5BMIA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmiA00
1FCLA 2IGGA 2KDMA 4WH4A 1IBXB 1GB1A 2RMMA 1K51A 4KGRA 2JWUA 2IGHA 5HHDG 1XCTL 5JXVA 1XF5L 4KGSA 2LUMA 1C9FA 2RPVA 1EM7A 1PGAA 1YMHE 1PGXA 2GI9A 1P7FA 2QSDA 2PTLA 5HI1A 2IGDA 1JMLA 5BMGA 2ZW0A 2NMQA 1MI0A 2JZPA 4D2KA 1ZXHA 3UI3A 2JU6X 2ZW1A 1MPEA 5HG2A 5BMIA 1Q10A 2EELA 2ON8A 2JXTA 4HKZE 1K53A 2GB1A 1FD6A 4IKGA 5HFYA 4KGTA 2K0PA 1KH0A 1IGCA 1GB4A 2PW9A 1K52A 3GB1A 2KQ4X 1YNTE 2JSVX 1HEZE 4OZAA 1FCCC 1MHHE 1F2RI 1PGBA 4MACA 2KACA 2LHDA 2LGIA 4OZCA 2ONQA 4IOIE 2PLPA 1F2RC 2OEDA 3V3XA 4OZBA 4GLSC 3FILB 2N9LA 2QMTA 3MP9A 2I2YA 1QKZA 5BMHA 2J52A 1K50A 1HZ6A 2J53A 1UWXA 1IBXA 2N9KA 1IGDA 2I38A 1MVKA 2LHEA 1P7EA 1D4BA 4HJGE 2KWDA 2KN4A 1XCQL 3FILA 2N7JA 1HZ5A 1MHXA
chains in the Genus database with same CATH superfamily
2D07B 1EWYC 1YJ1A 4BOZB 3WA0A 2MH7A 4EZKA 2DZIA 4OVUA 1YQ4B 4WJPA 4GOCA 4HXDA 3WIMA 3MJWA 1SSNA 3BVGA 3HUIA 3N1XC 3QJZA 4B0EA 2N9PC 3BYTB 4J6IA 4MDKE 4IM3A 1ZW7A 4MJSB 2WX1A 3GE3C 1KTKA 3B1LX 3A1QA 1DOIA 4NAWB 1FNUA 2N9EB 2WDRB 1L0YB 5KHOA 2SAKA 2GMIC 4HPMB 2Z59B 3AULA 5BYQA 3H7PA 3R3MA 2KQSA 1KH0A 2QC8A 2YEPB 3L0WB 1Y56A 1C77A 2CR5A 3B2GA 3W1SA 1QF6A 3OLMD 3RPFC 1MHHE 2KKCA 3RZWC 3PLUA 4JIOU 3NRZA 4IOIE 2BBCA 1NBFC 1ET6A 3A9JA 2KDBA 1TY0A 4N59A 2V9HA 2DBYA 2VRRB 3PO0A 1ZOYB 3MP9A 3QCAA 4XWTA 5AUIA 2GOWA 2J52A 5EE0A 3VXWA 4MH8A 1E6EB 4WWOA 2BS4B 3L4PA 3QIJA 2IO3B 2NVUI 5C1ZA 3NJTA 2BQQA 2MBEA 4ZOHC 3SU8X 4E74A 1CQVA 2KN4A 2ZPYA 2JZ3B 2PVGC 2Y5PA 1KLGD 2Q5WD 4BFRA 3AEBB 1EWCA 4BBNF 2AYOB 1GG3A 4M02A 3CMMB 1IBXB 2N0SB 4RNAA 4LDTB 3TEWA 2MJ3A 3UIPB 1V9JA 3NVVA 3AE8B 5BYSA 4WWPA 1EM7A 2A4ZA 2YEPF 3PZDA 3L08A 1JCKB 4KZ0A 5G55A 2IGDA 2B3AA 5BMGA 2ZCCA 2JZPA 4ANWA 1T0SC 2INCC 1WZ0A 3PHXB 1RYJA 1RFAA 2JQRB 2YVCA 2PMVA 1ET9A 4AJWA 3MHSD 1D3ZA 5D6JB 1ENFA 3AE2B 5HFYA 2MX2A 3ZRFA 3AE7B 3ZQ4A 3ML9A 1QILA 2KJHB 2GLSA 5D3DA 1I35A 1WXQA 4URKA 3MFGA 3RT3B 1ACCA 3DBLI 4KDLB 4ZDVA 4LJOB 1F2RC 5AEKB 2WWZA 1C1YB 3AU5A 1FMAD 2LEKA 1UD7A 2IO1B 4A55A 2Z0DB 3PREA 3X23A 4WJOA 2LVQA 5IA7A 4RFBA 5G5HA 1E7UA 1WJ4A 1SJED 2VH2A 3P63A 2LASA 2N9XA 4C00A 3K9OB 3Q3MC 4X57B 1HZ5A 2NPTA 4JE3B 4A3OA 2WXHA 2KDIA 3E9SA 1FCLA 2KOXA 2L0FA 3BVZA 1SGHA 3VR8B 2WXMA 1Z2MA 4TUUA 2J7QB 5AZHA 2LI5A 3O65B 1TKYA 2FE8A 4CQNA 4JWSC 1TKEA 1BUIC 2I1KA 3VH3B 4ARIA 4QAYA 1WE7A 1AN8A 2BS3B 2LJIA 1OEYA 4MH0E 3J9CA 2ICIA 3A9KB 1MI0A 1TY2A 1BMLC 1J7BA 4GMVA 1C4PA 3ZYYX 3AEFB 1J7AA 1B9RA 2V3PA 3BY4B 1GNUA 2MQJA 3KVFB 3A1QB 2K0PA 4B0MA 3TMPB 2V0GA 3U7DA 3EHVA 5I4DA 1IGCA 1TS3A 3TBLD 2KQ4X 1SE4A 3N9YC 4OW0A 2BB5A 2CU3A 1V97A 4G0NB 2RSUA 3VRBB 3V6EB 3EFCA 3AE3B 3ZUNA 3H6NA 5LXIB 2JWZA 3PPAA 4IWOA 1QKZA 1L0XB 4REZA 2DX5B 1R4MB 5L95C 1EO6A 3C19A 4AP4C 1UGMA 4NQLB 1FNVA 2L52A 4AQ7A 1L4ZB 2BW2A 2WXLA 2X38A 1BT0A 2W9NA 2N4FA 2RDHA 2XN9C 4CO7A 3X0WA 4AOFA 3RI7C 3V05A 1XCTL 5FR3A 3B0AA 1V86A 2MWSB 2DLBA 2D10A 2M56B 2PPHA 3DBRI 3WAMA 1RM6C 4PS8A 2DHZA 1MG8A 4WJNA 1T0QC 5J2RA 4NJCA 4GN1A 2WLBA 3KWVA 4ZHPA 3AE6B 1XLOA 3DBRB 1C4AA 3AEEB 2HJ8A 1UZXB 3Q8EA 4K1RB 3ZNID 4E71A 1WM2A 4KGTA 3HHMA 1QT9A 2OJWA 1FO4A 3W5UB 2ZPNA 1IUEA 3FKYA 5C2TB 4II2B 2HJ1A 4RH6A 3BWUD 1TIFA 2UYZB 2AEHA 4RF0A 2LGIA 1E9MA 2KLGA 4GSWA 3R66C 4R3DA 4JLCA 3JW0X 2WXGA 2CHXA 4IC7B 3QQ8B 4AUQC 1FM0D 3NVWA 4KKIA 2N9LA 4XWWA 2GBJA 2DZJA 2EKIA 2INNE 2K5PA 4GDKB 3N30A 4YSXB 1IBXA 2PE6B 1B1ZA 1ROEA 2HTHA 2MP2B 2BS2B 1ZP0B 3NZUA 1YX5B 4WJQA 4TMAB 3B9JA 5MPOA 3VVWB 2CHWA 3P4SB 5JHAA 3AH7A 4E3CA 1FXIA 1WMHA 1WX8A 2KANA 4BAXA 3W2DA 3RNBC 2QHOA 2KDMA 4YSZB 1FRDA 4NJ6A 2WNMA 4RMAA 2RDBC 5DPRA 3LJ3A 2LXAA 1K51A 4HLEA 2DAFA 2M4NA 2PIAA 2KHWB 2N1WA 2EKEC 4WURA 2MJDA 3A9KA 2AL3A 3P4QB 4LDTD 4KGSA 2WU5B 3RULA 1HQRD 2D3CA 5JZEB 3IBEA 1AARA 3RNAC 3MC9A 3VR9B 4S0RA 3L10B 2RDGA 3P2BA 5E6JA 2NR2A 2WS3B 2R2QA 4RGTA 3VRAB 1D5ZC 2GBKA 5L83A 5HG2A 4W9IA 1H4RA 4W9KA 4WIPA 5EDSA 2JF5A 4FXCA 4HJKA 1A5RA 1IP9A 2N1VA 4PS3A 1WXMA 2HE7A 1GOZA 3GB1A 5LNK1 1HEZE 1VZ7A 1FCCC 1RRBA 4USAA 3R8BA 1KLUD 4B6WA 2DNFA 1PQSA 2KACA 1QQRA 2BYVE 1FXAA 3WANA 4S17A 1VCBA 4YL8A 2NPTB 5DCNA 3V62A 2W3RA 1VRAB 3P4PB 2I2YA 1P9DU 1T0RC 4IM2A 1DOXA 1YJIA 3APCA 4OVZA 4F8CB 