5BMIA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmiA00
3FILB 3MP9A 1F2RI 5HHDG 1PGAA 2KQ4X 5JXVA 5HFYA 1GB1A 2KN4A 2N7JA 1UWXA 2PLPA 1HZ5A 1FD6A 1MPEA 2QMTA 2N9KA 1K53A 2JWUA 4KGSA 2K0PA 5BMHA 2KWDA 4WH4A 1MHHE 4GLSC 4IOIE 1C9FA 5HI1A 2EELA 1IBXB 2PTLA 1YNTE 4IKGA 2LGIA 1XF5L 2KACA 4OZCA 1QKZA 2IGGA 1PGBA 2N9LA 1K50A 2ZW1A 1HEZE 2PW9A 4MACA 1FCCC 1GB4A 1K52A 2I2YA 1P7FA 1IGCA 1PGXA 1K51A 4HKZE 1P7EA 1F2RC 4OZAA 1Q10A 2J53A 4OZBA 2I38A 2LHDA 2J52A 5HG2A 1IGDA 2LUMA 2JU6X 4HJGE 2KDMA 5BMIA 2RPVA 2IGDA 2ZW0A 4KGRA 1FCLA 5BMGA 1KH0A 4KGTA 3UI3A 2GB1A 1HZ6A 1MI0A 2JZPA 4D2KA 2JXTA 1XCTL 2QSDA 1ZXHA 2RMMA 2GI9A 2JSVX 3GB1A 1EM7A 2IGHA 3FILA 2LHEA 2NMQA 1IBXA 3V3XA 2ON8A 2ONQA 1MHXA 1XCQL 1YMHE 1JMLA 2OEDA 1D4BA 1MVKA
chains in the Genus database with same CATH superfamily
4TQ0A 1JRUA 1WX9A 2KMCA 4ZHOA 3QCAA 3RNGC 5HFYA 4ZRPA 3H7SA 3NVVA 2QILA 3RZFA 1T0RC 2A4ZA 2INDC 2CKHB 2YEPB 2QMTA 3PRMB 3BINA 3B2FA 1T0YA 3P4QB 5E6OA 5AZFA 2N9KA 1FFVA 3CMMB 1UUPA 1L7YA 3R7QA 1FO4A 1IBXB 2L52A 4LNKA 3TJPA 2DYOA 4OZCA 1L0XB 2WDQB 4RNAA 3RNAC 4NZLB 2KDBA 2K22A 1K50A 3N32A 2JY6A 1DGJA 2KTRA 4W9JA 4ZOHC 1DOYA 2ZW1A 2MRPA 1PGXA 4AWJA 3MC8A 4KKIA 4GOCA 1UELA 3L17A 3O65B 1TKGA 3L4PA 4KX6B 1WRDB 1PUTA 3QHTA 4A8XC 2L3ZA 2DZIA 4PK1A 1JRPA 4JQWC 2Y3AA 1XLOA 4LNIA 2KTRB 1V1OA 3ZNID 2XNAC 4N58A 4DHZB 3ZGZA 1E7VA 1ISNA 2LHEA 4WWMA 4TV3A 3V05A 4LDTD 3TEXA 5TR5A 1JMLA 2JQRB 1MVKA 4AJYB 3MP9A 4J6IA 3HUIA 1IUEA 4N9F4 2KQ4X 1NEKB 4ANVA 2INCC 3HVDA 2QCZA 1I7HA 4BFRA 2INNE 4B0MA 2W55A 3KYCD 1E8XA 2LVOA 5AEKB 5I4DA 2WXPA 1WXVA 1MHHE 1QZEA 4M0WA 1WE6A 1RYJA 4KIKA 1P0RA 2K6QA 5CX3A 3VVWB 2KT7A 2MP2A 2MQJA 2VZKD 2JT4B 3GS2A 1Z2MA 1CQVA 4IM0A 1V1PA 4BKSD 1YN3A 3Q6BA 4BVUC 1KM7A 1XQQA 1N5XA 2M19A 1R4MB 4EEWA 3BYYB 3U52E 2J53A 3UQAA 3BZDB 2JWZA 1PYWD 2WNMA 5HG2A 2G3QB 1F52A 4P1CC 3HM3A 4NY0A 3CSTA 4LTUA 3A1QA 3PSEB 3T3NA 5EE1A 2LGXA 5CHFA 2BS4B 4KIKB 1D6EC 3PRZA 5C2TB 4BZAA 2MP2B 3QQ8B 2K39A 4XYCA 3VR8B 3AU5A 1KRHA 4DHZE 2D10A 4DWFA 3X23A 2VH1A 1FXIA 1H4RA 1NYRA 4FN2A 3ZJVA 2MJ3A 4N6EB 1VZ6A 2AQ3B 2AEHA 1OQRA 1WF9A 4MGKE 4ANWA 1PGAA 4NAWA 3IT6B 3R2TA 2LGSA 2CU3A 3ZYYX 4C7YA 3A1QB 1B1ZA 2V3SA 1GB1A 5CHVC 4P1BC 1LGRA 1FNWA 2L8JA 3ZO5B 4MJSA 2HJ8A 4M8MA 3VFKA 3WAMA 4WH4A 4LDTB 2KJRA 2AL3A 5GXGB 4RF1A 2EELA 3KVFB 2ASQA 3B2GA 5IOIA 4BKSA 2G4SA 1WGDA 4C80A 3H9DA 4WWPA 3AEDB 3ZIMA 2QIEB 4WIPA 1EWCA 2M8SA 3EUB2 2NPTA 4GU2A 3Q3FA 4XX5A 2X38A 2DZJA 1TBEA 4JLCA 1IGCA 5DPWA 1ZOYB 3MHZA 2PVOD 4IDIA 1FRDA 3M63B 3KYDD 4A9AA 3N9YC 2O6VB 3DBHI 2IBIB 2I38A 3BVZA 3ONSA 2M56B 2ZJDA 4GDLB 2QEJC 3DBSA 2L0TA 2JU6X 2WGSA 5BMIA 1BMLC 2KK8A 1LM8B 1E90A 2K8HA 3KWVA 1HZ6A 3ETRA 1J7AA 4W9LA 1QT9A 2Z8LA 4BBNF 1RRBA 3GB1A 2LASA 4BOSC 3ZXRA 3VHTC 3QJZA 1MJDA 3MFGA 2WLBA 3AI5A 2NBWB 1UGMA 4IWQA 4OW0A 3SU8X 1MHXA 1WX7A 2LFIA 4GIVA 2OEDA 1WMHB 2HJ1A 3DBRB 2NTTA 3ZDMC 4FHJA 1RWSA 2L00B 2HTHA 3NZ3A 4A3PA 1N60A 2N7JA 2WXMA 5DCNA 4XWWA 2PE9A 4LJOB 2CHWA 2UU7A 2Y5CA 4M00A 2NBUA 4HCNB 1TTNA 3NY5A 3A9JB 1SE2A 1UNSA 2RSUA 3EGRA 1C1YB 2MW5A 2KNBA 2LEKA 1VR9A 2WU5B 1QKZA 4KZCA 1V5TA 2I1KA 3NHEB 1WX8A 2H89B 1H8CA 1K8RB 2ICIA 2XN9C 3WIMA 3VRBB 3P4SB 3Q69A 3I63C 4IWPA 3AEEB 2M17A 4MH0E 1EF1A 1T5XD 3RT3B 4HKZE 4LNNA 2KJ6A 4JL9A 1P7EA 2JUOA 1VDVA 5JZEB 2G9HD 2L0FA 1J7BA 2KXJA 2WU2B 3BYTB 3FAHA 4EZLA 3CWIA 3UGBB 2RPVA 4XDDA 2JVCA 3B1LX 4OVVA 2KYWA 1HA5A 2C5LC 1IPGA 4YL8A 2B76B 5AZGA 1CK1A 2D07B 2BF8B 3VTUA 3CF6E 1E10A 2KX3A 3UIOB 3QA8A 4MGIE 3HRDD 3IVFA 1R7SA 1C78A 2LXCA 3A4RA 2Y5PA 3VH3B 1V5OA 1XCQL 1WJ6A 3RCZA 4B95A 4MH8A 3OLMD 4PS3A 3FILB 1TS4A 4HXDA 1G6JA 5E6JA 4NQLB 4FXCA 1R4MI 3ECIA 1TZOA 1ZP0B 2LRWA 4A90A 5LXHA 2B3AA 4EE2A 3HM6X 2MEKA 4PS7A 4ZRQA 1ZE3D 3DHIC 3JYUA 2KWDA 4ANUA 4RGOS 4CO7A 3H1UA 4LCDE 2KD0A 2WYQA 1E0ZA 2WXJA 3Q2AC 1WI0A 3ML9A 4AP4C 2GBNA 2XK5A 5JH5C 5J18A 2NCNA 2MBOA 1WYGA 2WX0A 4US8A 4K3CA 2RGFA 5J2RA 4K7WA 1WGRA 3J9CA 2GBMA 3I9V1 3NJTA 4TQ1A 2GBKA 2H88B 1L6UA 1WZ3A 4USAA 2LUMA 3BIID 3P4PB 1M4VA 1TS2A 3PTFC 4EZJA 1ZUD2 3KH0A 2ACZB 2GMIC 3Q8CA 5D3IB 4X57B 1I4GA 3TCAA 3NOBA 1QOGA 4XDCA 2QSDA 2RMMA 3A4SC 4FJVB 2M0AA 2MBHA 2KJHB 2N1VA 3PVLA 3AEAB 5E6NA 3DWMA 2JYTA 1QLBB 4II2B 3VUWA 3H7PB 4MELA 4A55A 4WQMA 3NVZA 3S2AA 1V9JA 4ITKA 3WAPA 3GOEA 2L1AA 4HPPA 2C60A 4BBNC 4HCPB 3QK0A 1WSPA 3M3JA 4WJOA 1PFDA 1JWUD 2KVRA 3QWZB 5LLIA 2LGYA 2BYFA 4PT5A 1FD6A 1I4RA 3PS6A 3FC4A 5FKAC 1CMXB 3ZNGC 3P63A 4AS1A 2KFKB 1WGHA 2IGGA 2ZCBA 2D3GA 2BT6A 3SR6A 1PGBA 3TBLD 2Q5WD 1E9MA 4ACFA 5KHQA 1F0ZA 1HEZE 2V4IB 1TYGB 3Q8BA 3QAQA 1WZ0A 2WQYB 3RFZB 3ML8A 1VRAB 4C4VB 4AOFA 3AE8B 3DBRI 3TEYA 3NZUA 3BK1A 1GG3A 1E7PB 2KDMA 5FR6A 1E5WA 2UWQA 4BKTA 4K81A 3T9LA 1KH0A 3ZTCA 3AN1A 3AE9B 5C1ZA 1ROEA 2I1JA 3RPFC 4D2KA 5EE9A 4HROA 2IO3B 2G1EA 2BYVE 1SJHD 2KKCA 2LZ6A 3LB8C 2MA9B 1EM7A 2GRIA 1T3QA 2ON8A 3ZXVA 2HDEA 2QJLA 2K9XA 4W9FA 1TJEA 2RPQA 2SEBD 4W9CA 4JX1C 3MJWA 5H8YE 2N7EA 4EFOA 4EUTA 2BS3B 2AQ2B 1TKYA 1ZW7A 2A5UA 4RH6A 1UWXA 1NBFC 2O2VB 1HZ5A 2RDHA 3HK0A 1V97A 3K9OB 3R3MA 2NTSA 2IJ0A 2LD9A 3HIZA 1EU4A 1BXTA 2UYZB 3HHMA 4HEA1 4IKGA 2QDFA 2BVCA 1UD7A 4CHKA 1WYWB 2AQ1B 3R66C 1SBBB 1U4AA 3Q8FA 3A9KB 1VJKA 2JX5A 3AM9A 4Q2JA 4P7IA 2KDFB 2O6VD 