DHZB 4KDIC 4MGYE 1IGDA 1XD3B 3Q69A 3ABVB 4HJGE 4ZOHC 4PT5A 3VUXA 1FXIA 2IGGA 3DCGA 5JZEB 1XF5L 2AL3A 1YQ4B 3R8BA 3E9SA 1FCLA 1L0XB 4GDKB 4USAA 4KDLB 5FKAC 3FKYA 2KOXA 3FAHA 3PO0A 5EE1A 4EFOA 1E8YA 1NYQA 1WGDA 4ZYNA 2MP2B 4NQKE 1V80A 1VJKA 1XQQA 3IAM1 3LXFA 2DBYA 2PMVA 1J7BA 1E6EB 1WR1A 2KTFA 3UI3A 3RZFA 2GI9A 1JWBD 4KGTA 4W9DA 1I7HA 4US9A 2BGFA 4JLCA 5KHQA 1ET6A 3MC0B 4PS3A 4JWUC 3PT2B 3ZLZA 1WI0A 3EGRA 4OZAA 3AV8A 2MBOA 3SU8X 4AQ7A 1TT5B 2M0AA 4PYUA 1N61A 2LGSA 1V86A 2FCNA 2D3BA 5EDSA 2YEPB 1FO4A 1I4RA 2FIFA 2WQYB 4A3PA 4TKNA 3AI5A 1WF9A 3AE5B 3HIZA 2JUOA 3VXWA 1LO5D 2L7RA 4G11A 4WWOA 1P98A 4L23A 1WRDB 1D5MC 3QK0A 2CHXA 4W9JA 4PYZA 5DPTA 2J53A 1GUAB 2G9HD 1JWSD 4HJKA 2D10A 4OHJA 2I1KA 1Y8RC 4MGIE 3SFEB 3DWGC 3N1YC 1VD2A 4M8MA 4BKSD 3R3MA 3UIOB 4F1SA 3ZW3A 2FCQA 1ZXIA 4ZHPA 4REZA 3NZ3A 1QOAA 3VR8B 5E6NA 3CIRB 3UINB 1QOBA 1C4CA 3PSEB 3ENEA 2XNAC 3MHSD 2RDGA 1SEBD 4RGNA 3W5VB 2JRIB 4NAWB 2Q5WD 4TQ0A 2MJ3A 1ENFA 2BYFA 1MHHE 1C76A 4BZAA 1TS2A 2ON8A 4GB9A 2NBUA 1ET9A 1FCCC 3WAMA 4FXCA 1TS5A 2C7MB 3T9LA 3AU4A 4CHKA 1R4MB 1WYWB 1GOZA 3ZKJC 3BYTB 1FD6A 1FXTB 2VRRB 4BKTA 3QJZA 4Q2JA 1PYWD 3B0AA 4BOZB 2WXNA 4MDKE 3RYTA 4WJPA 3Q8BA 3IG3A 4K7WA 4M8NA 1T0SC 5JH5C 2RDHA 2IO1B 4AP4C 1JWMD 1QLBB 4I6NB 1KOTA 2LRUA 3ZXVA 2N9EB 1I42A 4KIKA 3L16A 2RD0A 4IM3A 2FCSA 3QARA 1YQ3B 5BMGA 1HZ6A 1TGZB 1EU4A 1XCQL 2NPTA 5DCNA 3DBLI 1TJEA 5IOIA 3U7DA 3VH4B 2NTTA 1YN5A 4W9FA 1TZOA 3KH0A 2PW9A 4TMAB 4WWMA 4DXAB 4NJ6A 4E3CA 3P4QB 4MSQB 1PFDA 2K3UA 2MJEA 4XYCA 4JX1C 2ASQA 1GPXA 4ZHOA 2MBBB 2KN4A 1SE2A 3URYA 1KF6B 3DWMA 3V05A 2M19A 1YN4A 2BWFA 2EKEC 3QHTA 3NHEB 3DVGX 4GSWA 2L8JA 2KDEB 1IBXA 4TV3A 3MC9A 3L08A 2AQ1B 3BYYB 5AZFA 1PUTA 4FJYA 1KH0A 2WXFA 5JHAA 3AE1B 4RCOA 1Q10A 4N58A 2R61A 1TS3A 1WE7A 1EF1A 2BWES 2DYBA 1NVID 2R2OA 1L6VA 2O2VA 2MSED 2MLBA 2B76B 4MM3A 4BKSA 4PK1A 1FFVA 3HM3A 4LNFA 1RRBA 5C3JB 3W1YA 5J17A 4ZYSA 4XGAB 3C19A 1TIFA 4J6IA 2KJ6A 2X38A 3GE8C 3DPDA 1IYFA 2KZRA 5H8YE 1V9JA 3AM9A 2CJNA 1UUPA 1F9JA 3QX1A 4RGMA 5AZGA 2JX5A 4OZBA 2N0SB 3P63A 1PDXA 3AXCA 2K6QA 2DAJA 2INNE 5D7GA 2REXA 4II3B 1WM2A 1YQBA 5C1ZA 3ZJVA 4HVBA 2Y5BB 1UBIA 3OG5A 3Q3OC 2LWPA 4UDUC 1TKYA 4K3CA 2PEAA 4XDDA 1YX5B 3AEFB 3AE7B 3AE8B 3MC8A 3WIMA 3CF6E 2IYDB 2BS2B 3L17A 2KVZA 1XCTL 2V9HA 3VHTC 1I4GA 3A9KB 3K9OB 3GZNI 4CO7A 4YSZB 4I6LB 1EWCA 4RH6A 2YLMA 4IM0A 2N4FA 4GDLB 1NBFC 3P42A 1C78A 2HJ1A 4FHKA 2QSDA 4A90A 4C00A 1T5XD 4KKJA 3B2GA 3PZ7A 1ZKHA 4KX6B 1BT0A 1ESFA 1OGWA 3U8ZA 3ZJTA 2L83A 2BTEA 2BQQA 1R4MI 4HPPA 3PVLA 1EWYC 3A33B 1CMXB 2WDTB 2JXXA 4HK2A 2KQ7A 3KWLA 1IGCA 4EEWA 2C7NB 4C80A 1NYRA 1WJ4A 2CR5A 1STEA 1VRAB 4XWWA 3RUIB 1OQRA 4IM2A 3DHHC 2LMCA 2GBRA 1HZ5A 3P1MA 2W3SA 1C1YB 4NNJB 1GC6A 1P3QU 3Q3FA 2D3GA 3C8YA 5FR6A 1QF6A 1FNUA 4FHJA 3PREA 1K50A 2WXRA 4ICUA 1TYGB 2ZJDA 4BFRA 2KACA 1WM3A 4G0NB 2LZ6A 2BS3B 4KZ0A 4QAYA 1MPEA 3RNFC 4ITKA 4HCNB 1WRIA 2KJRA 4WWNA 2FCMA 3WCQA 4CYEA 3NOBA 4IUMB 4B6WA 4EUTA 4M00A 1SIFA 2DAFA 4WJNA 3U4EG 3ZYYX 3J9CA 1UWMA 2LI5A 2N9LA 3W9CB 4TSSA 4A55A 4PS7A 3C0RB 2VH1A 1QKZA 2VZKB 2Z8LA 2ZVOA 3BK2A 1UBQA 2WXHA 4EE2A 4RGTA 1MG4A 4HPMB 2JQRB 2BYTA 4GN1A 1UD7A 3AEEB 3N32A 2Y5PA 3PGEA 3H7PA 4DHZE 3I63C 3NZUA 1TY0A 2XBBC 1Q0WB 1WXAA 1JW9D 1L0VB 4W9KA 2J0JA 2RMMA 5FR3A 2NVUI 2AWTA 2D5GA 1C4AA 3V62A 2IJ0A 2WXJA 4LTUA 2IO2B 3UQBA 2I2YA 1T3QA 2AQ2B 1WY8A 1KLUD 2ONQA 2KC1A 3QQ8B 1OEYA 5LXIB 2G45B 3ZO5B 1X1MA 2ZVNA 4C7YA 1JQ4A 2AX5A 3LJ3A 4KV2A 2CS4A 3I3TB 4W9EA 2KD0A 4HWIB 4WH4A 2IPKD 2DENB 4W9HA 3RNGC 1R4NI 1J8CA 3NRZA 4O1NA 4GXBA 2ZZPB 1V49A 4GDLA 1PQSA 3SFDB 1L0YB 4KGRA 1KLGD 2ZPYA 1VDVA 2HE7A 1IP9A 1N63A 2BVCA 4FADA 3TL5A 1SGHA 3Q14C 1F1HA 3AH7A 3PRMB 1L2NA 1NDDA 2K8CA 3P4SB 2WU5B 3L10B 4LK0M 2DLBA 3BK1A 3HRDD 4MSMB 4IC7B 1RLFA 1WZ0A 3KUZA 1AARA 5L83A 1YMHE 4II2B 4YT0B 5G55A 2FUHB 4H2AA 3ZDTA 1RFKA 1WMHB 2INDC 3U52E 2WXOA 2LJ5A 3NVVA 2L3ZA 2D11A 3H9DA 5BYSA 1Y56A 1UGJA 2AL6A 2LEKA 1WX9A 4MH0E 2K22A 4NAMA 2KDIA 3PLUA 2OJRA 1YOVB 3Q8AA 3MJWA 3HUIA 1C79A 4DQOC 3IXSA 3ZRCA 2LD9A 4GMVA 3T8MA 2JT4B 2EMSA 2MBQA 2PPHA 3U30A 3X0WA 1UNSA 3A9JA 4WJOA 1L7YA 2KMCA 3APDA 3Q3NC 2LRWA 2N9PC 5CHVC 4B0MA 1WGKA 3ZNHB 4LDTD 1Z2MA 4BOSC 1VLBA 2K0PA 1F2RC 2JWUA 2LXCA 5LNK1 4JGHB 2NBVB 2WDRB 4ASWC 1LFDA 3WAOA 4EOYA 4FA6A 3TCAA 1SJHD 4MGKE 2LASA 1GJZA 1GG3A 4HKQA 3RPFC 2M1MA 3NZSA 2EELA 3GZNB 3PZ8A 1KM7A 1FM0D 