3VTWA 3DHGC 1HZ6A 4NAMA 3VUYA 2W3SA 2D3GA 3CSTA 3QC8B 1F77A 1UGJA 4W9CA 3KW5B 1QOAA 4YT0B 2WXIA 3T9LA 4ANXA 3SR6A 2KWUB 2YLMA 3P42A 3TSSA 2BKRB 2IJ0A 1TS4A 2JYEA 2R61A 1KOTA 2K39A 4DWFA 2KMMA 1GB1A 4BOSC 2V4LA 3VQIA 5J18A 1N60A 1NYRA 4ZYNA 4C7ZA 4AJYB 3DPDA 3AE5B 1DYQA 1UNSA 1JWMD 2PJHA 3AN1A 5HKHA 3Q14C 3GOEA 2K9XA 1PYWD 3DVGY 4WWMA 3WAOA 3IAS1 2JU6X 3AI5A 1AW7A 1Q10A 1L6UA 1WXSA 2K6DB 2J0KA 2JT4B 2FIFA 4IDIA 2KZRA 4RGMA 3I5JC 1V5TA 1LXDA 4LLGM 4P16A 1S3SG 3D32A 3RCZA 1C76A 1STEA 3R2IA 5E6PA 4EZJA 3H7SA 2LHDA 4IM0A 2AQ2B 2LXCA 4I6PA 4NPNA 2MRPA 2ONQA 1ZGUB 2Y5CA 3ML8A 3DHIC 4HVBA 2H88B 2RGFA 4GDLB 1JQ4A 5D2MB 2JXXA 4TSSA 2BWFA 2NCNA 2WXOA 3ALBA 2KVRA 4N6EB 4LCDE 4XE0A 2IY0B 4ICVA 2ZEQA 4MGKE 1NI3A 4II3B 3ZTCA 1IPGA 4YTMB 1WX7A 1IYFA 1N6ZA 2C60A 2JWUA 1C78A 2MBQA 3ZDMC 4MJSA 1I4RA 1CMXB 1CZPA 4HWIB 3ZNGC 3APFA 4BBNC 4TQ0A 5DPWA 5H92C 1C9FA 3M95A 3DQVA 2O2VA 4B95A 2WXFA 2R2OA 4XDCA 2J4XA 4MEMA 1LQBA 2Z8LA 2FUHB 2INDC 3L17A 4KDIC 1E5WA 2NTSA 1ZKHA 2IO0B 4ZRPA 3BYYB 1SJHD 1RLFA 2VH1A 3MJ5A 1U4AA 2BVCA 4OHJA 1RAXA 3R7RA 1KJTA 2CS4A 1M94A 2DZMA 1UELA 2VZKD 3RUIB 1GB4A 4C7YA 1YNTE 2KLCA 3QHTA 5EE3A 5FKAC 4RF1A 1ZUD2 4LNNA 2BT6A 2L8JA 4DHZE 1GAQB 5IOIA 1JROA 3N20C 3DOWA 1MG4A 3Q2AC 5CHFA 3Q3NC 3N3KB 4ANVA 2MA9B 3NZ3A 5BMHA 2CHZA 1K50A 2J0JA 4IG7B 2J53A 3Q69A 2I38A 2L00B 2D3AA 1SBBB 2CKHB 4PYUA 3VFKA 2NS5A 4HPPA 2BGFA 4JL9A 3Q3OC 3BK1A 5E6NA 2K8BA 2BWES 2IDYA 4ZRKA 1V1OA 4ITKA 3OJ3A 2WX0A 1F9JA 1YN3A 2CJOA 3PV1A 3BINA 4WAAA 2ZNVB 4I6LB 4FJZA 1SIFA 3CF6E 5HHDG 3AE4B 1WR6E 3R7QA 1VJKA 4DBGA 1WGYA 4KV2A 2FNJB 3H8HA 2FCQA 3Q8AA 4IUMB 1C4CA 1P3QU 2HD5B 4ICUA 1I4HA 3JVZX 3UI3A 1PUTA 1VZ8A 5BMIA 4HROA 3BK2A 3KQ4A 2NBUA 4C80A 3AM9A 3AMZA 4DHJB 1JRPA 4RM8A 1C79A 2JY6A 2QEJC 4K7SA 3RN9C 1FRRA 1I7HA 2WHIA 1L5PA 1NYQA 4HDOA 3U4EG 2ZNVC 1ZXIA 2KWCA 4OZCA 3QA8A 3A4SC 2BYEA 2WXPA 5JHBA 4GLSC 2DWQA 1WYGA 2W82A 1ISNA 3DVNV 2JPHA 2G45B 2XEWA 2RPQA 4LNKA 4ACFA 3RD2A 2M17A 2D11A 3PVLA 2WXRA 1HTQA 4KSKC 2M0XA 1OFFA 2WDTB 3SHQA 1QLBB 2MBBB 2LGXA 1XCQL 3L54A 5E6OA 2BB6A 2Y5BB 3RNEC 2JVCA 3AE9B 4PS7A 4FBJB 2D2QA 3ZGZA 3CSFA 1JALA 2LGSA 1YN5A 1WZ3A 4I6NB 2KT7A 3AV8A 4P1CC 1OTRB 2QCZA 4JX1C 2IZVB 2WXJA 5IKCM 2LD9A 3PTFC 1Q5WB 2EMSA 3HM6X 4W9HA 2LUEA 1HTOA 1EUVB 5GXGB 4WWNA 1E90A 2L1AA 1E10A 1QOGA 2KYWA 3VH4B 3VHTC 3W5VB 2LMCA 3N1YC 3VUXA 1WGRA 3RMKC 5G2NA 1WGKA 3NS1A 1N5WA 3UF8A 4W9GA 3DWMA 2MJEA 4M8NA 2ACZB 3NUHB 1WXAA 3U30A 3EUB2 5CHWA 2KFKA 1TBEA 4BZAA 2UU7A 3JSVB 2B76B 2NTTA 2AL6A 5FR6A 2RR9A 4PK1A 3Q8FA 2LFIA 1ESFA 3AXCA 3WCQA 3U52E 2D3BA 1SB3C 3HVDA 4ANUA 1CK1A 3ZVVA 2GBNA 1YD8U 5LXHA 1E8ZA 5CTRC 3S2AA 4G50A 2LVPA 4RCOA 3QWZB 3SDLC 3SFEB 2LHEA 3VTUA 3RFZB 4LK0M 4GIVA 1T3QA 1N63A 1WJUA 2ZVNA 2LJ5A 4P7IA 2V1YA 1OGWA 4US8A 3M3JA 4BKTA 1GJZA 2N7JA 4ZRJA 3SEBA 1E8YA 1SE2A 3C8YA 2G9HD 3AU4A 3QX1A 4MM3B 3BIID 2REXA 1UUPA 4ASWC 1XQQA 2WGSA 2BTEA 2LUMA 4MSQB 1S1QB 4XGAB 4L2YA 2KTRA 2QSDA 3CWIA 5HI1A 4TQ1A 1JMLA 5T8IA 2KN5A 2NMQA 2L05A 4D2KA 4AWJA 1JRUA 3ENEA 1XO3A 3MHZA 1VZ6A 1Z5SB 4HKZE 4IWQA 2ZCBA 5AUKA 3ZJVA 5TR5A 4K81A 2IY1B 3GE8C 4FLHA 2V3NA 3IAM1 2KC1A 3L13A 2XBBC 2QJLA 1WE6A 4DXAB 3ZW3A 2QILA 1KFYB 4LNFA 2ZJDA 5IAAC 3CIRB 1CJEA 1SE3A 1NENB 3PZ7A 4PYZA 4HRSA 2JRIB 2WU2B 3I3TB 3EC8A 2J42A 2N9KA 1HXYD 1IGDA 4KSLC 3NG0A 1N5XA 1OQQA 3E56A 4M0WA 4IW0A 2KTFA 1M4VA 4FJYA 1YJJA 4XX5A 1JWSD 2JX5A 4F7ZA 1A70A 3Q3FA 2IGGA 4NNJB 4KVGB 1WWTA 1FIQA 1OQRA 3PS6A 3ZRCA 2AQ3B 3C0RB 1J0GA 2FCMA 4M8MA 5CHVC 2BF8B 1L7YA 3IVFA 1D5XC 5FK9C 3P1MA 1WGDA 3U2SC 4AS1A 1FEHA 1WH3A 4G3XB 1R4MI 3MC8A 2CJNA 2EELA 2DENB 1GPXA 3U7ZA 2MSED 2OJRA 3ZNZB 2DYMA 3PT2B 3ZXVA 2PW9A 2DYOA 4KZCA 1YN4A 2LGDA 3A33B 4GDKA 1KM7A 1F2RI 2QDFA 4DHZB 2L32A 3H7PB 4RGOS 2WP9B 4A6QA 3KYDD 3KYCD 1WIAA 2PVOD 4EFOA 3DVGX 2OOBB 2MEKA 2C7MB 2W55A 4YXDB 1WMHB 1FFUA 1GUAB 1OQYA 3UQBA 2FCSA 4HDQA 1UBQA 1AWDA 1EU3A 5BO4B 3UGBB 3ZLZA 4EEWA 1J8CA 1V80A 1D4BA 2INPE 4L1BA 1PFDA 2M8SA 4YTNB 1MHXA 5AZGA 3T8MA 3NOBA 2BYFA 5EE1A 2A5UA 3RZFA 1XD3B 1WGGA 2FCNA 1F1HA 2KX3A 3TIXA 1AYFA 1R4NB 2K8HA 2WQYB 3WAPA 3ZJTA 2K25A 4ZYSA 4PT5A 1LGRA 3MC0B 3Q8CA 5GMVA 2KDEB 4XDDA 4MM3A 1PGXA 2GRIA 4Q2JA 