4E74A 2IY1B 3ZNZB 2BYEA 1LXDA 5H92C 3ZTDA 2KWVB 1Q5WB 2WXGA 2PVGC 4MT5A 4AJWA 5AZHA 2IGDA 3VUYA 4KVGB 2KMAA 2Z0EB 2IO1B 1E8ZA 1FIQA 2GB1A 3WA0A 1JALA 3NS8A 1WXMA 2IZVB 5E6PA 1MI0A 2TSSA 5C3JB 2R2QA 1WGGA 1ZXHA 2KANA 1YIWA 3U30A 5BYSA 2KZRA 4GXBA 4JWSC 4A20A 1KJTA 4QAYA 4W9GA 1YQBA 2W3SA 2QHOA 1D4BA 4F8CB 1P1AA 4WWNA 1AN8A 2FBWB 1JW9D 3RD2A 4DXFA 3NZSA 1UH6A 1I4XA 2DLBA 1UGJA 4I6LB 2K8BA 4URKA 3VTVA 2XBBC 1HE8A 2PLPA 5L95C 3KWLA 2BWFA 2DAJA 4ZRKA 4ARIA 1WXQA 2J0MA 2MLBA 2MBBB 1C9FA 2K6DB 5BYRA 2BWES 1OFFA 5HI1A 1FXAA 4L23A 1SSNA 3EFUA 3DVNU 5EDSA 1NI2A 2LRUA 2INPE 3KUCB 2O6VA 3SFDB 4A3OA 4F7ZA 3C19A 4GDLA 1C4PA 3AE2B 3Q3JA 3OJ4B 3EA6A 5C23A 2WXKA 2BTEA 3RNCC 2D3CA 2LHDA 3I57A 1E8WA 1HXYD 2JPHA 1XXGA 3ZW3A 4HKQA 2DBYA 1N6ZA 3NVYA 1PQSA 2WDTB 4KGTA 5JHBA 4XZ4A 4FJYA 1XCTL 1FEHA 3AULA 4NJCA 3Q3OC 3PREA 2PMVA 2PPHA 1L0YB 2M4NA 1WMHA 2WXNA 1GOZA 2MBEA 4M02A 2NMQA 3PHWB 3SFEB 1XLQA 4ZYNA 4HLEA 5J17A 4H2AA 1YOVB 4ZRJA 5HHDG 3R8BA 4LJPB 4HRSA 1JCKB 2KDEB 5AUKA 3RN9C 4RF0A 2RDGA 3KW5B 4GN1A 3PRPB 3A9JA 1ENFA 2ZNVB 4RGTA 1RAXA 3O13A 2ZPNA 3C8YA 2L32A 2N9PC 1XD3B 4GLSC 3WAOA 4RGNA 3ZVVA 3T8MA 4MGYE 3P2BA 5JHAA 2OJRA 2K5PA 2YEPF 2DX5B 1LFDA 1NYQA 4JIOU 2V3PA 3PGEA 4ANXA 5D94A 1GC7A 2N9LA 2R2OA 1ZKHA 1NI3A 1MFWA 5DPTA 1K52A 4WJNA 2I2YA 3H8HA 3X0WA 3AV8A 4IC7B 2OJWA 2PEAA 2KWUB 2ZCCA 1AWDA 2MSED 3BWUD 4RGMA 3DDCB 4KDIC 2Z0DB 1Y56A 2FCSA 3DVGX 4EOYA 3IHPC 4W9HA 4LNFA 3CSFA 3FKYA 2LI5A 3WALA 4NJ6A 2ZW0A 4ZHPA 1D5MC 4MDKE 4B0EA 3W5VB 4DQOC 2KVZA 3U2SC 4DK5A 1JQ4A 3SEBA 4CYEA 2J0JA 2BBCA 4LLGM 1M94A 1OQQA 4JWUC 4HDOA 2L83A 2FIFA 3FILA 3IFWB 2CS4A 3NVWA 3V61A 1LQBA 2FE8A 3GP7A 3U8ZA 2R61A 5TSSA 4PYZA 3L16A 3P4RB 1SEBD 4RMAA 4OVUA 3MTNB 1SIJA 3ZNHB 1JWBD 4TUUA 2W3RA 4KZ0A 1QQRA 2L05A 4IM3A 1FMAD 2DNFA 2BYTA 1C76A 3BVGA 2OHFA 3PHXB 5CTRC 4NQKE 1P98A 4FA6A 3PZ7A 1UWMA 4DDGD 3B9JA 3TSSA 1WR1A 2PTLA 2KQSA 4YSYB 2FIDA 2G45B 2WXOA 4K7SA 3VXWA 4DXGA 4WAAA 3LXFA 1D3ZA 5CHWA 2L76A 1WGKA 1V8CA 3Q3NC 3L08A 1ET6A 3JSVB 1K51A 2MH7A 3MC0B 5BYQA 1RFAA 5LNK1 3B0AA 1Q10A 4YSXB 2FAZA 3NUHB 1BUIC 1IGDA 1E6EB 2GBRA 4B9KA 2BGFA 5FK9C 1FNVA 4KGRA 3N1XC 3VQIA 2KOXA 1YN5A 2K1FA 4M8NA 1WR6E 2BKRB 1N5WA 3AE7B 2DZKA 1MG8A 1F9JA 2K3UA 1OEYA 1EUVB 2JZPA 1A70A 1R4NB 3PO0A 4IM2A 1AW7A 1S3SG 3H7PA 3W2DA 4HVBA 1KF6B 2MJEA 5MPOA 3RYTA 3I3TB 3ABVB 2JF5A 1GAQB 3V3XA 1E8YA 3IAM1 1YMHE 1ZDXA 2W54A 2CJOA 2DWQA 1XT9B 2KC1A 2AYOB 2BQQA 1F2RI 4PS8A 3BY4B 4C56C 1IYFA 4RM9A 2EMTA 4E71A 1Z5SB 3MJ5A 2J0KA 2KDIA 3EHVA 2CHZA 1SIFA 2J4XA 1VLBA 2GOWA 2CJNA 1MPEA 2C7HA 2KFKA 4IW0A 5G55A 1YD8U 4ICUA 2WXHA 1L0VB 4IOIE 1KLGD 3PV1A 2V4LA 4HK2A 4HPLB 4LNOA 2M1MA 1DOIA 3U7ZA 1C3TA 3MHSD 2LGIA 1C4AA 3RNBC 2MX2A 1DOXA 2D3AA 3PZ8A 1V2YA 2MHJA 3RNFC 2KHWB 1JWMD 1XO3A 3TIXA 4C4VA 1V49A 1P7FA 2EMSA 1WJUA 1N61A 3AEBB 4JPSA 2LUEA 3DQVA 2KLGA 3KUZA 4II3B 2C9WB 2K25A 3AE3B 3VTWA 3PLVA 5EE0A 2BPSA 3RI7C 2V0GA 2DAFA 2ZVOA 1T6BX 3AXCA 1ZDVA 4RM8A 2AWTA 2BB5A 4PYUA 1KLUD 2LGDA 2V1YA 5IO9A 4P6VF 2FCMA 2AL6A 4W9KA 1RFKA 2YVCA 3VUXA 2FUG1 3L54A 4FADA 2LJ5A 1J7CA 1WXSA 3I5JC 2WDRB 1WXAA 4E3CA 1T0QC 4XGAB 1AARA 4I6PA 1NVID 1S1QB 1SF0A 3A33B 1WFYA 2VH2A 2SAKA 3UQBA 1FNUA 2O2VA 1P3QU 3PLUA 2WHIA 1F77A 1V81A 4IWOA 3V6CB 2KWCA 1Y8RC 4MSQB 1KTKA 2QC8A 3M62B 3SDLC 2DYMA 2KN4A 3GZNB 3UIPB 4NAMA 3D32A 4AUQC 4EZKA 1EO6A 4FULA 1Q1OA 1YJ1A 4GDKA 3R2IA 3RMKC 1QILA 2GBJA 4MEMA 2N9EB 3M95A 3OAWA 3VDZA 3A9KA 2JZ3B 2G4DB 3Q8AA 2HD5B 2X8XX 4KSKC 1QOFA 2JYEA 3TL5A 3OJ3A 3ZRFA 4DHJB 2LMCA 3KLSX 1T0SC 3T3OA 2PW9A 4MACA 3AE4B 1NDDA 1GC6A 4NJ7A 3PZDA 4YTPB 2C7MB 3CIRB 2MJDA 1D5XC 4HWIB 1RM6C 5DPSA 4OZAA 3H6NA 4XE0A 1KLVA 3JVZX 1VZ8A 3TEZA 1ET9A 4OZBA 1SE4A 4GDKB 4P16A 1WIAA 3R7RA 3ZLZA 4F1SA 4TKNA 3VRAB 3QIJA 3DWGC 2WS3B 4W9IA 1YN4A 3ENEA 3V62A 4ARCA 1QF6A 4IUMB 2NVUI 4WWOA 1I4PA 1OQYA 5G5GA 2DYBA 2WXIA 3AB5A 2JSVX 2OOBB 1C77A 2IGHA 1YQ4B 5EE3A 4NPNA 1ZGUB 5BO4B 1CZPA 4KV2A 3RNEC 1YQ3B 2WDVB 4W9DA 2KC2A 3TEWA 1WE7A 3EECA 1YJIA 3DVGY 2BKFA 1SXTA 2KLCA 3U4EG 1TGZB 4WJQA 5JXVA 1X1MA 3P42A 4L1BA 1UF0A 1UBIA 3JW0X 1WGYA 2JRHA 1QOBA 1WJ4A 2DENB 5IA7A 2DZMA 1L4DB 2W9NA 3DOWA 3NG0A 4GB9A 1K53A 2BS2B 3RUIB 4REZA 2N9XA 4A6QA 1L5PA 1PDXA 5IN7A 4YTNB 3L10B 2MCNB 1YX6B 1XF5L 3E56A 3BVMA 1WWTA 2WX1A 4XC2A 1R4NI 2D5GA 4M0WB 2FCQA 2PJHA 4YSZB 1FM0D 1FCCC 5D2MB 2HTME 3DCGA 3W1SA 3DPDA 1F2RC 1V1PB 3DBLB 3AU4A 4FLHA 1IP9A 2PIAA 2IO2B 2J52A 4OVZA 3W5UB 1FPYA 4WAFA 4BOZB 2YLMA 2RR9A 2IPKD 2FCNA 3W1SC 5GMVA 3TUOA 2M0XA 3EC8A 2IDYA 1FRRA 1VZ7A 1XLPA 4M01A 3UINB 2WP9B 2FUHB 5G2NA 2N0SB 3OWEB 1WH3A 1SE3A 4L2YA 2K8CA 3ZJTA 4G50A 1WM2A 4DXAB 4HJKA 2LVQA 3B08A 4G11A 1OEYJ 2CU1A 1I42A 3W9CB 1A5RA 1EWYC 5T8IA 1N62A 3UF8A 4K1RB 1WRIA 2DHZA 3AE6B 3ZJUA 4DDID 4MM3A 3IBEA 1GNUA 3L0WB 1C4CA 4NAWB 2W82A 3KUDB 3N30A 2KAJA 3ZUNA 3APCA 1CJEA 4I6NB 2J7QB 2WWZA 1N63A 2ZZPB 2KFJA 2ZNVC 1BT0A 4MJSB 1L2NA 5DPRA 4KKJA 2WXRA 3ALBA 1HTOA 4FHKA 4K7UA 2VZKB 4GGQA 3W1YA 4WJPA 5G5HA 1ZXIA 3N3KB 1I4HA 4FJZA 5D6JB 1HTQA 4K3BA 2KTFA 3KQ4A 1VCBA 1OGWA 1V86A 4MM3B 2NPTB 4JE3B 4EKUA 2WXFA 3ZDTA 2KQ7A 3L13A 2CR5A 4CQNA 3ZKJC 4O1NA 3RZWC 2RDBC 4US9A 3URYA 4HJGE 4ZYSA 1JWSD 3TMPB 1JWAD 3GZNI 1FCLA 1F1HA 1MG4A 4W9EA 