2PIAA 2WDVB 1SXTA 1WZ3A 3MTNB 3WAPA 5MPOA 1ZUD2 4ZRIA 4A3OA 5CX3A 1WWTA 4S0RA 3IVFA 2UU7A 5BYRA 1ZP0B 1K8RB 3M95A 1WX8A 4K3BA 2KFKB 2KT7A 4HKZE 4WWPA 3E56A 2G1EA 1VZ7A 2YVCA 4M0WA 4NPNA 4PS8A 1ZPSA 1T0QC 5GMVA 4B0EA 2C5LC 2E6XA 1DOYA 4GOCA 1XEEA 2WP9B 1F0ZA 2MW5A 2DZIA 3DVGY 2I1JA 1S3SG 1ZGUB 1JRPA 2GBMA 4NQLB 2PE9A 3PLVA 3BY4B 2INPE 2SEBD 3I57A 3NVWA 4L2YA 4N59A 1OFFA 2V4IB 1A5RA 2KDBA 5D3IB 3JSVB 2L52A 4GLSC 1SE9A 4FJZA 4TQ1A 4DDGD 2XK5A 2WU2B 1YX6B 5C2TB 3AE2B 1WGGA 3EHVA 2N7EA 2YEPF 2UWQA 1MVKA 3IT6B 2HTME 3ETRA 4GDKA 1CK1A 2PTLA 1YNTE 4ARIA 2MP2A 1V1PB 2Z59B 2LXAA 2MJDA 4RGOS 3GE3C 1V5OA 3NVZA 1XO3A 3MJ5A 4HDQA 2AEHA 2O6VB 2RSUA 1FNWA 2MCNB 2WX0A 1JRUA 2JRHA 2QC8A 3RCZA 3W1SA 2GRIA 3NUHB 1JALA 2MRPA 3TMPB 2JF5A 4C56C 4YTMB 3IHPC 3JW0X 5G5GA 4ZRQA 3EFCA 2WXMA 1SE3A 2NCNA 4RMAA 4YSXB 2QCZA 2H89B 2KX3A 3OJ3A 4XWTA 2CHWA 2IY1B 2L76A
chains in the Genus database with same CATH topology
1WYGA 1OQRA 3HVDA 2LMCA 5EE0A 1AWDA 2PKOA 3KQ4A 1HZ5A 3P1MA 1QQRA 2BB6A 2JYEA 2LGIA 2W3SA 5HHDG 3VQIA 3AE6B 1N62A 3L4PA 3C8YA 4L1BA 1XLNA 1GB1A 1QF6A 3AMZA 1FNUA 4YXDB 1SBBB 1K50A 3OWEB 1FMAD 2ICIA 2WXRA 5AUKA 3AEBB 1C9FA 1TYGB 4P16A 1D6EC 1K51A 4HEA1 3BIID 2KACA 1I4QA 1IGDA 4US8A 2BS3B 4RFBA 3Q69A 3ABVB 4HJGE 4ZOHC 4PT5A 1MPEA 1C77A 3AEDB 4ITKA 1FXIA 2IGGA 1A70A 1WRIA 1XF5L 1DYQA 1YQ4B 3R8BA 1YJJA 3E9SA 1FCLA 1L0XB 4GDKB 4USAA 5FKAC 3TSSA 3WCQA 3FAHA 3PO0A 5EE1A 2N7JA 3W5UB 3TEYA 1NYQA 1ACCA 2WLBA 1JCKB 1OQQA 3U4EG 1VJKA 3ZYYX 3J9CA 1FNVA 1BMLC 1GB4A 3IAM1 3LXFA 2WXPA 3GB1A 1UWMA 2DBYA 2LHDA 2PMVA 1J7BA 1E6EB 1P7FA 2L1AA 2N9LA 4OZCA 4TSSA 5HI1A 2KDMA 3BVZA 3UI3A 3W9CB 4A55A 2QEJC 4AS1A 2GI9A 1JWBD 2KAJA 3AE9B 2XN9C 4KGTA 1I7HA 1QKZA 2CJOA 2VZKB 4US9A 2Z8LA 2BBCA 2WXQA 1UWXA 1AYFA 1ET6A 3BK2A 3MC0B 1VR9A 3TEZA 1I4XA 1NEKB 1GAQB 2RPVA 2WXHA 4YTPB 1EM7A 4JWUC 2WS3B 4EE2A 3EGRA 2FUG1 4OZAA 4RGTA 3AV8A 3H8HA 4WQMA 2JQRB 1RYJA 2BYTA 1HXYD 1NI3A 5BMHA 3N9YC 3AEEB 2Y5PA 4AQ7A 1FFUA 1TY0A 2M0AA 1FRDA 2JYTA 1N61A 1JW9D 1L0VB 3W2DA 2WNMA 2RMMA 5FR3A 1TS4A 1VZ8A 3FILA 2D5GA 4RNAA 1C4AA 2YEPB 1FO4A 2IJ0A 1I4RA 2K9XA 2H88B 2WXJA 3BVMA 2JSVX 4LTUA 1KRHA 2I2YA 2WQYB 1T3QA 4IKGA 4IOIE 2AQ2B 1L4DB 1TKGA 4WURA 3AE5B 1KLUD 2ONQA 1PGAA 1C4PA 1LO5D 4IDIA 5E6JA 2PVGC 4L23A 3R2TA 2PVOD 1D5MC 1M4VA 2ACZB 2HDEA 2V0GA 1EU3A 4C7YA 1JQ4A 4MT5A 1MI0A 1F77A 1DOIA 1RM6C 2J53A 2G9HD 2AX5A 2W82A 1CQVA 1JWSD 3CWIA 3GP7A 4OHJA 1B9RA 2L32A 3GS2A 4DXFA 1ZOYB 1JWAD 4KGSA 4WH4A 1N60A 2IPKD 1SE4A 3EA6A 2NTSA 3SFEB 3DWGC 2IDYA 3NRZA 4O1NA 4HRSA 3AEGB 1SF0A 3IAS1 4YWGG 1PGXA 4LLGM 2W55A 3SFDB 1ZXIA 1L0YB 4KGRA 4REZA 4ZHPA 3NZ3A 1KLGD 1QOAA 3VR8B 1L4ZB 5BMIA 4DXGA 1TKEA 1VDVA 3CIRB 4JWSC 1QOBA 1N63A 3SEBA 1C4CA 1FXAA 1DGJA 2J42A 3BVGA 1WXQA 2XNAC 2RDGA 1YJIA 3AH7A 1SEBD 2M56B 4RGNA 3W5VB 4NAWB 2Q5WD 3P4SB 4TQ0A 2MJ3A 1ENFA 2WU5B 4LK0M 1MHHE 2DLBA 2WXIA 3BK1A 3VR9B 3ZQ4A 5EE3A 3HRDD 1C76A 1TS2A 1ZE3D 2ON8A 3B9JA 1ET9A 2K5PA 1FCCC 1N5WA 3TEXA 4A9AA 1QOFA 3I9V1 2WDQB 3AE3B 1QT9A 4FXCA 1YMHE 1TS5A 1GOZA 4YT0B 3BYTB 1SSNA 1FD6A 2CU3A 4H2AA 1RFKA 4XE0A 2PLPA 3U52E 2WXOA 4WIPA 5G5HA 3NVVA 5BYSA 1E10A 4Q2JA 1PYWD 1Y56A 2WXNA 1UGJA 3LB8C 1R7SA 1AN8A 2LEKA 3T3NA 1CZPA 2SAKA 3FC4A 3Q8BA 1KFYB 1JWUD 1HA5A 1E9MA 5JXVA 3AECB 2QJLA 2K22A 2RDHA 4NAMA 1ZXHA 3VRAB 1SIJA 4D2KA 5T8IA 1L6UA 3Q8AA 1JWMD 1QLBB 4RF1A 3HUIA 1C79A 2AQ3B 3B2FA 4DQOC 2ZW1A 2TSSA 3IXSA 2J4XA 4R3DA 1ZDVA 1N5XA 1YQ3B 5BMGA 3ZJUA 1HZ6A 4J3OD 1EU4A 1XCQL 3AB5A 1UNSA 1FRRA 3U2SC 3SR6A 1TJEA 2FBWB 2DWQA 5GXGB 2VZKD 4XDCA 3VRBB 3R2IA 2LFIA 1WGKA 4B0MA 1XLOA 2QIEB 3AN1A 1VLBA 1K53A 2K0PA 2NTTA 2NMQA 1YN5A 1F2RC 2JZPA 2KWDA 2JWUA 1HQRD 1E7PB 1TZOA 2PW9A 4TMAB 4WWMA 5LNK1 2I38A 1XLQA 2BS4B 2WDRB 3P4QB 2MEKA 2BW2A 2IGHA 1V1OA 5D3DA 1PFDA 2K3UA 2MJEA 3P4PB 5BYQA 1JMLA 4JX1C 5HG2A 4JE3B 1GPXA 1SJHD 4ZHOA 3Q8CA 2KN4A 4CQNA 1SE2A 3URYA 2LUMA 2Y5CA 1KF6B 4YTNB 3DWMA 3RFZB 3V05A 2M19A 1YN4A 1SB3C 4HKQA 3NS1A 1V1PA 5EE9A 2V3PA 3RPFC 1J7AA 4OW0A 2N9KA 1IBXA 4JPSA 2EELA 3Q8FA 3AEAB 2AQ1B 3BYYB 1TY2A 1V8CA 1F2RI 1PUTA 1MHXA 3PZ8A 1KH0A 2WXFA 2DYMA 4HROA 4OVZA 1FM0D 3AE1B 1QILA 2PIAA 2WDVB 1D5ZC 4RCOA 3LYYA 1Q10A 1SXTA 4N58A 2R61A 1TS3A 1QOGA 2KQ4X 1ROEA 4C7ZA 1NVID 1T6BX 5MPOA 2DYOA 1ZUD2 1WWTA 1L6VA 5BYRA 1ZP0B 2B76B 3O13A 1FFVA 2Y3AA 1L5PA 1E0ZA 4A8XC 1PGBA 5C3JB 5I4DA 2E3TA 2EKIA 4HKZE 