2FUG1 1V49A 3AEAB 4WAFA 2PEAA 1LM8B 1P0RA 2KDFB 1NI2A 2ASQA 2K1FA 1T0YA 1E8XA 3JSVA 2KTRB 1ZDVA 2K22A 3GS2A 1V8CA 1R4NI 3ETRA 1DOYA 4IKGA 1WRDB 1WXVA 2KFJA 4B9KA 4A90A 2IBIB 2K8CA 3Q6BA 4YWGG 4P6VF 1F52A 1FPYA 4GDLA 4OZAA 5EE9A 4MACA 1WYWB 2OEDA 1Y8RC 4FA6A 3AB5A 3V3XA 5D3IB 4M0WB 1D5MC 2IYDB 4LNIA 3ZIMA 1WF9A 1WX9A 3DWGC 2AWTA 2MHJA 1UWMA 4LTUA 1R7SA 1TJEA 1E7VA 3ONSA 4FHJA 2L83A 4JPSA 2H89B 3LYYA 2E6XA 3HVZA 4EZLA 3NVZA 1VR9A 1YOVB 1V2YA 4N9F4 1V5OA 4WQOB 1SE9A 3TCAA 4HPLB 3QARA 2M1MA 2G3QB 2MCNB 2JRHA 1TZOA 2LWPA 2MW5A 2IGHA 5KHQA 2KK8A 3RNCC 4FADA 5JXVA 3URYA 1J19A 3DHHC 3NS8A 1KLVA 1JWAD 2FAZA 4O1NA 4US9A 1YIWA 5DPSA 3A4RA 4A20A 3I63C 1YMHE 4XC2A 2PKOA 5H8YE 2GI9A 3KH0A 4MELA 1P7FA 1EF5A 1RWSA 1P1AA 2Z0EB 3I9V1 2JYTA 1C3TA 4KIKB 2FIDA 1TS5A 1XT9B 2LRWA 2ZW1A 4BVUC 2RD0A 4TKNA 2D5GA 4ARCA 2G4SA 1SIJA 2MBHA 1GC7A 2W54A 1SEBD 2LVOA 2SEBD 4XZ4A 3WALA 1TZ1A 3ZTDA 3OWEB 3GP7A 2K6QA 3VAWA 5CX3A 1EF1A 3TEZA 3TJPA 2KVZA 3IXSA 1JW9D 1TYGB 3ZXRA 4KKJA 4OZBA 3FILB 3AEDB 1QOFA 4TV3A 2L0TA 4NJ7A 1YQ3B 3SFDB 3PRMB 4ZRIA 4HKQA 2IPKD 4JWUC 1G6JA 3NZSA 3V61A 1XXGA 4RGNA 1XLQA 1XLPA 3TEXA 4K3CA 1MVKA 2DZKA 1FFVA 1P7EA 2KO3A 5DPTA 3HRDD 2E3TA 3IT6B 1N61A 3N1ZC 4FHKA 4DDGD 1X1MA 4GGQA 3T3OA 3PHWB 4J3OD 3O13A 3KLSX 2O2VB 4YTPB 5AZFA 3LB8C 3L16A 1WJNA 3DBLB 1ZE3D 3KUDB 2N7EA 4GU2A 3M63B 2GBRA 2VZKB 4EE2A 3VDZA 1EU4A 3QAQA 4W9EA 4M00A 3LDZE 2Y3AA 1Q1OA 3EGRA 2RPVA 2L76A 2ZZPB 3ECIA 4W9JA 1Q0WB 2L7RA 3APDA 3AECB 3AE1B 1BXTA 2ZW0A 2MBOA 3ABVB 4XYCA 1ZXHA 3PRZA 2BPSA 3PGEA 4LJPB 1WY8A 5C23A 1VD2A 4K3BA 2KJRA 2LRUA 1I4XA 2BKFA 1FD6A 1UF0A 3EA6A 4HK2A 4HCNB 1NEKB 2WXKA 1NDDA 1K52A 1V1PA 4W9FA 3GZNB 3M62B 1NVID 1F0ZA 3R2TA 3V6CB 3KUCB 3Q8BA 2TSSA 3IHPC 3AEGB 3FAHA 3QK0A 1JWUD 2KNBA 3NY5A 2KQ7A 1YX6B 2XK5B 3H9DA 2I1JA 3DVNU 2BYTA 1WGHA 2MP2A 5IN7A 2KC2A 3PLVA 4DDID 2O6VB 2NBWB 4UDUC 2K3UA 1WSPA 1ZDXA 1SXTA 1V81A 3DDCB 1KRHA 1TKGA 1LFDA 4FULA 4C4VB 3A9JB 1N62A 2CU1A 1TGZB 2WDVB 3FILA 2M0AA 4MSMB 3W1SC 2O6VD 2NBVB 2HDEA 3SD5A 3Q3JA 4NZLB 4YSYB 3K9PB 1E7PB 4WH4A 4GXBA 1PDXA 1WRIA 4HEA1 1J7CA 1VLBA 5D94A 3GZNI 4A9AA 4C56C 4KIKA 4W9LA 1PGAA 1FNWA 3ZJUA 3IG3A 2IO2B 4G11A 3TUOA 5TSSA 4W9DA 1QZEA 2KJ6A 3BVMA 1GC6A 4NY0A 3VTVA 1HE8A 2C9WB 3W1YA 3B08A 2AQ1B 1TTNA 3W9CB 4BKSD 4A3PA 5D7GA 3ZNHB 1JWBD 2ZVOA 4MGIE 3BZDB 1VDVA 1L0VB 5BYRA 1I4QA 4LNOA 1XEEA 4K7WA 2KAJA 2V4IB 3HM3A 1KF6B 4DHJD 5IP4D 1L4DB 1FXTB 4DXFA 1PGBA 1LO5D 3PSEB 1T6BX 2JUOA 3NVYA 2QIEB 3KUZA 3V60A 4DXGA 4CYEA 1H8CA 2PLPA 2LZ6A 2DAJA 3TL5A 1V6EA 2WDQB 4IWPA 1T5XD 3HIZA 5C3JB 4BKGA 3UIOB 3DBHI 2EMTA 2HTME 2AX5A 4ZHOA 2C5LC 1MFWA 4DK5A 1UWXA 1I42A 3I57A 4HCPB 3IT4B 2KMAA 2M19A 3B2FA 3T3NA 4JQWC 1OEYJ 3PZ8A 1XLNA 4F1SA 5JH5C 1I4PA 2KWDA 2JZZA 1DGJA 3DCGA 3JYUA 1WJ6A 2N7DA 2GBMA 4RM9A 1E8WA 1QOBA 1YQBA 1SF0A 2FBWB 1RFKA 2O6VA 2C7HA 2KMCA 4N58A 4BKSA 3OAWA 2RMMA 4KGRA 4NAWA 2G1EA 3OG5A 2XNAC 1L6VA 3ZO5B 3U8ZA 4CHKA 1XF5L 3OJ4B 4NQKE 4OVVA 4FJVB 4K7UA 3IFWB 2X8XX 1WFYA 3EFUA 2KXJA 1K8RB 1E0ZA 2OHFA 4JGHB 2PTLA 3H1UA 4DQOC 4EOYA 4M01A 4EUTA 2LGYA 2V3SA 4GB9A 2KFKB 1D6EC 3NHEB 1WR1A 1MPEA 3ZDTA 2MLBA 3N32A 3TEYA 3ZKJC 2ON8A 2JXTA 2KX0A 3HK0A 1ZPSA 1K53A 4EKUA 4A8XC 2GB1A 2KWVB 5J17A 3UINB 1UBIA 3VUWA 4L23A 3MTNB 2JSVX 2G4DB 2WXQA 1P98A 2WYQA 3KWLA 4MGYE 4MGZE 4WQMA 4H2AA 4MT5A 4ZRQA 3RNGC 3LXFA 1V1PB 4FN2A 5LLIA 1HA5A 3DBSA 2C7NB 2QMTA 1TS2A 2WXNA 4C4VA 2PE9A 2XK5A 5G5GA 5IO9A 1WM3A 1L2NA 3FC4A 1UH6A 1TT5B 1WI0A 4P1BC 3UQAA 2J0MA 4KX6B 3RYTA 2UWQA 3EECA 1MJDA 2DYBA 2L3ZA 4HJGE 3RNFC 3PRPB 2KD0A 1I4GA 3DBHB 3P4RB
chains in the Genus database with same CATH topology
1EWYC 2MH7A 3W2DA 3ZGZA 4YSZB 2KDMA 1FRDA 2WNMA 1JALA 1K51A 1TZOA 1YN5A 2PIAA 2IGHA 1YQ4B 3AV8A 4WURA 2MJDA 5JXVA 3URYA 3P4QB 4KGSA 2WU5B 1HQRD 1JWAD 4O1NA 4US9A 1SSNA 4JX1C 3BVGA 3HUIA 3VR9B 2WXJA 1YMHE 2PKOA 5H8YE 2GI9A 1P7FA 4B0EA 2RDGA 3BYTB 5E6JA 1RWSA 5GXGB 2WS3B 4RGTA 2L1AA 3I9V1 1E10A 2JYTA 1QOGA 3VRAB 1D5ZC 1KTKA 3W5VB 1DOIA 1TS5A 4NAWB 2LMCA 1FNUA 2ZW1A 5HG2A 2WDRB 4WIPA 1L0YB 1WGKA 2D5GA 2SAKA 4ARCA 5BYQA 3NS1A 4FXCA 1N5WA 1SIJA 3DWMA 2MJEA 2W54A 1SEBD 2ACZB 2SEBD 1KH0A 2YEPB 3NUHB 1Y56A 1C77A 1GOZA 3B2GA 3EUB2 3GB1A 3W1SA 1QF6A 5LNK1 3OWEB 1HEZE 1VZ7A 3GP7A 3RPFC 1FCCC 4USAA 1MHHE 3R8BA 1KLUD 3TEZA 2KACA 1QQRA 3IXSA 2B76B 2NTTA 3NRZA 1JW9D 4IOIE 1TYGB 2BBCA 1FXAA 4KKJA 1ET6A 3Q8FA 1TY0A 2LFIA 4OZBA 3FILB 1ESFA 3WCQA 4N59A 3AEDB 1QOFA 3U52E 1SB3C 2DBYA 3HVDA 1YQ3B 3SFDB 2W3RA 1VRAB 3PO0A 1CK1A 1ZOYB 2IPKD 3MP9A 3P4PB 4JWUC 4XWTA 2I2YA 5AUIA 4HKQA 2J52A 1DOXA 1YJIA 4OVZA 1XXGA 5EE0A 4MH8A 1HZ6A 1E6EB 4NAMA 4RCOA 4RGNA 1XLQA 1XLPA 2BS4B 3L4PA 3TEXA 2W3SA 1MVKA 3SFEB 2LHEA 1FFVA 1F77A 1P7EA 3RFZB 4LK0M 1UGJA 1T3QA 1N63A 3HRDD 2E3TA 3IT6B 4ZOHC 1N61A 1QOAA 4YT0B 2WXIA 4US8A 1CQVA 2KN4A 3SR6A 2N7JA 2PVGC 2Y5PA 3SEBA 3T3OA 3P42A 4J3OD 3O13A 1KLGD 2Q5WD 3KLSX 3TSSA 3AEBB 4YTPB 1SE2A 1EWCA 1TS4A 2IJ0A 2JYEA 3LB8C 3C8YA 2G9HD 2R61A 2KMMA 1ZE3D 1IBXB 2N0SB 1GB1A 4MM3B 3VQIA 4RNAA 1N60A 3BIID 1NYRA 1UUPA 3TEWA 2VZKB 4EE2A 4C7ZA 2MJ3A 1EU4A 2BTEA 2LUMA 3AE5B 3NVVA 3AE8B 1DYQA 2Y3AA 1UNSA 3EGRA 1JWMD 5BYSA 2RPVA 1EM7A 2YEPF 4L2YA 3AN1A 2QSDA 1JCKB 2K9XA 1PYWD 3CWIA 5HI1A 3AECB 3AE1B 2IGDA 4TQ1A 1JMLA 5BMGA 1BXTA 2ZW0A 5T8IA 2NMQA 4WWMA 3ABVB 2JZPA 3IAS1 4D2KA 1ZXHA 2JU6X 1RYJA 2JQRB 3MHZA 1XO3A 1ET9A 2PMVA 1AW7A 1VZ6A 1Q10A 1L6UA 4HKZE 1I4XA 1ENFA 3AE2B 3ZJVA 5AUKA 1FD6A 4IDIA 4RGMA 5HFYA 3EA6A 3AE7B 1NEKB 2WXKA 3ZQ4A 2V3NA 1QILA 3IAM1 1K52A 4LLGM 1V1PA 4P16A 2QJLA 1NVID 1F0ZA 1C76A 1STEA 5D3DA 3R2TA 1WXQA 3R2IA 3Q8BA 2TSSA 3MFGA 3AEGB 3FAHA 2LHDA 2AQ2B 1ACCA 1JWUD 2QILA 2ONQA 1KFYB 2Y5CA 1F2RC 3CIRB 1CJEA 2H88B 4GDLB 1JQ4A 4TSSA 2BYTA 1SE3A 1NENB 3PZ7A 1FMAD 2LEKA 4HRSA 4A55A 2WU2B 2J42A 2WXOA 4RFBA 4UDUC 5G5HA 2K3UA 2N9KA 1HXYD 1IGDA 1WSPA 1ZDXA 1SXTA 4N6EB 1N5XA 1KRHA 1OQQA 1SJED 4XE0A 1TKGA 3E56A 4M0WA 3P63A 1M4VA 1N62A 1YJJA 2WDVB 3FILA 2M0AA 1HZ5A 4JE3B 1JWSD 2WXHA 1NI3A 2JX5A 2HDEA 3E9SA 1A70A 4NZLB 1FCLA 2IGGA 4YTMB 3BVZA 4YSYB 3VR8B 1WWTA 1FIQA 1E7PB 2WXMA 4WH4A 1PDXA 1WRIA 4HEA1 1OQRA 2JWUA 1C78A 1J7CA 1TKYA 1VLBA 2FE8A 1I4RA 4A9AA 4C56C 1CZPA 4CQNA 4JWSC 2AQ3B 1TKEA 1BUIC 1C9FA 4TQ0A 5H92C 1PGAA 4ARIA 1FNWA 3ZJUA 1AN8A 2BS3B 2LJIA 2WXFA 3TUOA 4XDCA 2J4XA 5TSSA 3BVMA 3J9CA 2ICIA 1D5XC 5FK9C 3P1MA 1MI0A 2Z8LA 1TY2A 3U2SC 4AS1A 2NTSA 2AQ1B 1BMLC 1J7BA 1FEHA 4ZRPA 3W9CB 5D7GA 3BYYB 1JWBD 1C4PA 1SJHD 2CJNA 3ZYYX 3AEFB 2EELA 1GPXA 1J7AA 3U7ZA 1B9RA 3BZDB 1VDVA 3MJ5A 2V3PA 1L0VB 5BYRA 4OHJA 1I4QA 1XEEA 2DYMA 2K0PA 2KAJA 2V4IB 4B0MA 2V0GA 5I4DA 1IGCA 2VZKD 1GB4A 1TS3A 2PW9A 4C7YA 2KQ4X 1KF6B 1SE4A 1YNTE 2DYOA 1YN4A 3N9YC 4OW0A 1L4DB 2BB5A 4DXFA 1F2RI 1PGBA 1LO5D 2CU3A 1V97A 5EE3A 1T6BX 2L32A 3NVYA 4RF1A 5FKAC 2QIEB 4DXGA 4RGOS 1ZUD2 2WP9B 2BT6A 3VRBB 4A6QA 1GAQB 2PLPA 2PVOD 3AE3B 1JROA 2WDQB 1T5XD 2MEKA 2W55A 5C3JB 4YXDB 1FFUA 2HTME 2AX5A 3NZ3A 1QKZA 5BMHA 1L0XB 1K50A 4REZA 4ZHOA 2J53A 1UWXA 3Q69A 3I57A 1AWDA 2I38A 1EU3A 3IT4B 2M19A 3B2FA 3T3NA 1SBBB 3PZ8A 1XLNA 1D4BA 1I4PA 2KWDA 2INPE 1FNVA 4L1BA 3BK1A 1PFDA 2L52A 4AQ7A 2IDYA 4YTNB 1DGJA 1MHXA 1V1OA 4ITKA 1L4ZB 2BW2A 5EE1A 1QOBA 2WXLA 2X38A 1SF0A 1YN3A 2FBWB 1RFKA 2CJOA 2RDHA 2XN9C 4N58A 2RMMA 4KGRA 3V05A 2G1EA 5HHDG 1XCTL 5FR3A 3AE4B 2XNAC 1AYFA 1VJKA 1L6VA 2WQYB 1XF5L 3ZJTA 2DLBA 3H8HA 4ZYSA 4PT5A 2M56B 3MC0B 1RM6C 3Q8CA 4XDDA 1E0ZA 3Q8AA 1PGXA 2GRIA 1C4CA 4Q2JA 2OHFA 2FUG1 2PTLA 4DQOC 3AEAB 4NJCA 4WAFA 2WLBA 1I4HA 3UI3A 1D6EC 3KWVA 1MPEA 4ZHPA 1PUTA 1VZ8A 3AE6B 5BMIA 1XLOA 4HROA 1C4AA 3BK2A 3AEEB 3KQ4A 3TEYA 1ZDVA 2ON8A 2JXTA 2K22A 3GS2A 3Q8EA 1V8CA 1ZPSA 4C80A 1K53A 3AM9A 4A8XC 2GB1A 3AMZA 3ETRA 4IKGA 1JRPA 4KGTA 1DOYA 1C79A 4A90A 1QT9A 2QEJC 1FO4A 1FRRA 4L23A 1I7HA 4YWGG 3W5UB 1L5PA 1NYQA 2JSVX 4P6VF 1IUEA 4OZAA 2WXQA 5C2TB 3U4EG 4RH6A 5EE9A 1ZXIA 3BWUD 3KWLA 4MACA 4RF0A 2LGIA 1E9MA 4OZCA 4WQMA 4R3DA 4H2AA 4MT5A 4ZRQA 2WXPA 3LXFA 2WXGA 1V1PB 2OEDA 3AB5A 3V3XA 4GLSC 2DWQA 1FM0D 3NVWA 1WYGA 5D3IB 1HA5A 2W82A 4KKIA 2N9LA 1D5MC 2QMTA 4XWWA 1TS2A 2WXNA 3DWGC 2EKIA 2INNE 2K5PA 4GDKB 5G5GA 1UWMA 3FC4A 4LTUA 4YSXB 1R7SA 1IBXA 1TJEA 4KX6B 2WXRA 1B1ZA 1ROEA 1OFFA 2BS2B 1QLBB 1ZP0B 4HJGE 2L83A 4JPSA 4TMAB 1XCQL 2H89B 3B9JA 5MPOA 3LYYA 3P4SB 2BB6A 2E6XA 1I4GA 3AH7A 3HVZA 3P4RB 1FXIA 3NVZA 1VR9A 3AE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCL A;  2IGG A;  2KDM A;  4WH4 A;  1IBX B;  1GB1 A;  2RMM A;  1K51 A;  4KGR A;  2JWU A;  2IGH A;  5HHD G;  1XCT L;  5JXV A;  1XF5 L;  4KGS A;  2LUM A;  1C9F A;  2RPV A;  1EM7 A;  1PGA A;  1YMH E;  1PGX A;  2GI9 A;  1P7F A;  2QSD A;  2PTL A;  5HI1 A;  2IGD A;  1JML A;  5BMG A;  2ZW0 A;  2NMQ A;  1MI0 A;  2JZP A;  4D2K A;  1ZXH A;  3UI3 A;  2JU6 X;  2ZW1 A;  1MPE A;  5HG2 A;  5BMI A;  1Q10 A;  2EEL A;  2ON8 A;  2JXT A;  4HKZ E;  1K53 A;  2GB1 A;  1FD6 A;  4IKG A;  5HFY A;  4KGT A;  2K0P A;  1KH0 A;  1IGC A;  1GB4 A;  2PW9 A;  1K52 A;  3GB1 A;  2KQ4 X;  1YNT E;  2JSV X;  1HEZ E;  4OZA A;  1FCC C;  1MHH E;  1F2R I;  1PGB A;  4MAC A;  2KAC A;  2LHD A;  2LGI A;  4OZC A;  2ONQ A;  4IOI E;  2PLP A;  1F2R C;  2OED A;  3V3X A;  4OZB A;  4GLS C;  3FIL B;  2N9L A;  2QMT A;  3MP9 A;  2I2Y A;  1QKZ A;  5BMH A;  2J52 A;  1K50 A;  1HZ6 A;  2J53 A;  1UWX A;  1IBX A;  2N9K A;  1IGD A;  2I38 A;  1MVK A;  2LHE A;  1P7E A;  1D4B A;  4HJG E;  2KWD A;  2KN4 A;  1XCQ L;  3FIL A;  2N7J A;  1HZ5 A;  1MHX A; 
#chains in the Genus database with same CATH topology
 2D07 B;  1EWY C;  1YJ1 A;  4BOZ B;  3WA0 A;  2MH7 A;  4EZK A;  2DZI A;  4OVU A;  1YQ4 B;  4WJP A;  4GOC A;  4HXD A;  3WIM A;  3MJW A;  1SSN A;  3BVG A;  3HUI A;  3N1X C;  3QJZ A;  4B0E A;  2N9P C;  3BYT B;  4J6I A;  4MDK E;  4IM3 A;  1ZW7 A;  4MJS B;  2WX1 A;  3GE3 C;  1KTK A;  3B1L X;  3A1Q A;  1DOI A;  4NAW B;  1FNU A;  2N9E B;  2WDR B;  1L0Y B;  5KHO A;  2SAK A;  2GMI C;  4HPM B;  2Z59 B;  3AUL A;  5BYQ A;  3H7P A;  3R3M A;  2KQS A;  1KH0 A;  2QC8 A;  2YEP B;  3L0W B;  1Y56 A;  1C77 A;  2CR5 A;  3B2G A;  3W1S A;  1QF6 A;  3OLM D;  3RPF C;  1MHH E;  2KKC A;  3RZW C;  3PLU A;  4JIO U;  3NRZ A;  4IOI E;  2BBC A;  1NBF C;  1ET6 A;  3A9J A;  2KDB A;  1TY0 A;  4N59 A;  2V9H A;  2DBY A;  2VRR B;  3PO0 A;  1ZOY B;  3MP9 A;  3QCA A;  4XWT A;  5AUI A;  2GOW A;  2J52 A;  5EE0 A;  3VXW A;  4MH8 A;  1E6E B;  4WWO A;  2BS4 B;  3L4P A;  3QIJ A;  2IO3 B;  2NVU I;  5C1Z A;  3NJT A;  2BQQ A;  2MBE A;  4ZOH C;  3SU8 X;  4E74 A;  1CQV A;  2KN4 A;  2ZPY A;  2JZ3 B;  2PVG C;  2Y5P A;  1KLG D;  2Q5W D;  4BFR A;  3AEB B;  1EWC A;  4BBN F;  2AYO B;  1GG3 A;  4M02 A;  3CMM B;  1IBX B;  2N0S B;  4RNA A;  4LDT B;  3TEW A;  2MJ3 A;  3UIP B;  1V9J A;  3NVV A;  3AE8 B;  5BYS A;  4WWP A;  1EM7 A;  2A4Z A;  2YEP F;  3PZD A;  3L08 A;  1JCK B;  4KZ0 A;  5G55 A;  2IGD A;  2B3A A;  5BMG A;  2ZCC A;  2JZP A;  4ANW A;  1T0S C;  2INC C;  1WZ0 A;  3PHX B;  1RYJ A;  1RFA A;  2JQR B;  2YVC A;  2PMV A;  1ET9 A;  4AJW A;  3MHS D;  1D3Z A;  5D6J B;  1ENF A;  3AE2 B;  5HFY A;  2MX2 A;  3ZRF A;  3AE7 B;  3ZQ4 A;  3ML9 A;  1QIL A;  2KJH B;  2GLS A;  5D3D A;  1I35 A;  1WXQ A;  4URK A;  3MFG A;  3RT3 B;  1ACC A;  3DBL I;  4KDL B;  4ZDV A;  4LJO B;  1F2R C;  5AEK B;  2WWZ A;  1C1Y B;  3AU5 A;  1FMA D;  2LEK A;  1UD7 A;  2IO1 B;  4A55 A;  2Z0D B;  3PRE A;  3X23 A;  4WJO A;  2LVQ A;  5IA7 A;  4RFB A;  5G5H A;  1E7U A;  1WJ4 A;  1SJE D;  2VH2 A;  3P63 A;  2LAS A;  2N9X A;  4C00 A;  3K9O B;  3Q3M C;  4X57 B;  1HZ5 A;  2NPT A;  4JE3 B;  4A3O A;  2WXH A;  2KDI A;  3E9S A;  1FCL A;  2KOX A;  2L0F A;  3BVZ A;  1SGH A;  3VR8 B;  2WXM A;  1Z2M A;  4TUU A;  2J7Q B;  5AZH A;  2LI5 A;  3O65 B;  1TKY A;  2FE8 A;  4CQN A;  4JWS C;  1TKE A;  1BUI C;  2I1K A;  3VH3 B;  4ARI A;  4QAY A;  1WE7 A;  1AN8 A;  2BS3 B;  2LJI A;  1OEY A;  4MH0 E;  3J9C A;  2ICI A;  3A9K B;  1MI0 A;  1TY2 A;  1BML C;  1J7B A;  4GMV A;  1C4P A;  3ZYY X;  3AEF B;  1J7A A;  1B9R A;  2V3P A;  3BY4 B;  1GNU A;  2MQJ A;  3KVF B;  3A1Q B;  2K0P A;  4B0M A;  3TMP B;  2V0G A;  3U7D A;  3EHV A;  5I4D A;  1IGC A;  1TS3 A;  3TBL D;  2KQ4 X;  1SE4 A;  3N9Y C;  4OW0 A;  2BB5 A;  2CU3 A;  1V97 A;  4G0N B;  2RSU A;  3VRB B;  3V6E B;  3EFC A;  3AE3 B;  3ZUN A;  3H6N A;  5LXI B;  2JWZ A;  3PPA A;  4IWO A;  1QKZ A;  1L0X B;  4REZ A;  2DX5 B;  1R4M B;  5L95 C;  1EO6 A;  3C19 A;  4AP4 C;  1UGM A;  4NQL B;  1FNV A;  2L52 A;  4AQ7 A;  1L4Z B;  2BW2 A;  2WXL A;  2X38 A;  1BT0 A;  2W9N A;  2N4F A;  2RDH A;  2XN9 C;  4CO7 A;  3X0W A;  4AOF A;  3RI7 C;  