2FNJB 2JZZA 1TY2A 2KX0A 3C0RB 3NRZA 1J8CA 5IP4D 1STEA 2N7DA 2WXQA 4B6WA 3Q14C 4MSMB 4ICVA 3ZRCA 5IKCM 5FR3A 4AQ7A 3MC9A 2REXA 5KHOA 2D11A 2XEWA 2HE7A 3PPAA 1RLFA 1NENB 4BAXA 2VRRB 3WCQA 4HPMB 3AH7A 2BW2A 3K9PB 3LYYA 3AMZA 1I4QA 4ASWC 1KFYB 2KO3A 4MGZE 2ZPYA 3IAS1 2BB6A 2E6XA 3AECB 4S0RA 2EKIA 1TT5B 3DHHC 2IO0B 2JXXA 3Q8EA 3LJ3A 4RFBA 4S17A 5D7GA 2NBVB 3Q3MC 1SGHA 1XLNA 3DHGC 2JWUA 4KGSA 5BMHA 1V6EA 2V3NA 2KACA 2D3BA 2J42A 2LVPA 4C7ZA 3JSVA 3IXSA 2KMMA 4TMAB 1E7UA 1OTRB 1UZXB 4BKGA 4LK0M 3SD5A 3RULA 4J3OD 2NR2A 1GB4A 5LXIB 1SJED 3VR9B 1YJJA 3N1YC 4TSSA 1P9DU 4DBGA 1JROA 1TS3A 4XWTA 1C79A 4WURA 2MBQA 2PE6B 1D5ZC 1SE9A 3QC8B 3V6EB 1I35A 4YXDB 3IG3A 3NS1A 3UI3A 1V80A 1WY8A 3AE5B 5AUIA 1YX5B 3BK2A 2GLSA 3SHQA 3VAWA 2JXTA 1UBQA 1EF5A 2LWPA 1HQRD 3EFCA 3IT4B 3HVZA 3OG5A 4KDLB 3AEGB 2E3TA 3PT2B 4R3DA 3P1MA 5HKHA 4G3XB 3LDZE 4GSWA 4ZRIA 1SB3C 3N1ZC 4JGHB 3AE1B 3DVNV 1AYFA 1WM3A 5D3DA 1TZ1A 2LXAA 1GPXA 3DBLI 1TY0A 3APDA 2WXLA 1ZPSA 3QARA 2K0PA 1QOAA 5IAAC 1VD2A 4WQOB 3VH4B 2CHXA 1YNTE 1Q0WB 1EU3A 1L6VA 2D2QA 3QX1A 4YWGG 3GE8C 2EKEC 3U7DA 4DHJD 1WJNA 1J0GA 1TIFA 3N20C 1TKEA 2Z59B 1J19A 2RD0A 4ZDVA 1GUAB 1XEEA 2KN5A 4C00A 2LJIA 4IG7B 3E9SA 2AX5A 4NNJB 1TS5A 4G0NB 4RCOA 1FFUA 5L83A 1B9RA 2V9HA 3ZQ4A 2XK5B 4FBJB 3WANA 2MWSB 2IY0B 3V60A 2JRIB 4UDUC 3APFA 2IYDB 2ZVNA 4HDQA 2N4FA 3AEFB 4GMVA 5BMGA 2Y5BB 1LO5D 1ACCA 1DYQA 2NS5A 4YTMB 3GE3C 1FXTB 2PKOA 4KSLC 4OHJA 1ESFA 2GI9A 2L7RA 2N1WA 4N59A 1IBXA 1L4ZB 2ONQA 4YT0B 1KOTA 2ZEQA 2C7NB 1GJZA 3DBHB
chains in the Genus database with same CATH topology
3FILB 1YJIA 1TS4A 1SXTA 5HHDG 3R8BA 3U4EG 4TQ0A 5E6JA 4HRSA 4ZHOA 5JXVA 1JCKB 3P42A 5AUKA 4RF0A 4L1BA 5HFYA 4FXCA 4ZRPA 2RDGA 3NVVA 2QILA 1TZOA 1ZP0B 1ENFA 1QOBA 4A90A 2YEPB 4EE2A 1L4DB 2MEKA 2QMTA 4ZRQA 3B2FA 1ZE3D 3P4QB 2N9KA 4RGTA 1K53A 3O13A 2BS2B 3C8YA 2KWDA 2L32A 4REZA 4A6QA 4RGOS 1FFVA 4GLSC 4RGNA 1UUPA 1L5PA 1PDXA 1FO4A 1IBXB 2L52A 4YTNB 2DYOA 1E0ZA 1XF5L 2K5PA 2YEPF 4OZCA 3E56A 2WXJA 1L0XB 1NYQA 2WDQB 2V3PA 1WWTA 3BVMA 4RNAA 4NZLB 2K22A 2D5GA 2N9LA 1K50A 1DGJA 4ZOHC 1DOYA 2ZW1A 4YSZB 1NI3A 1FM0D 1FCCC 2HTME 1K52A 3W1SA 2I2YA 3H8HA 1WYGA 1PGXA 3AV8A 4US8A 1AWDA 3BWUD 4RGMA 1F2RC 4KKIA 1V1PB 1Y56A 3J9CA 3I9V1 4TQ1A 2PIAA 2J52A 2H88B 1L6UA 1TKGA 4USAA 3L4PA 4KX6B 2LUMA 4OVZA 3W5UB 3BIID 3P4PB 1M4VA 4WAFA 1TS2A 2ZW0A 2IPKD 4ZHPA 1D5MC 4B0EA 1PUTA 1ZUD2 3W5VB 4DQOC 3TUOA 3U2SC 2ACZB 4A8XC 1JQ4A 2IDYA 3Q8CA 3SEBA 5D3IB 1JRPA 1FRRA 1I4GA 1VZ7A 2Y3AA 1XLPA 2BBCA 1XLOA 4LLGM 1QOGA 4XDCA 2QSDA 1OQQA 1V1OA 2RMMA 2XNAC 4N58A 4JWUC 2M0AA 2WP9B 3ZGZA 2L83A 3FILA 2LHEA 2N0SB 3AEAB 3DWMA 3NVWA 4WWMA 2JYTA 2FE8A 3GP7A 3OWEB 1QLBB 2R61A 1SE3A 4L2YA 5TSSA 3P4RB 3V05A 3ZJTA 1SEBD 3TEXA 1JMLA 1SIJA 4WQMA 2JQRB 4A55A 3NVZA 1MVKA 1JWBD 4ITKA 3MP9A 2L1AA 3HUIA 3W9CB 1EWYC 1IUEA 5T8IA 1WSPA 2KQ4X 2W3RA 1QQRA 1PFDA 1JWUD 1N62A 1NEKB 1WRIA 3AE6B 1FMAD 3HVDA 4PT5A 3ZJUA 1I7HA 1C4CA 2BYTA 4NAWB 1C76A 1FD6A 1I4RA 3BVGA 2INNE 2OHFA 4B0MA 2W55A 2W82A 3FC4A 5FKAC 2KAJA 1CJEA 3PZ7A 2WXPA 1UWMA 5I4DA 1MHHE 4M0WA 3B9JA 1N63A 3P63A 1RYJA 3TSSA 4AS1A 2PTLA 2IGGA 4YSYB 2BT6A 4KKJA 2WXRA 2VZKD 3SR6A 2WXOA 1PGBA 3GS2A 2Q5WD 1CQVA 2VZKB 4DXGA 3LXFA 1V1PA 1E9MA 1YN3A 1F0ZA 5G5HA 1ZXIA 1HEZE 1WGKA 1I4HA 2V4IB 1V8CA 1TYGB 1N5XA 1ET6A 2M19A 3Q8BA 3KQ4A 1K51A 2MH7A 3MC0B 2WQYB 5BYQA 5LNK1 3BYYB 4MM3B 4JE3B 3RFZB 1Q10A 3U52E 1VRAB 2J53A 2WXFA 4CQNA 4YSXB 3AE8B 4O1NA 3BZDB 3NUHB 3TEYA 1BUIC 1PYWD 2WNMA 5HG2A 1IGDA 1E6EB 3BK1A 4US9A 3URYA 4HJGE 1E7PB 2KDMA 5FK9C 4ZYSA 1FNVA 4LTUA 1JWSD 1JWAD 4KGRA 3VQIA 5EE1A 3T3NA 1FCLA 1YN5A 2BS4B 1N5WA 1TY2A 1D6EC 1KH0A 3AE7B 5C2TB 3AN1A 2K3UA 3NRZA 3AE9B 1ROEA 2JZPA 3RPFC 1A70A 1STEA 4D2KA 5EE9A 4HROA 3PO0A 1AW7A 2G1EA 2WXQA 3VR8B 3W2DA 1KF6B 1KRHA 1SJHD 2MJEA 4AQ7A 3LB8C 5FR3A 5MPOA 1EM7A 3ABVB 2GRIA 1GAQB 3V3XA 1FXIA 1T3QA 1NYRA 2ON8A 3ZJVA 1NENB 2HDEA 3IAM1 2MJ3A 2QJLA 2K9XA 1YMHE 4N6EB 3WCQA 1VZ6A 1ZDXA 2AQ3B 2CJOA 1TJEA 2DWQA 2W54A 3AH7A 2BW2A 2SEBD 1OQRA 4JX1C 1F2RI 4C56C 1PGAA 3IT6B 3R2TA 5H8YE 3LYYA 2CU3A 3ZYYX 4C7YA 3AMZA 1I4QA 1KFYB 1B1ZA 2BS3B 2AQ2B 1TKYA 3IAS1 2BB6A 4RH6A 1GB1A 2E6XA 3MJ5A 3AECB 1UWXA 2EKIA 1FNWA 1HZ5A 2J4XA 1VLBA 3Q8EA 2CJNA 1MPEA 2RDHA 4RFBA 1V97A 5D7GA 1XLNA 2NTSA 2JWUA 4KGSA 5BMHA 2WXHA 2IJ0A 1L0VB 4WH4A 1EU4A 4IOIE 1KLGD 5GXGB 4RF1A 1DOIA 2V3NA 1BXTA 2EELA 3U7ZA 4HEA1 4IKGA 2LGIA 1C4AA 3B2GA 2KACA 2J42A 1DOXA 4C7ZA 4C80A 3PZ8A 3AEDB 2QIEB 3IXSA 2KMMA 4TMAB 2AQ1B 4WIPA 1EWCA 1SBBB 4LK0M 3EUB2 1JWMD 4J3OD 2X38A 3Q8FA 1XO3A 1GB4A 1VJKA 2JX5A 1SJED 3AM9A 4Q2JA 1YJJA 1P7FA 3VR9B 1IGCA 1ZOYB 3MHZA 2PVOD 1N61A 3AEBB 4JPSA 4IDIA 1FRDA 4A9AA 3N9YC 4TSSA 1JROA 3AE3B 5H92C 1TS3A 5EE0A 2I38A 2V0GA 4XWTA 1C79A 2WXGA 2PVGC 3BVZA 4MT5A 4WURA 1T6BX 2M56B 1D5ZC 2QEJC 4GDLB 1ZDVA 2JU6X 5BMIA 2BB5A 2IGDA 1KLUD 4P6VF 1BMLC 4YXDB 3NS1A 1FIQA 1RFKA 3UI3A 2GB1A 3AE5B 3KWVA 1HZ6A 1JALA 5AUIA 3BK2A 2FUG1 1MI0A 2TSSA 3ETRA 1J7AA 1J7CA 5C3JB 2JXTA 2WDRB 1HQRD 1QT9A 1ZXHA 2Z8LA 3IT4B 3HVZA 5BYSA 3GB1A 4JWSC 3AEGB 3MFGA 2WLBA 2E3TA 1NVID 1SF0A 4R3DA 4OW0A 3P1MA 1MHXA 1SB3C 2LFIA 2W3SA 2SAKA 2OEDA 1FNUA 1D4BA 1AN8A 2FBWB 3AE1B 1JW9D 2NTTA 1F77A 1AYFA 4DXFA 