4ZYSA 5AUIA 2W3RA 3E56A 1B1ZA 2G1EA 1BUIC 1VZ7A 4M0WA 1ZPSA 4YSYB 2X38A 4B0EA 2E6XA 1DOYA 5H8YE 1XEEA 3AM9A 2CJNA 2WP9B 1UUPA 1F0ZA 4RGMA 2JX5A 4OZBA 1JRPA 2N0SB 2QILA 3P63A 2KMMA 1PDXA 2JU6X 2IGDA 1P7EA 2INPE 2SEBD 2ZW0A 4NZLB 3I57A 3NVWA 3FILB 2INNE 5D7GA 4L2YA 4MH8A 3BWUD 4N59A 1OFFA 3NVYA 4WAFA 2V4IB 3ZJVA 5D3IB 3P4RB 1AW7A 2L52A 2WXGA 3KWVA 2MH7A 4GLSC 2JXTA 4TQ1A 4UDUC 1TKYA 4XDDA 2GB1A 2LHEA 2WU2B 2V3NA 5C2TB 3AE2B 1SJED 3AEFB 4RF0A 3EUB2 4N6EB 3AE7B 2YEPF 3AE8B 2J52A 4A6QA 2FE8A 1FIQA 2WXLA 1MVKA 1BXTA 1I4PA 3IT4B 3KLSX 4ARCA 1IUEA 3IT6B 2BS2B 2HTME 2OEDA 1XCTL 4NJCA 3ETRA 3TEWA 1I4GA 3BZDB 1CK1A 1WSPA 4P6VF 2PTLA 1I4HA 1YNTE 1JROA 3T3OA 3TUOA 4ARIA 2BB5A 1NENB 1D5XC 4YSZB 3V3XA 3HVZA 2BT6A 1VZ6A 1V1PB 1J7CA 1EWCA 1V97A 2MJDA 1XLPA 4RGOS 4RH6A 1IBXB 3NVZA 2LJIA 1XO3A 3MJ5A 4GDLB 3P42A 3Q8EA 1C78A 5FK9C 2QSDA 4A90A 2W54A 1DOXA 4KKIA 2QMTA 1FNWA 1T5XD 4KKJA 3B2GA 3PZ7A 4KX6B 3ZGZA 1YN3A 1ESFA 3W1SA 2GRIA 3NUHB 1D4BA 4MACA 1JALA 4MM3B 3ZJTA 2L83A 2BTEA 3MP9A 3AE4B 1HEZE 4C56C 4YTMB 2OHFA 1EWYC 5G5GA 1XXGA 4ZRQA 1KTKA 2WXMA 5H92C 3MFGA 1SE3A 3KWLA 1IGCA 4C80A 1CJEA 1ZDXA 4YSXB 1K52A 5TSSA 1FEHA 4ZRPA 1RWSA 1NYRA 2WXKA 3MHZA 2H89B 3U7ZA 5HFYA 1STEA 1VRAB 4XWTA 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZB A;  2ZW1 A;  1HZ5 A;  5HHD G;  2LGI A;  2JU6 X;  5BMG A;  1HZ6 A;  2IGD A;  1P7E A;  2ZW0 A;  1XCQ L;  3FIL B;  1GB1 A;  1MI0 A;  2J53 A;  1K50 A;  4GLS C;  1C9F A;  2JXT A;  1K51 A;  1K53 A;  2K0P A;  2KAC A;  4KGS A;  4WH4 A;  2NMQ A;  1F2R C;  2GB1 A;  2JZP A;  2KWD A;  1IGD A;  2JWU A;  2LHE A;  4HJG E;  2PW9 A;  2I38 A;  1MPE A;  2J52 A;  1PGX A;  2IGH A;  2IGG A;  1XF5 L;  1JML A;  1MVK A;  4KGR A;  5HG2 A;  2OED A;  1XCT L;  5BMI A;  1FCL A;  2KN4 A;  2N7J A;  2LUM A;  2PTL A;  1YNT E;  1GB4 A;  3V3X A;  3GB1 A;  2LHD A;  1P7F A;  2N9L A;  4OZC A;  5HI1 A;  3UI3 A;  2KDM A;  1IBX B;  1MHH E;  2N9K A;  1IBX A;  2EEL A;  2GI9 A;  2ON8 A;  2QSD A;  1FCC C;  4KGT A;  1F2R I;  1QKZ A;  1MHX A;  1KH0 A;  2QMT A;  1UWX A;  1Q10 A;  1YMH E;  2RPV A;  1EM7 A;  2KQ4 X;  4OZA A;  1FD6 A;  2PLP A;  1D4B A;  4MAC A;  5BMH A;  3MP9 A;  1HEZ E;  1PGB A;  4HKZ E;  2RMM A;  3FIL A;  1IGC A;  2JSV X;  5JXV A;  2I2Y A;  1K52 A;  4IKG A;  1ZXH A;  4IOI E;  5HFY A;  4D2K A;  2ONQ A;  1PGA A; 
#chains in the Genus database with same CATH topology
 1E8X A;  4C4V B;  2KQS A;  3VTU A;  4EKU A;  1AWD A;  2KAN A;  4MJS B;  5HHD G;  2LGI A;  3VQI A;  3AE6 B;  1N62 A;  2LUE A;  4RM8 A;  2GOW A;  1FPY A;  4YXD B;  3AU5 A;  4OVV A;  2ZNV B;  2ICI A;  5AUK A;  3AEB B;  1C9F A;  2B3A A;  1D6E C;  4DDI D;  1ZW7 A;  1LQB A;  2KWU B;  5DPS A;  2HTH A;  4RFB A;  3AED B;  1F52 A;  3AUL A;  3DHI C;  3SDL C;  1R4N B;  5LLI A;  1ISN A;  2N7J A;  1WJN A;  3W5U B;  5LXH A;  1ACC A;  1XT9 B;  1JCK B;  1P1A A;  4X57 B;  2KWV B;  1GB4 A;  1BML C;  1V6E A;  3GB1 A;  3V60 A;  3CST A;  3ZNG C;  2LHD A;  1P7F A;  4OZC A;  1T0R C;  3Q3M C;  4NAW A;  5HI1 A;  2KDM A;  3BVZ A;  2UYZ B;  3UGB B;  2QEJ C;  4AS1 A;  3VFK A;  1P9D U;  3N30 A;  4LNI A;  2LVP A;  3AE9 B;  2CJO A;  2A4Z A;  2BBC A;  2WXQ A;  2L0T A;  1VR9 A;  1I4X A;  2RPV A;  4YTP B;  4P7I A;  4ZRJ A;  4WQM A;  4GGQ A;  2WHI A;  1RYJ A;  1HXY D;  4BAX A;  1NI3 A;  1WE6 A;  3N9Y C;  3APC A;  2KO3 A;  2KX0 A;  3UIP B;  3PRP B;  1FFU A;  3PTF C;  2KDF B;  3QA8 A;  3W2D A;  2WNM A;  2DX5 B;  1TS4 A;  1VZ8 A;  2KFJ A;  4WJQ A;  4RNA A;  4DBG A;  1WX7 A;  2H88 B;  3DBS A;  1KRH A;  3SD5 A;  3JSV A;  4IKG A;  4IOI E;  1TKG A;  3SHQ A;  4WUR A;  2JY6 A;  1TZ1 A;  4F8C B;  1PGA A;  4IDI A;  3VAW A;  1M94 A;  2K39 A;  3RI7 C;  2PVO D;  4BVU C;  2ACZ B;  2HDE A;  3VUW A;  4MT5 A;  1NI2 A;  4NJ7 A;  5J18 A;  1DOI A;  2W82 A;  5E6P A;  3GS2 A;  4DXF A;  4W9C A;  4KGS A;  5KHO A;  1MJD A;  3EA6 A;  5G2N A;  3HM6 X;  1SF0 A;  4WAA A;  4LNN A;  4YWG G;  1PGX A;  2KTR B;  2O6V A;  4DXG A;  4JWS C;  3BVG A;  1FXA A;  2J42 A;  1WJU A;  1WXQ A;  2G3Q B;  3ZTD A;  4FN2 A;  2M56 B;  2K25 A;  1Q1O A;  2WXI A;  2KNB A;  5EE3 A;  4XX5 A;  4K1R B;  1ZE3 D;  4AWJ A;  1E8W A;  2K5P A;  4A9A A;  4AOF A;  1WH3 A;  2XEW A;  2J0M A;  3I9V 1;  2WDQ B;  3VTV A;  1QT9 A;  3VDZ A;  4M01 A;  4DK5 A;  1SSN A;  3Q2A C;  5G5H A;  1TBE A;  2MA9 B;  4MJS A;  1R7S A;  3RN9 