3V05 A;  1XCT L;  5FR3 A;  3B0A A;  1V86 A;  2MWS B;  2DLB A;  2D10 A;  2M56 B;  2PPH A;  3DBR I;  3WAM A;  1RM6 C;  4PS8 A;  2DHZ A;  1MG8 A;  4WJN A;  1T0Q C;  5J2R A;  4NJC A;  4GN1 A;  2WLB A;  3KWV A;  4ZHP A;  3AE6 B;  1XLO A;  3DBR B;  1C4A A;  3AEE B;  2HJ8 A;  1UZX B;  3Q8E A;  4K1R B;  3ZNI D;  4E71 A;  1WM2 A;  4KGT A;  3HHM A;  1QT9 A;  2OJW A;  1FO4 A;  3W5U B;  2ZPN A;  1IUE A;  3FKY A;  5C2T B;  4II2 B;  2HJ1 A;  4RH6 A;  3BWU D;  1TIF A;  2UYZ B;  2AEH A;  4RF0 A;  2LGI A;  1E9M A;  2KLG A;  4GSW A;  3R66 C;  4R3D A;  4JLC A;  3JW0 X;  2WXG A;  2CHX A;  4IC7 B;  3QQ8 B;  4AUQ C;  1FM0 D;  3NVW A;  4KKI A;  2N9L A;  4XWW A;  2GBJ A;  2DZJ A;  2EKI A;  2INN E;  2K5P A;  4GDK B;  3N30 A;  4YSX B;  1IBX A;  2PE6 B;  1B1Z A;  1ROE A;  2HTH A;  2MP2 B;  2BS2 B;  1ZP0 B;  3NZU A;  1YX5 B;  4WJQ A;  4TMA B;  3B9J A;  5MPO A;  3VVW B;  2CHW A;  3P4S B;  5JHA A;  3AH7 A;  4E3C A;  1FXI A;  1WMH A;  1WX8 A;  2KAN A;  4BAX A;  3W2D A;  3RNB C;  2QHO A;  2KDM A;  4YSZ B;  1FRD A;  4NJ6 A;  2WNM A;  4RMA A;  2RDB C;  5DPR A;  3LJ3 A;  2LXA A;  1K51 A;  4HLE A;  2DAF A;  2M4N A;  2PIA A;  2KHW B;  2N1W A;  2EKE C;  4WUR A;  2MJD A;  3A9K A;  2AL3 A;  3P4Q B;  4LDT D;  4KGS A;  2WU5 B;  3RUL A;  1HQR D;  2D3C A;  5JZE B;  3IBE A;  1AAR A;  3RNA C;  3MC9 A;  3VR9 B;  4S0R A;  3L10 B;  2RDG A;  3P2B A;  5E6J A;  2NR2 A;  2WS3 B;  2R2Q A;  4RGT A;  3VRA B;  1D5Z C;  2GBK A;  5L83 A;  5HG2 A;  4W9I A;  1H4R A;  4W9K A;  4WIP A;  5EDS A;  2JF5 A;  4FXC A;  4HJK A;  1A5R A;  1IP9 A;  2N1V A;  4PS3 A;  1WXM A;  2HE7 A;  1GOZ A;  3GB1 A;  5LNK 1;  1HEZ E;  1VZ7 A;  1FCC C;  1RRB A;  4USA A;  3R8B A;  1KLU D;  4B6W A;  2DNF A;  1PQS A;  2KAC A;  1QQR A;  2BYV E;  1FXA A;  3WAN A;  4S17 A;  1VCB A;  4YL8 A;  2NPT B;  5DCN A;  3V62 A;  2W3R A;  1VRA B;  3P4P B;  2I2Y A;  1P9D U;  1T0R C;  4IM2 A;  1DOX A;  1YJI A;  3APC A;  4OVZ A;  4F8C B;  3VTW A;  3DHG C;  1HZ6 A;  4NAM A;  3VUY A;  2W3S A;  2D3G A;  3CST A;  3QC8 B;  1F77 A;  1UGJ A;  4W9C A;  3KW5 B;  1QOA A;  4YT0 B;  2WXI A;  3T9L A;  4ANX A;  3SR6 A;  2KWU B;  2YLM A;  3P42 A;  3TSS A;  2BKR B;  2IJ0 A;  1TS4 A;  2JYE A;  2R61 A;  1KOT A;  2K39 A;  4DWF A;  2KMM A;  1GB1 A;  4BOS C;  2V4L A;  3VQI A;  5J18 A;  1N60 A;  1NYR A;  4ZYN A;  4C7Z A;  4AJY B;  3DPD A;  3AE5 B;  1DYQ A;  1UNS A;  1JWM D;  2PJH A;  3AN1 A;  5HKH A;  3Q14 C;  3GOE A;  2K9X A;  1PYW D;  3DVG Y;  4WWM A;  3WAO A;  3IAS 1;  2JU6 X;  3AI5 A;  1AW7 A;  1Q10 A;  1L6U A;  1WXS A;  2K6D B;  2J0K A;  2JT4 B;  2FIF A;  4IDI A;  2KZR A;  4RGM A;  3I5J C;  1V5T A;  1LXD A;  4LLG M;  4P16 A;  1S3S G;  3D32 A;  3RCZ A;  1C76 A;  1STE A;  3R2I A;  5E6P A;  4EZJ A;  3H7S A;  2LHD A;  4IM0 A;  2AQ2 B;  2LXC A;  4I6P A;  4NPN A;  2MRP A;  2ONQ A;  1ZGU B;  2Y5C A;  3ML8 A;  3DHI C;  4HVB A;  2H88 B;  2RGF A;  4GDL B;  1JQ4 A;  5D2M B;  2JXX A;  4TSS A;  2BWF A;  2NCN A;  2WXO A;  3ALB A;  2KVR A;  4N6E B;  4LCD E;  4XE0 A;  2IY0 B;  4ICV A;  2ZEQ A;  4MGK E;  1NI3 A;  4II3 B;  3ZTC A;  1IPG A;  4YTM B;  1WX7 A;  1IYF A;  1N6Z A;  2C60 A;  2JWU A;  1C78 A;  2MBQ A;  3ZDM C;  4MJS A;  1I4R A;  1CMX B;  1CZP A;  4HWI B;  3ZNG C;  3APF A;  4BBN C;  4TQ0 A;  5DPW A;  5H92 C;  1C9F A;  3M95 A;  3DQV A;  2O2V A;  4B95 A;  2WXF A;  2R2O A;  4XDC A;  2J4X A;  4MEM A;  1LQB A;  2Z8L A;  2FUH B;  2IND C;  3L17 A;  4KDI C;  1E5W A;  2NTS A;  1ZKH A;  2IO0 B;  4ZRP A;  3BYY B;  1SJH D;  1RLF A;  2VH1 A;  3MJ5 A;  1U4A A;  2BVC A;  4OHJ A;  1RAX A;  3R7R A;  1KJT A;  2CS4 A;  1M94 A;  2DZM A;  1UEL A;  2VZK D;  3RUI B;  1GB4 A;  4C7Y A;  1YNT E;  2KLC A;  3QHT A;  5EE3 A;  5FKA C;  4RF1 A;  1ZUD 2;  4LNN A;  2BT6 A;  2L8J A;  4DHZ E;  1GAQ B;  5IOI A;  1JRO A;  3N20 C;  3DOW A;  1MG4 A;  3Q2A C;  5CHF A;  3Q3N C;  3N3K B;  4ANV A;  2MA9 B;  3NZ3 A;  5BMH A;  2CHZ A;  1K50 A;  2J0J A;  4IG7 B;  2J53 A;  3Q69 A;  2I38 A;  2L00 B;  2D3A A;  1SBB B;  2CKH B;  4PYU A;  3VFK A;  2NS5 A;  4HPP A;  2BGF A;  4JL9 A;  3Q3O C;  3BK1 A;  5E6N A;  2K8B A;  2BWE S;  2IDY A;  4ZRK A;  1V1O A;  4ITK A;  3OJ3 