1RWSA 5D3DA 3NZ3A 1I4XA 1KTKA 1N60A 2DYMA 2KN4A 2N7JA 2DLBA 2WXMA 1UGJA 4XWWA 1GPXA 4NAMA 1TY0A 2PLPA 2WXLA 1ZPSA 2Y5CA 3KWLA 3R2IA 2K0PA 4ARIA 1WXQA 1QILA 1QOAA 1SE2A 1C9FA 1UNSA 3EGRA 5BYRA 1OFFA 5HI1A 1YNTE 1FXAA 2LEKA 1VR9A 1EU3A 1L6VA 1QKZA 1SSNA 2WU5B 1QOFA 3Q8AA 4L23A 4YWGG 2JYEA 2H89B 2INPE 1TKEA 2ICIA 2XN9C 2LMCA 3KLSX 3T3OA 1XEEA 2PW9A 2LJIA 3P4SB 4MACA 3VRBB 3SFDB 3Q69A 3AE4B 3E9SA 2AX5A 1TS5A 3AEEB 4YTPB 1C4PA 1T5XD 3CIRB 1FFUA 1D5XC 2MJDA 4HKZE 4RCOA 1B9RA 1RM6C 1P7EA 1VDVA 4OZAA 3AE2B 4XE0A 2G9HD 3EA6A 3ZQ4A 1VZ8A 3TEZA 1ET9A 2WXKA 2BTEA 4OZBA 1SE4A 1J7BA 4GDKB 4P16A 2LHDA 2WU2B 3BYTB 3FAHA 3I57A 3CWIA 1HXYD 1XXGA 4HKQA 4UDUC 2RPVA 2DBYA 4XDDA 3VRAB 3DWGC 2WS3B 3NVYA 1YN4A 3AEFB 1HA5A 5BMGA 4KGTA 4ARCA 1QF6A 1LO5D 1ACCA 2B76B 1CK1A 1DYQA 1I4PA 5G5GA 1XCTL 1FEHA 4YTMB 1E10A 4NJCA 2WXIA 3AB5A 2PKOA 2PMVA 1L0YB 1ESFA 2GI9A 4OHJA 2JSVX 1C77A 1GOZA 2IGHA 2WXNA 3HRDD 1YQ4B 4N59A 2NMQA 5EE3A 1IBXA 3SFEB 1L4ZB 1C78A 1CZPA 1R7SA 1XLQA 2Y5PA 2ONQA 1YQ3B 2WDVB 4YT0B 1XCQL 4MH8A 3TEWA 4H2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIL B;  3MP9 A;  1F2R I;  5HHD G;  1PGA A;  2KQ4 X;  5JXV A;  5HFY A;  1GB1 A;  2KN4 A;  2N7J A;  1UWX A;  2PLP A;  1HZ5 A;  1FD6 A;  1MPE A;  2QMT A;  2N9K A;  1K53 A;  2JWU A;  4KGS A;  2K0P A;  5BMH A;  2KWD A;  4WH4 A;  1MHH E;  4GLS C;  4IOI E;  1C9F A;  5HI1 A;  2EEL A;  1IBX B;  2PTL A;  1YNT E;  4IKG A;  2LGI A;  1XF5 L;  2KAC A;  4OZC A;  1QKZ A;  2IGG A;  1PGB A;  2N9L A;  1K50 A;  2ZW1 A;  1HEZ E;  2PW9 A;  4MAC A;  1FCC C;  1GB4 A;  1K52 A;  2I2Y A;  1P7F A;  1IGC A;  1PGX A;  1K51 A;  4HKZ E;  1P7E A;  1F2R C;  4OZA A;  1Q10 A;  2J53 A;  4OZB A;  2I38 A;  2LHD A;  2J52 A;  5HG2 A;  1IGD A;  2LUM A;  2JU6 X;  4HJG E;  2KDM A;  5BMI A;  2RPV A;  2IGD A;  2ZW0 A;  4KGR A;  1FCL A;  5BMG A;  1KH0 A;  4KGT A;  3UI3 A;  2GB1 A;  1HZ6 A;  1MI0 A;  2JZP A;  4D2K A;  2JXT A;  1XCT L;  2QSD A;  1ZXH A;  2RMM A;  2GI9 A;  2JSV X;  3GB1 A;  1EM7 A;  2IGH A;  3FIL A;  2LHE A;  2NMQ A;  1IBX A;  3V3X A;  2ON8 A;  2ONQ A;  1MHX A;  1XCQ L;  1YMH E;  1JML A;  2OED A;  1D4B A;  1MVK A; 
#chains in the Genus database with same CATH topology
 4TQ0 A;  1JRU A;  1WX9 A;  2KMC A;  4ZHO A;  3QCA A;  3RNG C;  5HFY A;  4ZRP A;  3H7S A;  3NVV A;  2QIL A;  3RZF A;  1T0R C;  2A4Z A;  2IND C;  2CKH B;  2YEP B;  2QMT A;  3PRM B;  3BIN A;  3B2F A;  1T0Y A;  3P4Q B;  5E6O A;  5AZF A;  2N9K A;  1FFV A;  3CMM B;  1UUP A;  1L7Y A;  3R7Q A;  1FO4 A;  1IBX B;  2L52 A;  4LNK A;  3TJP A;  2DYO A;  4OZC A;  1L0X B;  2WDQ B;  4RNA A;  3RNA C;  4NZL B;  2KDB A;  2K22 A;  1K50 A;  3N32 A;  2JY6 A;  1DGJ A;  2KTR A;  4W9J A;  4ZOH C;  1DOY A;  2ZW1 A;  2MRP A;  1PGX A;  4AWJ A;  3MC8 A;  4KKI A;  4GOC A;  1UEL A;  3L17 A;  3O65 B;  1TKG A;  3L4P A;  4KX6 B;  1WRD B;  1PUT A;  3QHT A;  4A8X C;  2L3Z A;  2DZI A;  4PK1 A;  1JRP A;  4JQW C;  2Y3A A;  1XLO A;  4LNI A;  2KTR B;  1V1O A;  3ZNI D;  2XNA C;  4N58 A;  4DHZ B;  3ZGZ A;  1E7V A;  1ISN A;  2LHE A;  4WWM A;  4TV3 A;  3V05 A;  4LDT D;  3TEX A;  5TR5 A;  1JML A;  2JQR B;  1MVK A;  4AJY B;  3MP9 A;  4J6I A;  3HUI A;  1IUE A;  4N9F 4;  2KQ4 X;  1NEK B;  4ANV A;  2INC C;  3HVD A;  2QCZ A;  1I7H A;  4BFR A;  2INN E;  4B0M A;  2W55 A;  3KYC D;  1E8X A;  2LVO A;  5AEK B;  5I4D A;  2WXP A;  1WXV A;  1MHH E;  1QZE A;  4M0W A;  1WE6 A;  1RYJ A;  4KIK A;  1P0R A;  2K6Q A;  5CX3 A;  3VVW B;  2KT7 A;  2MP2 A;  2MQJ A;  2VZK D;  2JT4 B;  3GS2 A;  1Z2M A;  1CQV A;  4IM0 A;  1V1P A;  4BKS D;  1YN3 A;  3Q6B A;  4BVU C;  1KM7 A;  1XQQ A;  1N5X A;  2M19 A;  1R4M B;  4EEW A;  3BYY B;  3U52 E;  2J53 A;  3UQA A;  3BZD B;  2JWZ A;  1PYW D;  2WNM A;  5HG2 A;  2G3Q B;  1F52 A;  4P1C C;  3HM3 A;  4NY0 A;  3CST A;  4LTU A;  3A1Q A;  3PSE B;  3T3N A;  5EE1 A;  2LGX A;  5CHF A;  2BS4 B;  4KIK B;  1D6E C;  3PRZ A;  5C2T B;  4BZA A;  2MP2 B;  3QQ8 B;  2K39 A;  4XYC A;  3VR8 B;  3AU5 A;  1KRH A;  4DHZ E;  2D10 A;  4DWF A;  3X23 A;  2VH1 A;  1FXI A;  1H4R A;  1NYR A;  4FN2 A;  3ZJV A;  2MJ3 A;  4N6E B;  1VZ6 A;  2AQ3 B;  2AEH A;  1OQR A;  1WF9 A;  4MGK E;  4ANW A;  1PGA A;  4NAW A;  3IT6 B;  3R2T A;  2LGS A;  2CU3 A;  3ZYY X;  4C7Y A;  3A1Q B;  1B1Z A;  2V3S A;  1GB1 A;  5CHV C;  4P1B C;  1LGR A;  1FNW A;  2L8J A;  3ZO5 B;  4MJS A;  2HJ8 A;  4M8M A;  3VFK A;  3WAM A;  4WH4 A;  4LDT B;  2KJR A;  2AL3 A;  5GXG B;  4RF1 A;  2EEL A;  3KVF B;  2ASQ A;  3B2G A;  5IOI A;  4BKS A;  2G4S A;  1WGD A;  4C80 A;  3H9D A;  4WWP A;  3AED B;  3ZIM A;  2QIE B;  4WIP A;  1EWC A;  2M8S A;  3EUB 2;  2NPT A;  4GU2 A;  3Q3F A;  4XX5 A;  2X38 A;  2DZJ A;  1TBE A;  4JLC A;  1IGC A;  5DPW A;  1ZOY B;  3MHZ A;  2PVO D;  4IDI A;  1FRD A;  3M63 B;  3KYD D;  4A9A A;  3N9Y C;  2O6V B;  3DBH I;  2IBI B;  2I38 A;  3BVZ A;  3ONS A;  2M56 B;  2ZJD A;  4GDL B;  2QEJ C;  3DBS A;  2L0T A;  2JU6 X;  2WGS A;  5BMI A;  1BML C;  2KK8 A;  1LM8 B;  1E90 A;  2K8H A;  3KWV A;  1HZ6 A;  3ETR A;  1J7A A;  4W9L A;  1QT9 A;  2Z8L A;  4BBN F;  1RRB A;  3GB1 A;  2LAS A;  4BOS C;  3ZXR A;  3VHT C;  3QJZ A;  1MJD A;  3MFG A;  2WLB A;  3AI5 A;  2NBW B;  1UGM A;  4IWQ A;  4OW0 A;  3SU8 X;  1MHX A;  1WX7 A;  2LFI A;  4GIV A;  2OED A;  1WMH B;  2HJ1 A;  3DBR B;  2NTT A;  3ZDM C;  4FHJ A;  1RWS A;  2L00 B;  2HTH A;  3NZ3 A;  4A3P A;  1N60 A;  2N7J A;  2WXM A;  5DCN A;  4XWW A;  2PE9 A;  4LJO B;  2CHW A;  2UU7 A;  2Y5C A;  4M00 A;  2NBU A;  4HCN B;  1TTN A;  3NY5 A;  3A9J B;  1SE2 A;  1UNS A;  2RSU A;  3EGR A;  1C1Y B;  2MW5 A;  2KNB A;  2LEK A;  1VR9 A;  2WU5 B;  1QKZ A;  4KZC A;  1V5T A;  2I1K A;  3NHE B;  1WX8 A;  2H89 B;  1H8C A;  1K8R B;  2ICI A;  2XN9 C;  3WIM A;  3VRB B;  3P4S B;  3Q69 A;  3I63 C;  4IWP A;  3AEE B;  2M17 A;  4MH0 E;  1EF1 A;  1T5X D;  3RT3 B;  4HKZ E;  4LNN A;  2KJ6 A;  4JL9 A;  1P7E A;  2JUO A;  1VDV A;  5JZE B;  2G9H D;  2L0F A;  1J7B A;  2KXJ A;  2WU2 B;  3BYT B;  3FAH A;  4EZL A;  3CWI A;  3UGB B;  2RPV A;  4XDD A;  2JVC A;  3B1L X;  4OVV A;  2KYW A;  1HA5 A;  2C5L C;  1IPG A;  4YL8 A;  2B76 B;  5AZG A;  1CK1 A;  2D07 B;  2BF8 B;  3VTU A;  3CF6 E;  1E10 A;  2KX3 A;  3UIO B;  3QA8 A;  4MGI E;  3HRD D;  3IVF A;  1R7S A;  1C78 A;  2LXC A;  3A4R A;  2Y5P A;  3VH3 B;  1V5O A;  1XCQ L;  1WJ6 A;  3RCZ A;  4B95 A;  4MH8 A;  3OLM D;  4PS3 A;  3FIL B;  1TS4 A;  4HXD A;  1G6J A;  5E6J A;  4NQL B;  4FXC A;  1R4M I;  3ECI A;  1TZO A;  1ZP0 B;  2LRW A;  4A90 A;  5LXH A;  2B3A A;  4EE2 A;  3HM6 X;  2MEK A;  4PS7 A;  4ZRQ A;  1ZE3 D;  3DHI C;  3JYU A;  2KWD A;  4ANU A;  4RGO S;  4CO7 A;  3H1U A;  4LCD E;  2KD0 A;  2WYQ A;  1E0Z A;  2WXJ A;  3Q2A C;  1WI0 A;  3ML9 A;  4AP4 C;  2GBN A;  2XK5 A;  5JH5 C;  5J18 A;  2NCN A;  2MBO A;  1WYG A;  2WX0 A;  4US8 A;  4K3C A;  2RGF A;  5J2R A;  4K7W A;  1WGR A;  3J9C A;  2GBM A;  3I9V 1;  3NJT A;  4TQ1 A;  2GBK A;  2H88 B;  1L6U A;  1WZ3 A;  4USA A;  2LUM A;  3BII D;  3P4P B;  1M4V A;  1TS2 A;  3PTF C;  4EZJ A;  1ZUD 2;  3KH0 A;  2ACZ B;  2GMI C;  3Q8C A;  5D3I B;  4X57 B;  1I4G A;  3TCA A;  3NOB A;  1QOG A;  4XDC A;  2QSD A;  2RMM A;  3A4S C;  4FJV B;  2M0A A;  2MBH A;  2KJH B;  2N1V A;  3PVL A;  3AEA B;  5E6N A;  3DWM A;  2JYT A;  1QLB B;  4II2 B;  3VUW A;  3H7P B;  4MEL A;  4A55 A;  4WQM A;  3NVZ A;  3S2A A;  1V9J A;  4ITK A;  3WAP A;  3GOE A;  2L1A A;  4HPP A;  2C60 A;  4BBN C;  4HCP B;  3QK0 A;  1WSP A;  3M3J A;  4WJO A;  1PFD A;  1JWU D;  2KVR A;  3QWZ B;  5LLI A;  2LGY A;  2BYF A;  4PT5 A;  1FD6 A;  1I4R A;  3PS6 A;  3FC4 A;  5FKA C;  1CMX B;  3ZNG C;  3P63 A;  4AS1 A;  2KFK B;  1WGH A;  2IGG A;  2ZCB A;  2D3G A;  2BT6 A;  3SR6 A;  1PGB A;  3TBL D;  2Q5W D;  1E9M A;  4ACF A;  5KHQ A;  1F0Z A;  1HEZ E;  2V4I B;  1TYG B;  3Q8B A;  3QAQ A;  1WZ0 A;  2WQY B;  3RFZ B;  3ML8 A;  1VRA B;  4C4V B;  4AOF A;  3AE8 B;  3DBR I;  3TEY A;  3NZU A;  3BK1 A;  1GG3 A;  1E7P B;  2KDM A;  5FR6 A;  1E5W A;  2UWQ A;  4BKT A;  4K81 A;  3T9L A;  1KH0 A;  3ZTC A;  3AN1 A;  3AE9 B;  5C1Z A;  1ROE A;  2I1J A;  3RPF C;  4D2K A;  5EE9 A;  4HRO A;  2IO3 B;  2G1E A;  2BYV E;  1SJH D;  2KKC A;  2LZ6 A;  3LB8 C;  2MA9 B;  1EM7 A;  2GRI A;  1T3Q A;  2ON8 A;  3ZXV A;  2HDE A;  2QJL A;  2K9X A;  4W9F A;  1TJE A;  2RPQ A;  2SEB D;  4W9C A;  4JX1 C;  3MJW A;  5H8Y E;  2N7E A;  4EFO A;  4EUT A;  2BS3 B;  2AQ2 B;  1TKY A;  1ZW7 A;  2A5U A;  4RH6 A;  1UWX A;  1NBF C;  2O2V B;  1HZ5 A;  2RDH A;  3HK0 A;  1V97 A;  3K9O B;  3R3M A;  2NTS A;  2IJ0 A;  2LD9 A;  3HIZ A;  1EU4 A;  1BXT A;  2UYZ B;  3HHM A;  4HEA 1;  4IKG A;  2QDF A;  2BVC A;  1UD7 A;  4CHK A;  1WYW B;  2AQ1 B;  3R66 C;  1SBB B;  1U4A A;  3Q8F A;  3A9K B;  1VJK A;  2JX5 A;  3AM9 A;  4Q2J A;  4P7I A;  2KDF B;  2O6V D;  4E74 A;  2IY1 B;  3ZNZ B;  2BYE A;  1LXD A;  5H92 C;  3ZTD A;  2KWV B;  1Q5W B;  2WXG A;  2PVG C;  4MT5 A;  4AJW A;  5AZH A;  2IGD A;  3VUY A;  4KVG B;  2KMA A;  2Z0E B;  2IO1 B;  1E8Z A;  1FIQ A;  2GB1 A;  3WA0 A;  1JAL A;  3NS8 A;  1WXM A;  2IZV B;  5E6P A;  1MI0 A;  2TSS A;  5C3J B;  2R2Q A;  1WGG A;  1ZXH A;  2KAN A;  1YIW A;  3U30 A;  5BYS A;  2KZR A;  4GXB A;  4JWS C;  4A20 A;  1KJT A;  4QAY A;  4W9G A;  1YQB A;  2W3S A;  2QHO A;  1D4B A;  4F8C B;  1P1A A;  4WWN A;  1AN8 A;  2FBW B;  1JW9 D;  3RD2 A;  4DXF A;  3NZS A;  1UH6 A;  1I4X A;  2DLB A;  1UGJ A;  4I6L B;  2K8B A;  4URK A;  3VTV A;  2XBB C;  1HE8 A;  2PLP A;  5L95 C;  3KWL A;  2BWF A;  2DAJ A;  4ZRK A;  4ARI A;  1WXQ A;  2J0M A;  2MLB A;  2MBB B;  1C9F A;  2K6D B;  5BYR A;  2BWE S;  1OFF A;  5HI1 A;  1FXA A;  4L23 A;  1SSN A;  3EFU A;  3DVN U;  5EDS A;  1NI2 A;  2LRU A;  2INP E;  3KUC B;  2O6V A;  3SFD B;  4A3O A;  4F7Z A;  3C19 A;  4GDL A;  1C4P A;  3AE2 B;  3Q3J A;  3OJ4 B;  3EA6 A;  5C23 A;  2WXK A;  2BTE A;  3RNC C;  2D3C A;  2LHD A;  3I57 A;  1E8W A;  1HXY D;  2JPH A;  1XXG A;  3ZW3 A;  4HKQ A;  2DBY A;  1N6Z A;  3NVY A;  1PQS A;  2WDT B;  4KGT A;  5JHB A;  4XZ4 A;  4FJY A;  1XCT L;  1FEH A;  3AUL A;  4NJC A;  3Q3O C;  3PRE A;  2PMV A;  2PPH A;  1L0Y B;  2M4N A;  1WMH A;  2WXN A;  1GOZ A;  2MBE A;  4M02 A;  2NMQ A;  3PHW B;  3SFE B;  1XLQ A;  4ZYN A;  4HLE A;  5J17 A;  4H2A A;  1YOV B;  4ZRJ A;  5HHD G;  3R8B A;  4LJP B;  4HRS A;  1JCK B;  2KDE B;  5AUK A;  3RN9 C;  4RF0 A;  2RDG A;  3KW5 B;  4GN1 A;  3PRP B;  3A9J A;  1ENF A;  2ZNV B;  4RGT A;  