C;  4ACF A;  3QAQ A;  1Q5W B;  2RDB C;  1KFY B;  1YD8 U;  3AEC B;  2KKC A;  5JXV A;  4AJY B;  1ZXH A;  3M63 B;  3OLM D;  3VRA B;  3N1X C;  2V4L A;  1SIJ A;  5T8I A;  4LNK A;  3R7Q A;  3ECI A;  2AQ3 B;  3B2F A;  2FNJ B;  1WGY A;  1ZDV A;  2BYV E;  3ZJU A;  2JZ3 B;  2DZM A;  3AB5 A;  3U2S C;  5HKH A;  3SR6 A;  4A20 A;  2FBW B;  4ICV A;  2DWQ A;  5GXG B;  2VZK D;  3QIJ A;  4LJO B;  4HCP B;  2QIE B;  4KZC A;  3AN1 A;  4DHJ B;  2JZP A;  1HQR D;  2FID A;  2KMA A;  5L95 C;  2NBW B;  2I38 A;  1XLQ A;  2MEK A;  2BW2 A;  2IGH A;  1V1O A;  2BYE A;  4OVU A;  2KJH B;  2MWS B;  3ZRF A;  2BPS A;  3Q8C A;  3KUD B;  4CQN A;  2LUM A;  4IWP A;  3A1Q B;  3A9K A;  3W1S C;  4LNO A;  3NS1 A;  2V3P A;  2N9K A;  3Q8F A;  1TY2 A;  1V8C A;  2W9N A;  1MHX A;  1J0G A;  4HRO A;  3ZNI D;  3GOE A;  1QIL A;  2JPH A;  3LYY A;  3PHX B;  2PJH A;  2KQ4 X;  3ZNZ B;  3ML9 A;  4C7Z A;  1E8Z A;  1T6B X;  2DYO A;  3VH3 B;  2MBH A;  5D2M B;  3O13 A;  2N7D A;  2WGS A;  5I4D A;  2EKI A;  2INC C;  2W3R A;  1B1Z A;  1BUI C;  3PS6 A;  4YSY B;  2RR9 A;  2KVR A;  2CHZ A;  5IAA C;  2D07 B;  2ZEQ A;  2GBK A;  4KIK B;  2QIL A;  1UH6 A;  2JU6 X;  1GC7 A;  2NPT B;  3L54 A;  4NZL B;  2KTR A;  3FIL B;  4MH8 A;  3BWU D;  2VH2 A;  3NVY A;  4WAF A;  2DNF A;  3P4R B;  3IFW B;  3BIN A;  3CSF A;  3VVW B;  3Q6B A;  4ZRK A;  2GB1 A;  3QCA A;  5IKC M;  5TR5 A;  2K8H A;  3A4R A;  4K7U A;  3S2A A;  1SJE D;  3DQV A;  3EUB 2;  4ANV A;  2J52 A;  3KUC B;  2FE8 A;  4JQW C;  4XC2 A;  1FIQ A;  1OTR B;  1BXT A;  1I4P A;  3IT4 B;  3KLS X;  1IUE A;  3H7S A;  4LDT B;  4NJC A;  4KSL C;  2N1W A;  3BZD B;  1WSP A;  4P6V F;  4IWO A;  1I4H A;  3T3O A;  4DWF A;  2BB5 A;  1NEN B;  1D5X C;  3RZW C;  3RNE C;  2BT6 A;  3ALB A;  1J7C A;  1V97 A;  5D94 A;  4IG7 B;  1IBX B;  2C7H A;  4N9F 4;  5DPW A;  2LJI A;  4HLE A;  2L0F A;  1H4R A;  1H8C A;  3RNA C;  2IBI B;  3N3K B;  2W54 A;  1DOX A;  2QMT A;  3VTW A;  3O65 B;  2L00 B;  2M4N A;  3ZGZ A;  2O2V B;  4MM3 B;  3MP9 A;  3AE4 B;  1UEL A;  4BBN C;  1EO6 A;  2IY0 B;  2OHF A;  5IP4 D;  1KLV A;  3TBL D;  5H92 C;  1V81 A;  4G3X B;  1CJE A;  2KXJ A;  5TSS A;  1GNU A;  3M62 B;  4ZRP A;  2A5U A;  3EEC A;  3MHZ A;  3U7Z A;  1G6J A;  1WYG A;  2J0K A;  2D3C A;  1E7V A;  2LVQ A;  2X8X X;  3A4S C;  1QQR A;  2BB6 A;  2JYE A;  3L4P A;  4RM9 A;  2KLG A;  1GB1 A;  4L1B A;  1XLN A;  4ANU A;  2KYW A;  4B95 A;  1SBB B;  3OWE B;  4TUU A;  1FMA D;  1E7U A;  3A1Q A;  3BII D;  4JL9 A;  1UGM A;  1I4Q A;  4US8 A;  1LXD A;  2K8B A;  5D6J B;  1C77 A;  2EMT A;  3NS8 A;  2M8S A;  1WR6 E;  1A70 A;  3OAW A;  3KYC D;  1MFW A;  1DYQ A;  4M02 A;  1YJJ A;  1EUV B;  1UF0 A;  3TSS A;  3WAL A;  4W9I A;  2LGD A;  2J7Q B;  3TEY A;  4FBJ B;  2WLB A;  1OQQ A;  1FNV A;  3P2B A;  2WXP A;  2G4D B;  2L1A A;  2V1Y A;  3KVF B;  4EZL A;  2K6D B;  3WAN A;  2N9X A;  2KAJ A;  3R7R A;  2XN9 C;  1UWX A;  1AYF A;  3TEZ A;  1EF5 A;  1NEK B;  2ZNV C;  1GAQ B;  4WQO B;  1EM7 A;  2WS3 B;  4GU2 A;  2FUG 1;  3H8H A;  3DBR B;  2NS5 A;  5BO4 B;  1WMH A;  3DVN V;  2IO0 B;  5BMH A;  2WYQ A;  1FRD A;  2JYT A;  1KJT A;  3FIL A;  4K7S A;  2K9X A;  3BVM A;  4MEM A;  2JSV X;  1L4D B;  1U4A A;  1C4P A;  5E6J A;  2PVG C;  3R2T A;  3DOW A;  2V0G A;  1M4V A;  2BKF A;  1EU3 A;  3PPA A;  1MI0 A;  1F77 A;  1RM6 C;  1YJ1 A;  1CQV A;  2DHZ A;  3CWI A;  3GP7 A;  1B9R A;  2L32 A;  1WGR A;  2O6V D;  1WIA A;  1JWA D;  1ZOY B;  2GLS A;  3R66 C;  1N60 A;  4E71 A;  1SE4 A;  2NTS A;  2WWZ A;  2GMI C;  3ZIM A;  3HK0 A;  2IDY A;  2RGF A;  2M0X A;  4HRS A;  3AEG B;  4W9G A;  3IAS 1;  2LVO A;  1I35 A;  4LLG M;  2W55 A;  3HHM A;  2GBN A;  2DZJ A;  3UF8 A;  1L4Z B;  2CKH B;  5BMI A;  1TKE A;  1Z5S B;  1E90 A;  3SEB A;  4ANX A;  1DGJ A;  2LGX A;  3ZXR A;  3PHW B;  1YJI A;  3EFU A;  1HE8 A;  3DBH B;  3NY5 A;  2LGY A;  2NR2 A;  3VR9 B;  3ZQ4 A;  2PE6 B;  3Q3J A;  3B9J A;  2KHW B;  4G50 A;  1N5W A;  3TEX A;  3CMM B;  1QOF A;  3L0W B;  3AE3 B;  3RD2 A;  3H1U A;  1QZE A;  1WGH A;  1S1Q B;  3H6N A;  2CU3 A;  4BBN F;  4XE0 A;  2PLP A;  4GIV A;  4WIP A;  2MHJ A;  1WXV A;  2ZCB A;  2HD5 B;  3H7P B;  2MBE A;  1E10 A;  4URK A;  3ZUN A;  3LB8 C;  4HPL B;  4S17 A;  1AN8 A;  2KFK A;  3T3N A;  1CZP A;  3DVN U;  2SAK A;  3FC4 A;  1JWU D;  1HA5 A;  1E9M A;  4MGZ E;  2QJL A;  4P1B C;  2K1F A;  3RNB C;  3ZTC A;  