A;  2WX0 A;  1F9J A;  1YN3 A;  2CJO A;  3PV1 A;  3BIN A;  4WAA A;  2ZNV B;  4I6L B;  4FJZ A;  1SIF A;  3CF6 E;  5HHD G;  3AE4 B;  1WR6 E;  3R7Q A;  1VJK A;  4DBG A;  1WGY A;  4KV2 A;  2FNJ B;  3H8H A;  2FCQ A;  3Q8A A;  4IUM B;  1C4C A;  1P3Q U;  2HD5 B;  4ICU A;  1I4H A;  3JVZ X;  3UI3 A;  1PUT A;  1VZ8 A;  5BMI A;  4HRO A;  3BK2 A;  3KQ4 A;  2NBU A;  4C80 A;  3AM9 A;  3AMZ A;  4DHJ B;  1JRP A;  4RM8 A;  1C79 A;  2JY6 A;  2QEJ C;  4K7S A;  3RN9 C;  1FRR A;  1I7H A;  2WHI A;  1L5P A;  1NYQ A;  4HDO A;  3U4E G;  2ZNV C;  1ZXI A;  2KWC A;  4OZC A;  3QA8 A;  3A4S C;  2BYE A;  2WXP A;  5JHB A;  4GLS C;  2DWQ A;  1WYG A;  2W82 A;  1ISN A;  3DVN V;  2JPH A;  2G45 B;  2XEW A;  2RPQ A;  4LNK A;  4ACF A;  3RD2 A;  2M17 A;  2D11 A;  3PVL A;  2WXR A;  1HTQ A;  4KSK C;  2M0X A;  1OFF A;  2WDT B;  3SHQ A;  1QLB B;  2MBB B;  2LGX A;  1XCQ L;  3L54 A;  5E6O A;  2BB6 A;  2Y5B B;  3RNE C;  2JVC A;  3AE9 B;  4PS7 A;  4FBJ B;  2D2Q A;  3ZGZ A;  3CSF A;  1JAL A;  2LGS A;  1YN5 A;  1WZ3 A;  4I6N B;  2KT7 A;  3AV8 A;  4P1C C;  1OTR B;  2QCZ A;  4JX1 C;  2IZV B;  2WXJ A;  5IKC M;  2LD9 A;  3PTF C;  1Q5W B;  2EMS A;  3HM6 X;  4W9H A;  2LUE A;  1HTO A;  1EUV B;  5GXG B;  4WWN A;  1E90 A;  2L1A A;  1E10 A;  1QOG A;  2KYW A;  3VH4 B;  3VHT C;  3W5V B;  2LMC A;  3N1Y C;  3VUX A;  1WGR A;  3RMK C;  5G2N A;  1WGK A;  3NS1 A;  1N5W A;  3UF8 A;  4W9G A;  3DWM A;  2MJE A;  4M8N A;  2ACZ B;  3NUH B;  1WXA A;  3U30 A;  3EUB 2;  5CHW A;  2KFK A;  1TBE A;  4BZA A;  2UU7 A;  3JSV B;  2B76 B;  2NTT A;  2AL6 A;  5FR6 A;  2RR9 A;  4PK1 A;  3Q8F A;  2LFI A;  1ESF A;  3AXC A;  3WCQ A;  3U52 E;  2D3B A;  1SB3 C;  3HVD A;  4ANU A;  1CK1 A;  3ZVV A;  2GBN A;  1YD8 U;  5LXH A;  1E8Z A;  5CTR C;  3S2A A;  4G50 A;  2LVP A;  4RCO A;  3QWZ B;  3SDL C;  3SFE B;  2LHE A;  3VTU A;  3RFZ B;  4LK0 M;  4GIV A;  1T3Q A;  1N63 A;  1WJU A;  2ZVN A;  2LJ5 A;  4P7I A;  2V1Y A;  1OGW A;  4US8 A;  3M3J A;  4BKT A;  1GJZ A;  2N7J A;  4ZRJ A;  3SEB A;  1E8Y A;  1SE2 A;  3C8Y A;  2G9H D;  3AU4 A;  3QX1 A;  4MM3 B;  3BII D;  2REX A;  1UUP A;  4ASW C;  1XQQ A;  2WGS A;  2BTE A;  2LUM A;  4MSQ B;  1S1Q B;  4XGA B;  4L2Y A;  2KTR A;  2QSD A;  3CWI A;  5HI1 A;  4TQ1 A;  1JML A;  5T8I A;  2KN5 A;  2NMQ A;  2L05 A;  4D2K A;  4AWJ A;  1JRU A;  3ENE A;  1XO3 A;  3MHZ A;  1VZ6 A;  1Z5S B;  4HKZ E;  4IWQ A;  2ZCB A;  5AUK A;  3ZJV A;  5TR5 A;  4K81 A;  2IY1 B;  3GE8 C;  4FLH A;  2V3N A;  3IAM 1;  2KC1 A;  3L13 A;  2XBB C;  2QJL A;  1WE6 A;  4DXA B;  3ZW3 A;  2QIL A;  1KFY B;  4LNF A;  2ZJD A;  5IAA C;  3CIR B;  1CJE A;  1SE3 A;  1NEN B;  3PZ7 A;  4PYZ A;  4HRS A;  2JRI B;  2WU2 B;  3I3T B;  3EC8 A;  2J42 A;  2N9K A;  1HXY D;  1IGD A;  4KSL C;  3NG0 A;  1N5X A;  1OQQ A;  3E56 A;  4M0W A;  4IW0 A;  2KTF A;  1M4V A;  4FJY A;  1YJJ A;  4XX5 A;  1JWS D;  2JX5 A;  4F7Z A;  1A70 A;  3Q3F A;  2IGG A;  4NNJ B;  4KVG B;  1WWT A;  1FIQ A;  1OQR A;  3PS6 A;  3ZRC A;  2AQ3 B;  3C0R B;  1J0G A;  2FCM A;  4M8M A;  5CHV C;  2BF8 B;  1L7Y A;  3IVF A;  1D5X C;  5FK9 C;  3P1M A;  1WGD A;  3U2S C;  4AS1 A;  1FEH A;  1WH3 A;  4G3X B;  1R4M I;  3MC8 A;  2CJN A;  2EEL A;  2DEN B;  1GPX A;  3U7Z A;  2MSE D;  2OJR A;  3ZNZ B;  2DYM A;  3PT2 B;  3ZXV A;  2PW9 A;  2DYO A;  4KZC A;  1YN4 A;  2LGD A;  3A33 B;  4GDK A;  1KM7 A;  1F2R I;  2QDF A;  4DHZ B;  2L32 A;  3H7P B;  4RGO S;  2WP9 B;  4A6Q A;  3KYD D;  3KYC D;  1WIA A;  2PVO D;  4EFO A;  3DVG X;  2OOB B;  2MEK A;  2C7M B;  2W55 A;  4YXD B;  1WMH B;  1FFU A;  1GUA B;  1OQY A;  3UQB A;  2FCS A;  4HDQ A;  1UBQ A;  1AWD A;  1EU3 A;  5BO4 B;  3UGB B;  3ZLZ A;  4EEW A;  1J8C A;  1V80 A;  1D4B A;  2INP E;  4L1B A;  1PFD A;  2M8S A;  4YTN B;  1MHX A;  5AZG A;  3T8M A;  3NOB A;  2BYF A;  5EE1 A;  2A5U A;  3RZF A;  1XD3 B;  1WGG A;  2FCN A;  1F1H A;  2KX3 A;  3TIX A;  1AYF A;  1R4N B;  2K8H A;  2WQY B;  3WAP A;  3ZJT A;  2K25 A;  4ZYS A;  4PT5 A;  1LGR A;  3MC0 B;  3Q8C A;  5GMV A;  2KDE B;  4XDD A;  4MM3 A;  1PGX A;  2GRI A;  4Q2J A;  2FUG 1;  1V49 A;  3AEA B;  4WAF A;  2PEA A;  1LM8 B;  1P0R A;  2KDF B;  1NI2 A;  2ASQ A;  2K1F A;  1T0Y A;  