1RAX A;  3O13 A;  2ZPN A;  3C8Y A;  2L32 A;  2N9P C;  1XD3 B;  4GLS C;  3WAO A;  4RGN A;  3ZVV A;  3T8M A;  4MGY E;  3P2B A;  5JHA A;  2OJR A;  2K5P A;  2YEP F;  2DX5 B;  1LFD A;  1NYQ A;  4JIO U;  2V3P A;  3PGE A;  4ANX A;  5D94 A;  1GC7 A;  2N9L A;  2R2O A;  1ZKH A;  1NI3 A;  1MFW A;  5DPT A;  1K52 A;  4WJN A;  2I2Y A;  3H8H A;  3X0W A;  3AV8 A;  4IC7 B;  2OJW A;  2PEA A;  2KWU B;  2ZCC A;  1AWD A;  2MSE D;  3BWU D;  4RGM A;  3DDC B;  4KDI C;  2Z0D B;  1Y56 A;  2FCS A;  3DVG X;  4EOY A;  3IHP C;  4W9H A;  4LNF A;  3CSF A;  3FKY A;  2LI5 A;  3WAL A;  4NJ6 A;  2ZW0 A;  4ZHP A;  1D5M C;  4MDK E;  4B0E A;  3W5V B;  4DQO C;  2KVZ A;  3U2S C;  4DK5 A;  1JQ4 A;  3SEB A;  4CYE A;  2J0J A;  2BBC A;  4LLG M;  1M94 A;  1OQQ A;  4JWU C;  4HDO A;  2L83 A;  2FIF A;  3FIL A;  3IFW B;  2CS4 A;  3NVW A;  3V61 A;  1LQB A;  2FE8 A;  3GP7 A;  3U8Z A;  2R61 A;  5TSS A;  4PYZ A;  3L16 A;  3P4R B;  1SEB D;  4RMA A;  4OVU A;  3MTN B;  1SIJ A;  3ZNH B;  1JWB D;  4TUU A;  2W3R A;  4KZ0 A;  1QQR A;  2L05 A;  4IM3 A;  1FMA D;  2DNF A;  2BYT A;  1C76 A;  3BVG A;  2OHF A;  3PHX B;  5CTR C;  4NQK E;  1P98 A;  4FA6 A;  3PZ7 A;  1UWM A;  4DDG D;  3B9J A;  3TSS A;  1WR1 A;  2PTL A;  2KQS A;  4YSY B;  2FID A;  2G45 B;  2WXO A;  4K7S A;  3VXW A;  4DXG A;  4WAA A;  3LXF A;  1D3Z A;  5CHW A;  2L76 A;  1WGK A;  1V8C A;  3Q3N C;  3L08 A;  1ET6 A;  3JSV B;  1K51 A;  2MH7 A;  3MC0 B;  5BYQ A;  1RFA A;  5LNK 1;  3B0A A;  1Q10 A;  4YSX B;  2FAZ A;  3NUH B;  1BUI C;  1IGD A;  1E6E B;  2GBR A;  4B9K A;  2BGF A;  5FK9 C;  1FNV A;  4KGR A;  3N1X C;  3VQI A;  2KOX A;  1YN5 A;  2K1F A;  4M8N A;  1WR6 E;  2BKR B;  1N5W A;  3AE7 B;  2DZK A;  1MG8 A;  1F9J A;  2K3U A;  1OEY A;  1EUV B;  2JZP A;  1A70 A;  1R4N B;  3PO0 A;  4IM2 A;  1AW7 A;  1S3S G;  3H7P A;  3W2D A;  4HVB A;  1KF6 B;  2MJE A;  5MPO A;  3RYT A;  3I3T B;  3ABV B;  2JF5 A;  1GAQ B;  3V3X A;  1E8Y A;  3IAM 1;  1YMH E;  1ZDX A;  2W54 A;  2CJO A;  2DWQ A;  1XT9 B;  2KC1 A;  2AYO B;  2BQQ A;  1F2R I;  4PS8 A;  3BY4 B;  4C56 C;  1IYF A;  4RM9 A;  2EMT A;  4E71 A;  1Z5S B;  3MJ5 A;  2J0K A;  2KDI A;  3EHV A;  2CHZ A;  1SIF A;  2J4X A;  1VLB A;  2GOW A;  2CJN A;  1MPE A;  2C7H A;  2KFK A;  4IW0 A;  5G55 A;  1YD8 U;  4ICU A;  2WXH A;  1L0V B;  4IOI E;  1KLG D;  3PV1 A;  2V4L A;  4HK2 A;  4HPL B;  4LNO A;  2M1M A;  1DOI A;  3U7Z A;  1C3T A;  3MHS D;  2LGI A;  1C4A A;  3RNB C;  2MX2 A;  1DOX A;  2D3A A;  3PZ8 A;  1V2Y A;  2MHJ A;  3RNF C;  2KHW B;  1JWM D;  1XO3 A;  3TIX A;  4C4V A;  1V49 A;  1P7F A;  2EMS A;  1WJU A;  1N61 A;  3AEB B;  4JPS A;  2LUE A;  3DQV A;  2KLG A;  3KUZ A;  4II3 B;  2C9W B;  2K25 A;  3AE3 B;  3VTW A;  3PLV A;  5EE0 A;  2BPS A;  3RI7 C;  2V0G A;  2DAF A;  2ZVO A;  1T6B X;  3AXC A;  1ZDV A;  4RM8 A;  2AWT A;  2BB5 A;  4PYU A;  1KLU D;  2LGD A;  2V1Y A;  5IO9 A;  4P6V F;  2FCM A;  2AL6 A;  4W9K A;  1RFK A;  2YVC A;  3VUX A;  2FUG 1;  3L54 A;  4FAD A;  2LJ5 A;  1J7C A;  1WXS A;  3I5J C;  2WDR B;  1WXA A;  4E3C A;  1T0Q C;  4XGA B;  1AAR A;  4I6P A;  1NVI D;  1S1Q B;  1SF0 A;  3A33 B;  1WFY A;  2VH2 A;  2SAK A;  3UQB A;  1FNU A;  2O2V A;  1P3Q U;  3PLU A;  2WHI A;  1F77 A;  1V81 A;  4IWO A;  3V6C B;  2KWC A;  1Y8R C;  4MSQ B;  1KTK A;  2QC8 A;  3M62 B;  3SDL C;  2DYM A;  2KN4 A;  3GZN B;  3UIP B;  4NAM A;  3D32 A;  4AUQ C;  4EZK A;  1EO6 A;  4FUL A;  1Q1O A;  1YJ1 A;  4GDK A;  3R2I A;  3RMK C;  1QIL A;  2GBJ A;  4MEM A;  2N9E B;  3M95 A;  3OAW A;  3VDZ A;  3A9K A;  2JZ3 B;  2G4D B;  3Q8A A;  2HD5 B;  2X8X X;  4KSK C;  1QOF A;  2JYE A;  3TL5 A;  3OJ3 A;  3ZRF A;  4DHJ B;  2LMC A;  3KLS X;  1T0S C;  3T3O A;  2PW9 A;  4MAC A;  3AE4 B;  1NDD A;  1GC6 A;  4NJ7 A;  3PZD A;  4YTP B;  2C7M B;  3CIR B;  2MJD A;  1D5X C;  4HWI B;  1RM6 C;  5DPS A;  4OZA A;  3H6N A;  4XE0 A;  1KLV A;  3JVZ X;  1VZ8 A;  3TEZ A;  1ET9 A;  4OZB A;  1SE4 A;  4GDK B;  4P16 A;  1WIA A;  3R7R A;  3ZLZ A;  4F1S A;  4TKN A;  3VRA B;  3QIJ A;  3DWG C;  2WS3 B;  4W9I A;  1YN4 A;  3ENE A;  3V62 A;  4ARC A;  1QF6 A;  4IUM B;  2NVU I;  4WWO A;  1I4P A;  1OQY A;  5G5G A;  2DYB A;  2WXI A;  3AB5 A;  2JSV X;  2OOB B;  1C77 A;  2IGH A;  1YQ4 B;  5EE3 A;  4NPN A;  1ZGU B;  5BO4 B;  1CZP A;  4KV2 A;  3RNE C;  1YQ3 B;  2WDV B;  4W9D A;  2KC2 A;  3TEW A;  1WE7 A;  3EEC A;  1YJI A;  3DVG Y;  2BKF A;  1SXT A;  2KLC A;  3U4E G;  1TGZ B;  4WJQ A;  5JXV A;  1X1M A;  3P42 A;  4L1B A;  1UF0 A;  1UBI A;  3JW0 X;  1WGY A;  2JRH A;  1QOB A;  1WJ4 A;  2DEN B;  5IA7 A;  2DZM A;  1L4D B;  2W9N A;  3DOW A;  3NG0 A;  4GB9 A;  1K53 A;  2BS2 B;  3RUI B;  4REZ A;  2N9X A;  4A6Q A;  1L5P A;  1PDX A;  5IN7 A;  4YTN B;  3L10 B;  2MCN B;  1YX6 B;  1XF5 L;  3E56 A;  3BVM A;  1WWT A;  2WX1 A;  4XC2 A;  1R4N I;  2D5G A;  4M0W B;  2FCQ A;  2PJH A;  4YSZ B;  1FM0 D;  1FCC C;  5D2M B;  2HTM E;  3DCG A;  3W1S A;  3DPD A;  1F2R C;  1V1P B;  3DBL B;  3AU4 A;  4FLH A;  1IP9 A;  2PIA A;  2IO2 B;  2J52 A;  4OVZ A;  3W5U B;  1FPY A;  4WAF A;  4BOZ B;  2YLM A;  2RR9 A;  2IPK D;  2FCN A;  3W1S C;  5GMV A;  3TUO A;  2M0X A;  3EC8 A;  2IDY A;  1FRR A;  1VZ7 A;  1XLP A;  4M01 A;  3UIN B;  2WP9 B;  2FUH