2D2Q A;  3DHG C;  3WA0 A;  3B1L X;  2D3A A;  4D2K A;  1L6U A;  4RF1 A;  3LDZ E;  5AZH A;  2KLC A;  2KN5 A;  4K81 A;  2ZW1 A;  2TSS A;  2J4X A;  4R3D A;  1N5X A;  4MEL A;  1LM8 B;  4J3O D;  4NY0 A;  1FRR A;  4XDC A;  3VRB B;  3R2I A;  2LFI A;  2KWC A;  1XLO A;  1LGR A;  5AEK B;  1K53 A;  2NMQ A;  3PV1 A;  3RMK C;  2KWD A;  4AUQ C;  1E7P B;  2AYO B;  2BS4 B;  2OJW A;  3RUL A;  4EZJ A;  4LCD E;  5D3D A;  5BYQ A;  3P4P B;  1C3T A;  1JML A;  4HXD A;  3UQA A;  3PZD A;  5HG2 A;  4JE3 B;  4P1C C;  2IO3 B;  2BKR B;  2QHO A;  2Y5C A;  4YTN B;  5DPR A;  3RFZ B;  1SB3 C;  2Z0D B;  3VUY A;  1V1P A;  5EE9 A;  1J7A A;  4OW0 A;  4EZK A;  2MQJ A;  3NG0 A;  4FJV B;  4JPS A;  3TJP A;  3AEA B;  1P0R A;  1F2R I;  2GBJ A;  1WXS A;  2DYM A;  4OVZ A;  1E5W A;  1D5Z C;  1WJ6 A;  1HTQ A;  1QOG A;  3OJ4 B;  1HTO A;  1ROE A;  4IWQ A;  3V6C B;  5C23 A;  2JVC A;  3NJT A;  2R2Q A;  2ZCC A;  2C60 A;  5J2R A;  2Y3A A;  4E74 A;  2FAZ A;  1L5P A;  1E0Z A;  4A8X C;  1PGB A;  3PRZ A;  2E3T A;  3APF A;  1V2Y A;  3B08 A;  3DBR I;  5AUI A;  1D3Z A;  3K9P B;  2ZPN A;  2IZV B;  4HDO A;  4C4V A;  2N1V A;  5CTR C;  2KMM A;  3IBE A;  3QWZ B;  2IGD A;  5E6O A;  1P7E A;  2ZW0 A;  3A9J B;  4XZ4 A;  3QC8 B;  4W9L A;  1UZX B;  3ML8 A;  4FUL A;  3KWV A;  1AW7 A;  2WXG A;  2MH7 A;  2JZZ A;  2JXT A;  3ZDM C;  3L13 A;  3TIX A;  2M17 A;  2LHE A;  2V3N A;  4AJW A;  2V3S A;  1IPG A;  2G4S A;  4RF0 A;  4N6E B;  2JWZ A;  2OOB B;  4A6Q A;  1T0Y A;  2C9W B;  1TTN A;  2KK8 A;  2RPQ A;  2WXL A;  1VCB A;  4ARC A;  2OED A;  1N6Z A;  4B9K A;  5JHB A;  1V5T A;  3I5J C;  4I6P A;  3TEW A;  1JRO A;  5IN7 A;  3TUO A;  1OEY J;  5IO9 A;  1WXM A;  3EC8 A;  3V3X A;  3HVZ A;  4ZDV A;  1VZ6 A;  4KSK C;  2WX1 A;  1XLP A;  2QDF A;  4ANW A;  3M3J A;  4BKG A;  3Q8E A;  1RFA A;  5FK9 C;  3KW5 B;  2DZK A;  3X23 A;  3V61 A;  4KKI A;  4FLH A;  3DBH I;  2Z0E B;  1WFY A;  1J19 A;  1YN3 A;  4LJP B;  1D4B A;  4MAC A;  2BF8 B;  4DHJ D;  1HEZ E;  3ZVV A;  3DDC B;  1XXG A;  3ONS A;  1KTK A;  4JIO U;  3MFG A;  4M0W B;  1YIW A;  2HJ8 A;  1ZDX A;  2KC2 A;  3V6E B;  1K52 A;  1FEH A;  1OQY A;  1RWS A;  2WXK A;  5CHW A;  2CU1 A;  5HFY A;  3KYD D;  1RAX A;  3DBL B;  3HVD A;  3N20 C;  5EE0 A;  3RT3 B;  4IW0 A;  2L05 A;  5CHF A;  2PKO A;  3KQ4 A;  1MG8 A;  4F7Z A;  4KVG B;  3AMZ A;  3RNC C;  4YL8 A;  5IA7 A;  4P16 A;  1K51 A;  3JYU A;  3JVZ X;  4HEA 1;  2MX2 A;  2XK5 B;  3N1Z C;  3D32 A;  4DHZ B;  4KDI C;  4MGY E;  1IGD A;  1XD3 B;  3Q69 A;  3ABV B;  4HJG E;  4ZOH C;  4PT5 A;  3VUX A;  1FXI A;  2IGG A;  3DCG A;  5JZE B;  1XF5 L;  2AL3 A;  1YQ4 B;  3R8B A;  3E9S A;  1FCL A;  1L0X B;  4GDK B;  4USA A;  4KDL B;  5FKA C;  3FKY A;  2KOX A;  3FAH A;  3PO0 A;  5EE1 A;  4EFO A;  1E8Y A;  1NYQ A;  1WGD A;  4ZYN A;  2MP2 B;  4NQK E;  1V80 A;  1VJK A;  1XQQ A;  3IAM 1;  3LXF A;  2DBY A;  2PMV A;  1J7B A;  1E6E B;  1WR1 A;  2KTF A;  3UI3 A;  3RZF A;  2GI9 A;  1JWB D;  4KGT A;  4W9D A;  1I7H A;  4US9 A;  2BGF A;  4JLC A;  5KHQ A;  1ET6 A;  3MC0 B;  4PS3 A;  4JWU C;  3PT2 B;  3ZLZ A;  1WI0 A;  3EGR A;  4OZA A;  3AV8 A;  2MBO A;  3SU8 X;  4AQ7 A;  1TT5 B;  2M0A A;  4PYU A;  1N61 A;  2LGS A;  1V86 A;  2FCN A;  2D3B A;  5EDS A;  2YEP B;  1FO4 A;  1I4R A;  2FIF A;  2WQY B;  4A3P A;  4TKN A;  3AI5 A;  1WF9 A;  3AE5 B;  3HIZ A;  2JUO A;  3VXW A;  1LO5 D;  2L7R A;  4G11 A;  4WWO A;  1P98 A;  4L23 A;  1WRD B;  1D5M C;  3QK0 A;  2CHX A;  4W9J A;  4PYZ A;  5DPT A;  2J53 A;  1GUA B;  2G9H D;  1JWS D;  4HJK A;  2D10 A;  4OHJ A;  2I1K A;  1Y8R C;  4MGI E;  3SFE B;  3DWG C;  3N1Y C;  1VD2 A;  4M8M A;  4BKS D;  3R3M A;  3UIO B;  4F1S A;  3ZW3 A;  2FCQ A;  1ZXI A;  4ZHP A;  4REZ A;  3NZ3 A;  1QOA A;  3VR8 B;  5E6N A;  3CIR B;  3UIN B;  1QOB A;  1C4C A;  3PSE B;  3ENE A;  2XNA C;  3MHS D;  2RDG A;  1SEB D;  4RGN A;  3W5V B;  2JRI B;  4NAW B;  2Q5W D;  4TQ0 A;  2MJ3 A;  1ENF A;  2BYF A;  1MHH E;  1C76 A;  4BZA A;  1TS2 A;  2ON8 A;  4GB9 A;  2NBU A;  1ET9 A;  1FCC C;  3WAM A;  4FXC A;  1TS5 A;  2C7M B;  3T9L A;  3AU4 A;  4CHK A;  1R4M B;  1WYW B;  1GOZ A;  3ZKJ C;  3BYT B;  1FD6 A;  1FXT B;  2VRR B;  4BKT A;  3QJZ A;  4Q2J A;  1PYW D;  3B0A A;  4BOZ B;  2WXN A;  4MDK E;  3RYT A;  4WJP A;  3Q8B A;  3IG3 A;  4K7W A;  4M8N A;  1T0S C;  5JH5 C;  2RDH A;  2IO1 B;  4AP4 C;  1JWM D;  1QLB B;  4I6N B;  1KOT A;  2LRU A;  3ZXV A;  2N9E B;  1I42 A;  4KIK A;  3L16 A;  2RD0 A;  4IM3 A;  2FCS A;  3QAR A;  1YQ3 B;  5BMG A;  1HZ6 A;  1TGZ B;  1EU4 A;  1XCQ L;  2NPT A;  5DCN A;  3DBL I;  1TJE A;  5IOI A;  3U7D A;  3VH4 B;  2NTT A;  1YN5 A;  4W9F A;  1TZO A;  3KH0 A;  2PW9 A;  4TMA B;  4WWM A;  4DXA B;  4NJ6 A;  4E3C A;  3P4Q B;  4MSQ B;  1PFD A;  2K3U A;  2MJE A;  4XYC A;  4JX1 C;  2ASQ A;  1GPX A;  4ZHO A;  2MBB B;  2KN4 A;  1SE2 A;  3URY A;  1KF6 B;  3DWM A;  3V05 A;  2M19 A;  1YN4 A;  2BWF A;  2EKE C;  3QHT A;  3NHE B;  3DVG X;  4GSW A;  2L8J A;  2KDE B;  1IBX A;  4TV3 A;  3MC9 A;  3L08 A;  2AQ1 B;  3BYY B;  5AZF A;  1PUT A;  4FJY A;  1KH0 A;  2WXF A;  5JHA A;  3AE1 B;  4RCO A;  1Q10 A;  4N58 A;  2R61 A;  1TS3 A;  1WE7 A;  1EF1 A;  2BWE S;  2DYB A;  1NVI D;  2R2O A;  1L6V A;  2O2V A;  2MSE D;  2MLB A;  2B76 B;  4MM3 A;  4BKS A;  4PK1 A;  1FFV A;  3HM3 A;  4LNF A;  1RRB A;  5C3J B;  3W1Y A;  5J17 A;  4ZYS A;  4XGA B;  3C19 A;  1TIF A;  4J6I A;  2KJ6 A;  2X38 A;  3GE8 C;  3DPD A;  1IYF A;  2KZR A;  5H8Y E;  1V9J A;  3AM9 A;  2CJN A;  1UUP A;  1F9J A;  3QX1 A;  4RGM A;  5AZG A;  2JX5 A;  4OZB A;  2N0S B;  3P63 A;  1PDX A;  3AXC A;  2K6Q A;  2DAJ A;  2INN E;  5D7G A;  2REX A;  4II3 B;  1WM2 A;  1YQB A;  5C1Z A;  3ZJV A;  4HVB A;  2Y5B B;  1UBI A;  3OG5 A;  3Q3O C;  2LWP A;  4UDU C;  1TKY A;  4K3C A;  2PEA A;  4XDD A;  1YX5 B;  3AEF B;  3AE7 B;  3AE8 B;  3MC8 A;  3WIM A;  3CF6 E;  2IYD B;  2BS2 B;  3L17 A;  2KVZ A;  1XCT L;  2V9H A;  3VHT C;  1I4G A;  3A9K B;  3K9O B;  3GZN I;  4CO7 A;  4YSZ B;  4I6L B;  1EWC A;  4RH6 A;  2YLM A;  4IM0 A;  2N4F A;  4GDL B;  1NBF C;  3P42 A;  1C78 A;  2HJ1 A;  4FHK A;  2QSD A;  4A90 A;  4C00 A;  1T5X D;  4KKJ A;  3B2G A;  3PZ7 A;  1ZKH A;  4KX6 B;  1BT0 A;  1ESF A;  1OGW A;  3U8Z A;  3ZJT A;  2L83 A;  2BTE A;  2BQQ A;  1R4M I;  4HPP A;  3PVL A;  1EWY C;  3A33 B;  1CMX B;  2WDT B;  2JXX A;  4HK2 A;  2KQ7 A;  3KWL A;  1IGC A;  4EEW A;  2C7N B;  4C80 A;  1NYR A;  1WJ4 A;  2CR5 A;  1STE A;  1VRA B;  4XWW A;  3RUI B;  1OQR A;  4IM2 A;  3DHH C;  2LMC A;  2GBR A;  1HZ5 A;  3P1M A;  2W3S A;  1C1Y B;  4NNJ B;  1GC6 A;  1P3Q U;  3Q3F A;  2D3G A;  3C8Y A;  5FR6 A;  1QF6 A;  1FNU A;  4FHJ A;  3PRE A;  1K50 A;  2WXR A;  4ICU A;  1TYG B;  2ZJD A;  4BFR A;  2KAC A;  1WM3 A;  4G0N B;  2LZ6 A;  2BS3 B;  4KZ0 A;  4QAY A;  1MPE A;  3RNF C;  4ITK A;  4HCN B;  1WRI A;  2KJR A;  4WWN A;  2FCM A;  3WCQ A;  4CYE A;  3NOB A;  4IUM B;  4B6W A;  4EUT A;  4M00 A;  1SIF A;  2DAF A;  4WJN A;  3U4E G;  3ZYY X;  3J9C A;  1UWM A;  2LI5 A;  2N9L A;  3W9C B;  4TSS A;  4A55 A;  4PS7 A;  3C0R B;  2VH1 A;  1QKZ A;  2VZK B;  2Z8L A;  2ZVO A;  3BK2 A;  1UBQ A;  2WXH A;  4EE2 A;  4RGT A;  1MG4 A;  4HPM B;  2JQR B;  2BYT A;  4GN1 A;  1UD7 A;  3AEE B;  3N32 A;  2Y5P A;  3PGE A;  3H7P A;  4DHZ E;  3I63 C;  3NZU A;  1TY0 A;  2XBB C;  1Q0W B;  1WXA A;  1JW9 D;  1L0V B;  4W9K A;  2J0J A;  2RMM A;  5FR3 A;  2NVU I;  2AWT A;  2D5G A;  1C4A A;  3V62 A;  2IJ0 A;  2WXJ A;  4LTU A;  2IO2 B;  3UQB A;  2I2Y A;  1T3Q A;  2AQ2 B;  1WY8 A;  1KLU D;  2ONQ A;  2KC1 A;  3QQ8 B;  1OEY A;  5LXI B;  2G45 B;  3ZO5 B;  1X1M A;  2ZVN A;  4C7Y A;  1JQ4 A;  2AX5 A;  3LJ3 A;  4KV2 A;  2CS4 A;  3I3T B;  4W9E A;  2KD0 A;  4HWI B;  4WH4 A;  2IPK D;  2DEN B;  4W9H A;  3RNG C;  1R4N I;  1J8C A;  3NRZ A;  4O1N A;  4GXB A;  2ZZP B;  1V49 A;  4GDL A;  1PQS A;  3SFD B;  1L0Y B;  4KGR A;  1KLG D;  2ZPY A;  1VDV A;  2HE7 A;  1IP9 A;  1N63 A;  2BVC A;  4FAD A;  3TL5 A;  1SGH A;  3Q14 C;  1F1H A;  3AH7 A;  3PRM B;  1L2N A;  1NDD A;  2K8C A;  3P4S B;  2WU5 B;  3L10 B;  4LK0 M;  2DLB A;  3BK1 A;  3HRD D;  4MSM B;  4IC7 B;  1RLF A;  1WZ0 A;  3KUZ A;  1AAR A;  5L83 A;  1YMH E;  4II2 B;  4YT0 B;  5G55 A;  2FUH B;  4H2A A;  3ZDT A;  1RFK A;  1WMH B;  2IND C;  3U52 E;  2WXO A;  2LJ5 A;  3NVV A;  2L3Z A;  2D11 A;  3H9D A;  5BYS A;  1Y56 A;  1UGJ A;  2AL6 A;  2LEK A;  1WX9 A;  4MH0 E;  2K22 A;  4NAM A;  2KDI A;  3PLU A;  2OJR A;  1YOV B;  3Q8A A;  3MJW A;  3HUI A;  1C79 A;  4DQO C;  3IXS A;  3ZRC A;  2LD9 A;  4GMV A;  3T8M A;  2JT4 B;  2EMS A;  2MBQ A;  2PPH A;  3U30 A;  3X0W A;  1UNS A;  3A9J A;  4WJO A;  1L7Y A;  2KMC A;  3APD A;  3Q3N C;  2LRW A;  2N9P C;  5CHV C;  4B0M A;  1WGK A;  3ZNH B;  4LDT D;  1Z2M A;  4BOS C;  