B;  5G2N A;  2N0S B;  3OWE B;  1WH3 A;  1SE3 A;  4L2Y A;  2K8C A;  3ZJT A;  4G50 A;  1WM2 A;  4DXA B;  4HJK A;  2LVQ A;  3B08 A;  4G11 A;  1OEY J;  2CU1 A;  1I42 A;  3W9C B;  1A5R A;  1EWY C;  5T8I A;  1N62 A;  3UF8 A;  4K1R B;  1WRI A;  2DHZ A;  3AE6 B;  3ZJU A;  4DDI D;  4MM3 A;  3IBE A;  1GNU A;  3L0W B;  1C4C A;  4NAW B;  2W82 A;  3KUD B;  3N30 A;  2KAJ A;  3ZUN A;  3APC A;  1CJE A;  4I6N B;  2J7Q B;  2WWZ A;  1N63 A;  2ZZP B;  2KFJ A;  2ZNV C;  1BT0 A;  4MJS B;  1L2N A;  5DPR A;  4KKJ A;  2WXR A;  3ALB A;  1HTO A;  4FHK A;  4K7U A;  2VZK B;  4GGQ A;  3W1Y A;  4WJP A;  5G5H A;  1ZXI A;  3N3K B;  1I4H A;  4FJZ A;  5D6J B;  1HTQ A;  4K3B A;  2KTF A;  3KQ4 A;  1VCB A;  1OGW A;  1V86 A;  4MM3 B;  2NPT B;  4JE3 B;  4EKU A;  2WXF A;  3ZDT A;  2KQ7 A;  3L13 A;  2CR5 A;  4CQN A;  3ZKJ C;  4O1N A;  3RZW C;  2RDB C;  4US9 A;  3URY A;  4HJG E;  4ZYS A;  1JWS D;  3TMP B;  1JWA D;  3GZN I;  1FCL A;  1F1H A;  1MG4 A;  4W9E A;  2FNJ B;  2JZZ A;  1TY2 A;  2KX0 A;  3C0R B;  3NRZ A;  1J8C A;  5IP4 D;  1STE A;  2N7D A;  2WXQ A;  4B6W A;  3Q14 C;  4MSM B;  4ICV A;  3ZRC A;  5IKC M;  5FR3 A;  4AQ7 A;  3MC9 A;  2REX A;  5KHO A;  2D11 A;  2XEW A;  2HE7 A;  3PPA A;  1RLF A;  1NEN B;  4BAX A;  2VRR B;  3WCQ A;  4HPM B;  3AH7 A;  2BW2 A;  3K9P B;  3LYY A;  3AMZ A;  1I4Q A;  4ASW C;  1KFY B;  2KO3 A;  4MGZ E;  2ZPY A;  3IAS 1;  2BB6 A;  2E6X A;  3AEC B;  4S0R A;  2EKI A;  1TT5 B;  3DHH C;  2IO0 B;  2JXX A;  3Q8E A;  3LJ3 A;  4RFB A;  4S17 A;  5D7G A;  2NBV B;  3Q3M C;  1SGH A;  1XLN A;  3DHG C;  2JWU A;  4KGS A;  5BMH A;  1V6E A;  2V3N A;  2KAC A;  2D3B A;  2J42 A;  2LVP A;  4C7Z A;  3JSV A;  3IXS A;  2KMM A;  4TMA B;  1E7U A;  1OTR B;  1UZX B;  4BKG A;  4LK0 M;  3SD5 A;  3RUL A;  4J3O D;  2NR2 A;  1GB4 A;  5LXI B;  1SJE D;  3VR9 B;  1YJJ A;  3N1Y C;  4TSS A;  1P9D U;  4DBG A;  1JRO A;  1TS3 A;  4XWT A;  1C79 A;  4WUR A;  2MBQ A;  2PE6 B;  1D5Z C;  1SE9 A;  3QC8 B;  3V6E B;  1I35 A;  4YXD B;  3IG3 A;  3NS1 A;  3UI3 A;  1V80 A;  1WY8 A;  3AE5 B;  5AUI A;  1YX5 B;  3BK2 A;  2GLS A;  3SHQ A;  3VAW A;  2JXT A;  1UBQ A;  1EF5 A;  2LWP A;  1HQR D;  3EFC A;  3IT4 B;  3HVZ A;  3OG5 A;  4KDL B;  3AEG B;  2E3T A;  3PT2 B;  4R3D A;  3P1M A;  5HKH A;  4G3X B;  3LDZ E;  4GSW A;  4ZRI A;  1SB3 C;  3N1Z C;  4JGH B;  3AE1 B;  3DVN V;  1AYF A;  1WM3 A;  5D3D A;  1TZ1 A;  2LXA A;  1GPX A;  3DBL I;  1TY0 A;  3APD A;  2WXL A;  1ZPS A;  3QAR A;  2K0P A;  1QOA A;  5IAA C;  1VD2 A;  4WQO B;  3VH4 B;  2CHX A;  1YNT E;  1Q0W B;  1EU3 A;  1L6V A;  2D2Q A;  3QX1 A;  4YWG G;  3GE8 C;  2EKE C;  3U7D A;  4DHJ D;  1WJN A;  1J0G A;  1TIF A;  3N20 C;  1TKE A;  2Z59 B;  1J19 A;  2RD0 A;  4ZDV A;  1GUA B;  1XEE A;  2KN5 A;  4C00 A;  2LJI A;  4IG7 B;  3E9S A;  2AX5 A;  4NNJ B;  1TS5 A;  4G0N B;  4RCO A;  1FFU A;  5L83 A;  1B9R A;  2V9H A;  3ZQ4 A;  2XK5 B;  4FBJ B;  3WAN A;  2MWS B;  2IY0 B;  3V60 A;  2JRI B;  4UDU C;  3APF A;  2IYD B;  2ZVN A;  4HDQ A;  2N4F A;  3AEF B;  4GMV A;  5BMG A;  2Y5B B;  1LO5 D;  1ACC A;  1DYQ A;  2NS5 A;  4YTM B;  3GE3 C;  1FXT B;  2PKO A;  4KSL C;  4OHJ A;  1ESF A;  2GI9 A;  2L7R A;  2N1W A;  4N59 A;  1IBX A;  1L4Z B;  2ONQ A;  4YT0 B;  1KOT A;  2ZEQ A;  2C7N B;  1GJZ A;  3DBH B; 
#chains in the Genus database with same CATH homology
 3FIL B;  1YJI A;  1TS4 A;  1SXT A;  5HHD G;  3R8B A;  3U4E G;  4TQ0 A;  5E6J A;  4HRS A;  4ZHO A;  5JXV A;  1JCK B;  3P42 A;  5AUK A;  4RF0 A;  4L1B A;  5HFY A;  4FXC A;  4ZRP A;  2RDG A;  3NVV A;  2QIL A;  1TZO A;  1ZP0 B;  1ENF A;  1QOB A;  4A90 A;  2YEP B;  4EE2 A;  1L4D B;  2MEK A;  2QMT A;  4ZRQ A;  3B2F A;  1ZE3 D;  3P4Q B;  2N9K A;  4RGT A;  1K53 A;  3O13 A;  2BS2 B;  3C8Y A;  2KWD A;  2L32 A;  4REZ A;  4A6Q A;  4RGO S;  1FFV A;  4GLS C;  4RGN A;  1UUP A;  1L5P A;  1PDX A;  1FO4 A;  1IBX B;  2L52 A;  4YTN B;  2DYO A;  1E0Z A;  1XF5 L;  2K5P A;  2YEP F;  4OZC A;  3E56 A;  2WXJ A;  1L0X B;  1NYQ A;  2WDQ B;  2V3P A;  1WWT A;  3BVM A;  4RNA A;  4NZL B;  2K22 A;  2D5G A;  2N9L A;  1K50 A;  1DGJ A;  4ZOH C;  1DOY A;  2ZW1 A;  4YSZ B;  1NI3 A;  1FM0 D;  1FCC C;  2HTM E;  1K52 A;  3W1S A;  2I2Y A;  3H8H A;  1WYG A;  1PGX A;  3AV8 A;  4US8 A;  1AWD A;  3BWU D;  4RGM A;  1F2R C;  4KKI A;  1V1P B;  1Y56 A;  3J9C A;  3I9V 1;  4TQ1 A;  2PIA A;  2J52 A;  2H88 B;  1L6U A;  1TKG A;  4USA A;  3L4P A;  4KX6 B;  2LUM A;  4OVZ A;  3W5U B;  3BII D;  3P4P B;  1M4V A;  4WAF A;  1TS2 A;  2ZW0 A;  2IPK D;  4ZHP A;  1D5M C;  4B0E A;  1PUT A;  1ZUD 2;  3W5V B;  4DQO C;  3TUO A;  3U2S C;  2ACZ B;  4A8X C;  1JQ4 A;  2IDY A;  3Q8C A;  3SEB A;  5D3I B;  1JRP A;  1FRR A;  1I4G A;  1VZ7 A;  2Y3A A;  1XLP A;  2BBC A;  1XLO A;  4LLG M;  1QOG A;  4XDC A;  2QSD A;  1OQQ A;  1V1O A;  2RMM A;  2XNA C;  4N58 A;  4JWU C;  2M0A A;  2WP9 B;  3ZGZ A;  2L83 A;  3FIL A;  2LHE A;  2N0S B;  3AEA B;  3DWM A;  3NVW A;  4WWM A;  2JYT A;  2FE8 A;  3GP7 A;  3OWE B;  1QLB B;  2R61 A;  1SE3 A;  4L2Y A;  5TSS A;  3P4R B;  3V05 A;  3ZJT A;  1SEB D;  3TEX A;  1JML A;  1SIJ A;  4WQM A;  2JQR B;  4A55 A;  3NVZ A;  1MVK A;  1JWB D;  4ITK A;  3MP9 A;  2L1A A;  3HUI A;  3W9C B;  1EWY C;  