1VLB A;  2K0P A;  1F2R C;  2JWU A;  2LXC A;  5LNK 1;  4JGH B;  2NBV B;  2WDR B;  4ASW C;  1LFD A;  3WAO A;  4EOY A;  4FA6 A;  3TCA A;  1SJH D;  4MGK E;  2LAS A;  1GJZ A;  1GG3 A;  4HKQ A;  3RPF C;  2M1M A;  3NZS A;  2EEL A;  3GZN B;  3PZ8 A;  1KM7 A;  1FM0 D;  2PIA A;  2WDV B;  1SXT A;  1WZ3 A;  3MTN B;  3WAP A;  5MPO A;  1ZUD 2;  4ZRI A;  4A3O A;  5CX3 A;  1WWT A;  4S0R A;  3IVF A;  2UU7 A;  5BYR A;  1ZP0 B;  1K8R B;  3M95 A;  1WX8 A;  4K3B A;  2KFK B;  2KT7 A;  4HKZ E;  4WWP A;  3E56 A;  2G1E A;  1VZ7 A;  2YVC A;  4M0W A;  4NPN A;  4PS8 A;  1ZPS A;  1T0Q C;  5GMV A;  4B0E A;  2C5L C;  2E6X A;  1DOY A;  4GOC A;  1XEE A;  2WP9 B;  1F0Z A;  2MW5 A;  2DZI A;  3DVG Y;  2I1J A;  1S3S G;  1ZGU B;  1JRP A;  2GBM A;  4NQL B;  2PE9 A;  3PLV A;  3BY4 B;  2INP E;  2SEB D;  3I57 A;  3NVW A;  4L2Y A;  4N59 A;  1OFF A;  2V4I B;  1A5R A;  2KDB A;  5D3I B;  3JSV B;  2L52 A;  4GLS C;  1SE9 A;  4FJZ A;  4TQ1 A;  4DDG D;  2XK5 A;  2WU2 B;  1YX6 B;  5C2T B;  3AE2 B;  1WGG A;  3EHV A;  2N7E A;  2YEP F;  2UWQ A;  1MVK A;  3IT6 B;  2HTM E;  3ETR A;  4GDK A;  1CK1 A;  2PTL A;  1YNT E;  4ARI A;  2MP2 A;  1V1P B;  2Z59 B;  2LXA A;  2MJD A;  4RGO S;  3GE3 C;  1V5O A;  3NVZ A;  1XO3 A;  3MJ5 A;  4HDQ A;  2AEH A;  2O6V B;  2RSU A;  1FNW A;  2MCN B;  2WX0 A;  1JRU A;  2JRH A;  2QC8 A;  3RCZ A;  3W1S A;  2GRI A;  3NUH B;  1JAL A;  2MRP A;  3TMP B;  2JF5 A;  4C56 C;  4YTM B;  3IHP C;  3JW0 X;  5G5G A;  4ZRQ A;  3EFC A;  2WXM A;  1SE3 A;  2NCN A;  4RMA A;  4YSX B;  2QCZ A;  2H89 B;  2KX3 A;  3OJ3 A;  4XWT A;  2CHW A;  2IY1 B;  2L76 A; 
#chains in the Genus database with same CATH homology
 1WYG A;  1OQR A;  3HVD A;  2LMC A;  5EE0 A;  1AWD A;  2PKO A;  3KQ4 A;  1HZ5 A;  3P1M A;  1QQR A;  2BB6 A;  2JYE A;  2LGI A;  2W3S A;  5HHD G;  3VQI A;  3AE6 B;  1N62 A;  3L4P A;  3C8Y A;  4L1B A;  1XLN A;  1GB1 A;  1QF6 A;  3AMZ A;  1FNU A;  4YXD B;  1SBB B;  1K50 A;  3OWE B;  1FMA D;  2ICI A;  2WXR A;  5AUK A;  3AEB B;  1C9F A;  1TYG B;  4P16 A;  1D6E C;  1K51 A;  4HEA 1;  3BII D;  2KAC A;  1I4Q A;  1IGD A;  4US8 A;  2BS3 B;  4RFB A;  3Q69 A;  3ABV B;  4HJG E;  4ZOH C;  4PT5 A;  1MPE A;  1C77 A;  3AED B;  4ITK A;  1FXI A;  2IGG A;  1A70 A;  1WRI A;  1XF5 L;  1DYQ A;  1YQ4 B;  3R8B A;  1YJJ A;  3E9S A;  1FCL A;  1L0X B;  4GDK B;  4USA A;  5FKA C;  3TSS A;  3WCQ A;  3FAH A;  3PO0 A;  5EE1 A;  2N7J A;  3W5U B;  3TEY A;  1NYQ A;  1ACC A;  2WLB A;  1JCK B;  1OQQ A;  3U4E G;  1VJK A;  3ZYY X;  3J9C A;  1FNV A;  1BML C;  1GB4 A;  3IAM 1;  3LXF A;  2WXP A;  3GB1 A;  1UWM A;  2DBY A;  2LHD A;  2PMV A;  1J7B A;  1E6E B;  1P7F A;  2L1A A;  2N9L A;  4OZC A;  4TSS A;  5HI1 A;  2KDM A;  3BVZ A;  3UI3 A;  3W9C B;  4A55 A;  2QEJ C;  4AS1 A;  2GI9 A;  1JWB D;  2KAJ A;  3AE9 B;  2XN9 C;  4KGT A;  1I7H A;  1QKZ A;  2CJO A;  2VZK B;  4US9 A;  2Z8L A;  2BBC A;  2WXQ A;  1UWX A;  1AYF A;  1ET6 A;  3BK2 A;  3MC0 B;  1VR9 A;  3TEZ A;  1I4X A;  1NEK B;  1GAQ B;  2RPV A;  2WXH A;  4YTP B;  1EM7 A;  4JWU C;  2WS3 B;  4EE2 A;  3EGR A;  2FUG 1;  4OZA A;  4RGT A;  3AV8 A;  3H8H A;  4WQM A;  2JQR B;  1RYJ A;  2BYT A;  1HXY D;  1NI3 A;  5BMH A;  3N9Y C;  3AEE B;  2Y5P A;  4AQ7 A;  1FFU A;  1TY0 A;  2M0A A;  1FRD A;  2JYT A;  1N61 A;  1JW9 D;  1L0V B;  3W2D A;  2WNM A;  2RMM A;  5FR3 A;  1TS4 A;  1VZ8 A;  3FIL A;  2D5G A;  4RNA A;  1C4A A;  2YEP B;  1FO4 A;  2IJ0 A;  1I4R A;  2K9X A;  2H88 B;  2WXJ A;  3BVM A;  2JSV X;  4LTU A;  1KRH A;  2I2Y A;  2WQY B;  1T3Q A;  4IKG A;  4IOI E;  2AQ2 B;  1L4D B;  1TKG A;  4WUR A;  3AE5 B;  1KLU D;  2ONQ A;  1PGA A;  1C4P A;  1LO5 D;  4IDI A;  5E6J A;  2PVG C;  4L23 A;  3R2T A;  2PVO D;  1D5M C;  1M4V A;  2ACZ B;  2HDE A;  2V0G A;  1EU3 A;  4C7Y A;  1JQ4 A;  4MT5 A;  1MI0 A;  1F77 A;  1DOI A;  1RM6 C;  2J53 A;  2G9H D;  2AX5 A;  2W82 A;  1CQV A;  1JWS D;  3CWI A;  3GP7 A;  4OHJ A;  1B9R A;  2L32 A;  3GS2 A;  4DXF A;  1ZOY B;  1JWA D;  4KGS A;  4WH4 A;  1N60 A;  2IPK D;  1SE4 A;  3EA6 A;  2NTS A;  3SFE B;  3DWG C;  2IDY A;  3NRZ A;  4O1N A;  4HRS A;  3AEG B;  1SF0 A;  3IAS 1;  4YWG G;  1PGX A;  4LLG M;  2W55 A;  3SFD B;  1ZXI A;  1L0Y B;  4KGR A;  4REZ A;  4ZHP A;  3NZ3 A;  1KLG D;  1QOA A;  3VR8 B;  1L4Z B;  5BMI A;  4DXG A;  1TKE A;  1VDV A;  3CIR B;  4JWS C;  1QOB A;  1N63 A;  3SEB A;  1C4C A;  1FXA