1IUE A;  5T8I A;  1WSP A;  2KQ4 X;  2W3R A;  1QQR A;  1PFD A;  1JWU D;  1N62 A;  1NEK B;  1WRI A;  3AE6 B;  1FMA D;  3HVD A;  4PT5 A;  3ZJU A;  1I7H A;  1C4C A;  2BYT A;  4NAW B;  1C76 A;  1FD6 A;  1I4R A;  3BVG A;  2INN E;  2OHF A;  4B0M A;  2W55 A;  2W82 A;  3FC4 A;  5FKA C;  2KAJ A;  1CJE A;  3PZ7 A;  2WXP A;  1UWM A;  5I4D A;  1MHH E;  4M0W A;  3B9J A;  1N63 A;  3P63 A;  1RYJ A;  3TSS A;  4AS1 A;  2PTL A;  2IGG A;  4YSY B;  2BT6 A;  4KKJ A;  2WXR A;  2VZK D;  3SR6 A;  2WXO A;  1PGB A;  3GS2 A;  2Q5W D;  1CQV A;  2VZK B;  4DXG A;  3LXF A;  1V1P A;  1E9M A;  1YN3 A;  1F0Z A;  5G5H A;  1ZXI A;  1HEZ E;  1WGK A;  1I4H A;  2V4I B;  1V8C A;  1TYG B;  1N5X A;  1ET6 A;  2M19 A;  3Q8B A;  3KQ4 A;  1K51 A;  2MH7 A;  3MC0 B;  2WQY B;  5BYQ A;  5LNK 1;  3BYY B;  4MM3 B;  4JE3 B;  3RFZ B;  1Q10 A;  3U52 E;  1VRA B;  2J53 A;  2WXF A;  4CQN A;  4YSX B;  3AE8 B;  4O1N A;  3BZD B;  3NUH B;  3TEY A;  1BUI C;  1PYW D;  2WNM A;  5HG2 A;  1IGD A;  1E6E B;  3BK1 A;  4US9 A;  3URY A;  4HJG E;  1E7P B;  2KDM A;  5FK9 C;  4ZYS A;  1FNV A;  4LTU A;  1JWS D;  1JWA D;  4KGR A;  3VQI A;  5EE1 A;  3T3N A;  1FCL A;  1YN5 A;  2BS4 B;  1N5W A;  1TY2 A;  1D6E C;  1KH0 A;  3AE7 B;  5C2T B;  3AN1 A;  2K3U A;  3NRZ A;  3AE9 B;  1ROE A;  2JZP A;  3RPF C;  1A70 A;  1STE A;  4D2K A;  5EE9 A;  4HRO A;  3PO0 A;  1AW7 A;  2G1E A;  2WXQ A;  3VR8 B;  3W2D A;  1KF6 B;  1KRH A;  1SJH D;  2MJE A;  4AQ7 A;  3LB8 C;  5FR3 A;  5MPO A;  1EM7 A;  3ABV B;  2GRI A;  1GAQ B;  3V3X A;  1FXI A;  1T3Q A;  1NYR A;  2ON8 A;  3ZJV A;  1NEN B;  2HDE A;  3IAM 1;  2MJ3 A;  2QJL A;  2K9X A;  1YMH E;  4N6E B;  3WCQ A;  1VZ6 A;  1ZDX A;  2AQ3 B;  2CJO A;  1TJE A;  2DWQ A;  2W54 A;  3AH7 A;  2BW2 A;  2SEB D;  1OQR A;  4JX1 C;  1F2R I;  4C56 C;  1PGA A;  3IT6 B;  3R2T A;  5H8Y E;  3LYY A;  2CU3 A;  3ZYY X;  4C7Y A;  3AMZ A;  1I4Q A;  1KFY B;  1B1Z A;  2BS3 B;  2AQ2 B;  1TKY A;  3IAS 1;  2BB6 A;  4RH6 A;  1GB1 A;  2E6X A;  3MJ5 A;  3AEC B;  1UWX A;  2EKI A;  1FNW A;  1HZ5 A;  2J4X A;  1VLB A;  3Q8E A;  2CJN A;  1MPE A;  2RDH A;  4RFB A;  1V97 A;  5D7G A;  1XLN A;  2NTS A;  2JWU A;  4KGS A;  5BMH A;  2WXH A;  2IJ0 A;  1L0V B;  4WH4 A;  1EU4 A;  4IOI E;  1KLG D;  5GXG B;  4RF1 A;  1DOI A;  2V3N A;  1BXT A;  2EEL A;  3U7Z A;  4HEA 1;  4IKG A;  2LGI A;  1C4A A;  3B2G A;  2KAC A;  2J42 A;  1DOX A;  4C7Z A;  4C80 A;  3PZ8 A;  3AED B;  2QIE B;  3IXS A;  2KMM A;  4TMA B;  2AQ1 B;  4WIP A;  1EWC A;  1SBB B;  4LK0 M;  3EUB 2;  1JWM D;  4J3O D;  2X38 A;  3Q8F A;  1XO3 A;  1GB4 A;  1VJK A;  2JX5 A;  1SJE D;  3AM9 A;  4Q2J A;  1YJJ A;  1P7F A;  3VR9 B;  1IGC A;  1ZOY B;  3MHZ A;  2PVO D;  1N61 A;  3AEB B;  4JPS A;  4IDI A;  1FRD A;  4A9A A;  3N9Y C;  4TSS A;  1JRO A;  3AE3 B;  5H92 C;  1TS3 A;  5EE0 A;  2I38 A;  2V0G A;  4XWT A;  1C79 A;  2WXG A;  2PVG C;  3BVZ A;  4MT5 A;  4WUR A;  1T6B X;  2M56 B;  1D5Z C;  2QEJ C;  4GDL B;  1ZDV A;  2JU6 X;  5BMI A;  2BB5 A;  2IGD A;  1KLU D;  4P6V F;  1BML C;  4YXD B;  3NS1 A;  1FIQ A;  1RFK A;  3UI3 A;  2GB1 A;  3AE5 B;  3KWV A;  1HZ6 A;  1JAL A;  5AUI A;  3BK2 A;  2FUG 1;  1MI0 A;  2TSS A;  3ETR A;  1J7A A;  1J7C A;  5C3J B;  2JXT A;  2WDR B;  1HQR D;  1QT9 A;  1ZXH A;  2Z8L A;  3IT4 B;  3HVZ A;  5BYS A;  3GB1 A;  4JWS C;  3AEG B;  3MFG A;  2WLB A;  2E3T A;  1NVI D;  1SF0 A;  4R3D A;  4OW0 A;  3P1M A;  1MHX A;  1SB3 C;  2LFI A;  2W3S A;  2SAK A;  2OED A;  1FNU A;  1D4B A;  1AN8 A;  2FBW B;  3AE1 B;  1JW9 D;  2NTT A;  1F77 A;  1AYF A;  4DXF A;  1RWS A;  5D3D A;  3NZ3 A;  1I4X A;  1KTK A;  1N60 A;  2DYM A;  2KN4 A;  2N7J A;  2DLB A;  2WXM A;  1UGJ A;  4XWW A;  1GPX A;  4NAM A;  1TY0 A;  2PLP A;  2WXL A;  1ZPS A;  2Y5C A;  3KWL A;  3R2I A;  2K0P A;  4ARI A;  1WXQ A;  1QIL A;  1QOA A;  1SE2 A;  1C9F A;  1UNS A;  3EGR A;  5BYR A;  1OFF A;  5HI1 A;  1YNT E;  1FXA A;  2LEK A;  1VR9 A;  1EU3 A;  1L6V A;  1QKZ A;  1SSN A;  2WU5 B;  1QOF A;  3Q8A A;  4L23 A;  4YWG G;  2JYE A;  2H89 B;  2INP E;  1TKE A;  2ICI A;  2XN9 C;  2LMC A;  3KLS X;  3T3O A;  1XEE A;  2PW9 A;  2LJI A;  3P4S B;  4MAC A;  3VRB B;  3SFD B;  3Q69 A;  3AE4 B;  3E9S A;  2AX5 A;  1TS5 A;  3AEE B;  4YTP B;  1C4P A;  1T5X D;  3CIR B;  1FFU A;  1D5X C;  2MJD A;  4HKZ E;  4RCO A;  1B9R A;  1RM6 C;  1P7E A;  1VDV A;  4OZA A;  3AE2 B;  4XE0 A;  2G9H D;  3EA6 A;  3ZQ4 A;  1VZ8 A;  3TEZ A;  1ET9 A;  2WXK A;  2BTE A;  4OZB A;  1SE4 A;  1J7B A;  4GDK B;  4P16 A;  2LHD A;  2WU2 B;  3BYT B;  3FAH A;  3I57 A;  3CWI A;  1HXY D;  1XXG A;  4HKQ A;  4UDU C;  2RPV A;  2DBY A;  4XDD A;  3VRA B;  3DWG C;  2WS3 B;  3NVY A;  1YN4 A;  3AEF B;  1HA5 A;  5BMG A;  4KGT A;  4ARC A;  1QF6 A;  1LO5 D;  1ACC A;  2B76 B;  1CK1 A;  1DYQ A;  1I4P A;  5G5G A;  1XCT L;  1FEH A;  4YTM B;  1E10 A;  4NJC A;  2WXI A;  3AB5 A;  2PKO A;  2PMV A;  1L0Y B;  1ESF A;  2GI9 A;  4OHJ A;  2JSV X;  1C77 A;  1GOZ A;  2IGH A;  2WXN A;  3HRD D;  1YQ4 B;  4N59 A;  2NMQ A;  5EE3 A;  1IBX A;  3SFE B;  1L4Z B;  1C78 A;  1CZP A;  1R7S A;  1XLQ A;  2Y5P A;  2ONQ A;  1YQ3 B;  2WDV B;  4YT0 B;  1XCQ L;  4MH8 A;  3TEW A;  4H2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...