A;  1DGJ A;  2J42 A;  3BVG A;  1WXQ A;  2XNA C;  2RDG A;  1YJI A;  3AH7 A;  1SEB D;  2M56 B;  4RGN A;  3W5V B;  4NAW B;  2Q5W D;  3P4S B;  4TQ0 A;  2MJ3 A;  1ENF A;  2WU5 B;  4LK0 M;  1MHH E;  2DLB A;  2WXI A;  3BK1 A;  3VR9 B;  3ZQ4 A;  5EE3 A;  3HRD D;  1C76 A;  1TS2 A;  1ZE3 D;  2ON8 A;  3B9J A;  1ET9 A;  2K5P A;  1FCC C;  1N5W A;  3TEX A;  4A9A A;  1QOF A;  3I9V 1;  2WDQ B;  3AE3 B;  1QT9 A;  4FXC A;  1YMH E;  1TS5 A;  1GOZ A;  4YT0 B;  3BYT B;  1SSN A;  1FD6 A;  2CU3 A;  4H2A A;  1RFK A;  4XE0 A;  2PLP A;  3U52 E;  2WXO A;  4WIP A;  5G5H A;  3NVV A;  5BYS A;  1E10 A;  4Q2J A;  1PYW D;  1Y56 A;  2WXN A;  1UGJ A;  3LB8 C;  1R7S A;  1AN8 A;  2LEK A;  3T3N A;  1CZP A;  2SAK A;  3FC4 A;  3Q8B A;  1KFY B;  1JWU D;  1HA5 A;  1E9M A;  5JXV A;  3AEC B;  2QJL A;  2K22 A;  2RDH A;  4NAM A;  1ZXH A;  3VRA B;  1SIJ A;  4D2K A;  5T8I A;  1L6U A;  3Q8A A;  1JWM D;  1QLB B;  4RF1 A;  3HUI A;  1C79 A;  2AQ3 B;  3B2F A;  4DQO C;  2ZW1 A;  2TSS A;  3IXS A;  2J4X A;  4R3D A;  1ZDV A;  1N5X A;  1YQ3 B;  5BMG A;  3ZJU A;  1HZ6 A;  4J3O D;  1EU4 A;  1XCQ L;  3AB5 A;  1UNS A;  1FRR A;  3U2S C;  3SR6 A;  1TJE A;  2FBW B;  2DWQ A;  5GXG B;  2VZK D;  4XDC A;  3VRB B;  3R2I A;  2LFI A;  1WGK A;  4B0M A;  1XLO A;  2QIE B;  3AN1 A;  1VLB A;  1K53 A;  2K0P A;  2NTT A;  2NMQ A;  1YN5 A;  1F2R C;  2JZP A;  2KWD A;  2JWU A;  1HQR D;  1E7P B;  1TZO A;  2PW9 A;  4TMA B;  4WWM A;  5LNK 1;  2I38 A;  1XLQ A;  2BS4 B;  2WDR B;  3P4Q B;  2MEK A;  2BW2 A;  2IGH A;  1V1O A;  5D3D A;  1PFD A;  2K3U A;  2MJE A;  3P4P B;  5BYQ A;  1JML A;  4JX1 C;  5HG2 A;  4JE3 B;  1GPX A;  1SJH D;  4ZHO A;  3Q8C A;  2KN4 A;  4CQN A;  1SE2 A;  3URY A;  2LUM A;  2Y5C A;  1KF6 B;  4YTN B;  3DWM A;  3RFZ B;  3V05 A;  2M19 A;  1YN4 A;  1SB3 C;  4HKQ A;  3NS1 A;  1V1P A;  5EE9 A;  2V3P A;  3RPF C;  1J7A A;  4OW0 A;  2N9K A;  1IBX A;  4JPS A;  2EEL A;  3Q8F A;  3AEA B;  2AQ1 B;  3BYY B;  1TY2 A;  1V8C A;  1F2R I;  1PUT A;  1MHX A;  3PZ8 A;  1KH0 A;  2WXF A;  2DYM A;  4HRO A;  4OVZ A;  1FM0 D;  3AE1 B;  1QIL A;  2PIA A;  2WDV B;  1D5Z C;  4RCO A;  3LYY A;  1Q10 A;  1SXT A;  4N58 A;  2R61 A;  1TS3 A;  1QOG A;  2KQ4 X;  1ROE A;  4C7Z A;  1NVI D;  1T6B X;  5MPO A;  2DYO A;  1ZUD 2;  1WWT A;  1L6V A;  5BYR A;  1ZP0 B;  2B76 B;  3O13 A;  1FFV A;  2Y3A A;  1L5P A;  1E0Z A;  4A8X C;  1PGB A;  5C3J B;  5I4D A;  2E3T A;  2EKI A;  4HKZ E;  4ZYS A;  5AUI A;  2W3R A;  3E56 A;  1B1Z A;  2G1E A;  1BUI C;  1VZ7 A;  4M0W A;  1ZPS A;  4YSY B;  2X38 A;  4B0E A;  2E6X A;  1DOY A;  5H8Y E;  1XEE A;  3AM9 A;  2CJN A;  2WP9 B;  1UUP A;  1F0Z A;  4RGM A;  2JX5 A;  4OZB A;  1JRP A;  2N0S B;  2QIL A;  3P63 A;  2KMM A;  1PDX A;  2JU6 X;  2IGD A;  1P7E A;  2INP E;  2SEB D;  2ZW0 A;  4NZL B;  3I57 A;  3NVW A;  3FIL B;  2INN E;  5D7G A;  4L2Y A;  4MH8 A;  3BWU D;  4N59 A;  1OFF A;  3NVY A;  4WAF A;  2V4I B;  3ZJV A;  5D3I B;  3P4R B;  1AW7 A;  2L52 A;  2WXG A;  3KWV A;  2MH7 A;  4GLS C;  2JXT A;  4TQ1 A;  4UDU C;  1TKY A;  4XDD A;  2GB1 A;  2LHE A;  2WU2 B;  2V3N A;  5C2T B;  3AE2 B;  1SJE D;  3AEF B;  4RF0 A;  3EUB 2;  4N6E B;  3AE7 B;  2YEP F;  3AE8 B;  2J52 A;  4A6Q A;  2FE8 A;  1FIQ A;  2WXL A;  1MVK A;  1BXT A;  1I4P A;  3IT4 B;  3KLS X;  4ARC A;  1IUE A;  3IT6 B;  2BS2 B;  2HTM E;  2OED A;  1XCT L;  4NJC A;  3ETR A;  3TEW A;  1I4G A;  3BZD B;  1CK1 A;  1WSP A;  4P6V F;  2PTL A;  1I4H A;  1YNT E;  1JRO A;  3T3O A;  3TUO A;  4ARI A;  2BB5 A;  1NEN B;  1D5X C;  4YSZ B;  3V3X A;  3HVZ A;  2BT6 A;  1VZ6 A;  1V1P B;  1J7C A;  1EWC A;  1V97 A;  2MJD A;  1XLP A;  4RGO S;  4RH6 A;  1IBX B;  3NVZ A;  2LJI A;  1XO3 A;  3MJ5 A;  4GDL B;  3P42 A;  3Q8E A;  1C78 A;  5FK9 C;  2QSD A;  4A90 A;  2W54 A;  1DOX A;  4KKI A;  2QMT A;  1FNW A;  1T5X D;  4KKJ A;  3B2G A;  3PZ7 A;  4KX6 B;  3ZGZ A;  1YN3 A;  1ESF A;  3W1S A;  2GRI A;  3NUH B;  1D4B A;  4MAC A;  1JAL A;  4MM3 B;  3ZJT A;  2L83 A;  2BTE A;  3MP9 A;  3AE4 B;  1HEZ E;  4C56 C;  4YTM B;  2OHF A;  1EWY C;  5G5G A;  1XXG A;  4ZRQ A;  1KTK A;  2WXM A;  5H92 C;  3MFG A;  1SE3 A;  3KWL A;  1IGC A;  4C80 A;  1CJE A;  1ZDX A;  4YSX B;  1K52 A;  5TSS A;  1FEH A;  4ZRP A;  1RWS A;  1NYR A;  2WXK A;  3MHZ A;  2H89 B;  3U7Z A;  5HFY A;  1STE A;  1VRA B;  4XWT A;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...