1E8X A;  3JSV A;  2KTR B;  1ZDV A;  2K22 A;  3GS2 A;  1V8C A;  1R4N I;  3ETR A;  1DOY A;  4IKG A;  1WRD B;  1WXV A;  2KFJ A;  4B9K A;  4A90 A;  2IBI B;  2K8C A;  3Q6B A;  4YWG G;  4P6V F;  1F52 A;  1FPY A;  4GDL A;  4OZA A;  5EE9 A;  4MAC A;  1WYW B;  2OED A;  1Y8R C;  4FA6 A;  3AB5 A;  3V3X A;  5D3I B;  4M0W B;  1D5M C;  2IYD B;  4LNI A;  3ZIM A;  1WF9 A;  1WX9 A;  3DWG C;  2AWT A;  2MHJ A;  1UWM A;  4LTU A;  1R7S A;  1TJE A;  1E7V A;  3ONS A;  4FHJ A;  2L83 A;  4JPS A;  2H89 B;  3LYY A;  2E6X A;  3HVZ A;  4EZL A;  3NVZ A;  1VR9 A;  1YOV B;  1V2Y A;  4N9F 4;  1V5O A;  4WQO B;  1SE9 A;  3TCA A;  4HPL B;  3QAR A;  2M1M A;  2G3Q B;  2MCN B;  2JRH A;  1TZO A;  2LWP A;  2MW5 A;  2IGH A;  5KHQ A;  2KK8 A;  3RNC C;  4FAD A;  5JXV A;  3URY A;  1J19 A;  3DHH C;  3NS8 A;  1KLV A;  1JWA D;  2FAZ A;  4O1N A;  4US9 A;  1YIW A;  5DPS A;  3A4R A;  4A20 A;  3I63 C;  1YMH E;  4XC2 A;  2PKO A;  5H8Y E;  2GI9 A;  3KH0 A;  4MEL A;  1P7F A;  1EF5 A;  1RWS A;  1P1A A;  2Z0E B;  3I9V 1;  2JYT A;  1C3T A;  4KIK B;  2FID A;  1TS5 A;  1XT9 B;  2LRW A;  2ZW1 A;  4BVU C;  2RD0 A;  4TKN A;  2D5G A;  4ARC A;  2G4S A;  1SIJ A;  2MBH A;  1GC7 A;  2W54 A;  1SEB D;  2LVO A;  2SEB D;  4XZ4 A;  3WAL A;  1TZ1 A;  3ZTD A;  3OWE B;  3GP7 A;  2K6Q A;  3VAW A;  5CX3 A;  1EF1 A;  3TEZ A;  3TJP A;  2KVZ A;  3IXS A;  1JW9 D;  1TYG B;  3ZXR A;  4KKJ A;  4OZB A;  3FIL B;  3AED B;  1QOF A;  4TV3 A;  2L0T A;  4NJ7 A;  1YQ3 B;  3SFD B;  3PRM B;  4ZRI A;  4HKQ A;  2IPK D;  4JWU C;  1G6J A;  3NZS A;  3V61 A;  1XXG A;  4RGN A;  1XLQ A;  1XLP A;  3TEX A;  4K3C A;  1MVK A;  2DZK A;  1FFV A;  1P7E A;  2KO3 A;  5DPT A;  3HRD D;  2E3T A;  3IT6 B;  1N61 A;  3N1Z C;  4FHK A;  4DDG D;  1X1M A;  4GGQ A;  3T3O A;  3PHW B;  4J3O D;  3O13 A;  3KLS X;  2O2V B;  4YTP B;  5AZF A;  3LB8 C;  3L16 A;  1WJN A;  3DBL B;  1ZE3 D;  3KUD B;  2N7E A;  4GU2 A;  3M63 B;  2GBR A;  2VZK B;  4EE2 A;  3VDZ A;  1EU4 A;  3QAQ A;  4W9E A;  4M00 A;  3LDZ E;  2Y3A A;  1Q1O A;  3EGR A;  2RPV A;  2L76 A;  2ZZP B;  3ECI A;  4W9J A;  1Q0W B;  2L7R A;  3APD A;  3AEC B;  3AE1 B;  1BXT A;  2ZW0 A;  2MBO A;  3ABV B;  4XYC A;  1ZXH A;  3PRZ A;  2BPS A;  3PGE A;  4LJP B;  1WY8 A;  5C23 A;  1VD2 A;  4K3B A;  2KJR A;  2LRU A;  1I4X A;  2BKF A;  1FD6 A;  1UF0 A;  3EA6 A;  4HK2 A;  4HCN B;  1NEK B;  2WXK A;  1NDD A;  1K52 A;  1V1P A;  4W9F A;  3GZN B;  3M62 B;  1NVI D;  1F0Z A;  3R2T A;  3V6C B;  3KUC B;  3Q8B A;  2TSS A;  3IHP C;  3AEG B;  3FAH A;  3QK0 A;  1JWU D;  2KNB A;  3NY5 A;  2KQ7 A;  1YX6 B;  2XK5 B;  3H9D A;  2I1J A;  3DVN U;  2BYT A;  1WGH A;  2MP2 A;  5IN7 A;  2KC2 A;  3PLV A;  4DDI D;  2O6V B;  2NBW B;  4UDU C;  2K3U A;  1WSP A;  1ZDX A;  1SXT A;  1V81 A;  3DDC B;  1KRH A;  1TKG A;  1LFD A;  4FUL A;  4C4V B;  3A9J B;  1N62 A;  2CU1 A;  1TGZ B;  2WDV B;  3FIL A;  2M0A A;  4MSM B;  3W1S C;  2O6V D;  2NBV B;  2HDE A;  3SD5 A;  3Q3J A;  4NZL B;  4YSY B;  3K9P B;  1E7P B;  4WH4 A;  4GXB A;  1PDX A;  1WRI A;  4HEA 1;  1J7C A;  1VLB A;  5D94 A;  3GZN I;  4A9A A;  4C56 C;  4KIK A;  4W9L A;  1PGA A;  1FNW A;  3ZJU A;  3IG3 A;  2IO2 B;  4G11 A;  3TUO A;  5TSS A;  4W9D A;  1QZE A;  2KJ6 A;  3BVM A;  1GC6 A;  4NY0 A;  3VTV A;  1HE8 A;  2C9W B;  3W1Y A;  3B08 A;  2AQ1 B;  1TTN A;  3W9C B;  4BKS D;  4A3P A;  5D7G A;  3ZNH B;  1JWB D;  2ZVO A;  4MGI E;  3BZD B;  1VDV A;  1L0V B;  5BYR A;  1I4Q A;  4LNO A;  1XEE A;  4K7W A;  2KAJ A;  2V4I B;  3HM3 A;  1KF6 B;  4DHJ D;  5IP4 D;  1L4D B;  1FXT B;  4DXF A;  1PGB A;  1LO5 D;  3PSE B;  1T6B X;  2JUO A;  3NVY A;  2QIE B;  3KUZ A;  3V60 A;  4DXG A;  4CYE A;  1H8C A;  2PLP A;  2LZ6 A;  2DAJ A;  3TL5 A;  1V6E A;  2WDQ B;  4IWP A;  1T5X D;  3HIZ A;  5C3J B;  4BKG A;  3UIO B;  3DBH I;  2EMT A;  2HTM E;  2AX5 A;  4ZHO A;  2C5L C;  1MFW A;  4DK5 A;  1UWX A;  1I42 A;  3I57 A;  4HCP B;  3IT4 B;  2KMA A;  2M19 A;  3B2F A;  3T3N A;  4JQW C;  1OEY J;  3PZ8 A;  1XLN A;  4F1S A;  5JH5 C;  1I4P A;  2KWD A;  2JZZ A;  1DGJ A;  3DCG A;  3JYU A;  1WJ6 A;  2N7D A;  2GBM A;  4RM9 A;  1E8W A;  1QOB A;  1YQB A;  1SF0 A;  2FBW B;  1RFK A;  2O6V A;  2C7H A;  2KMC A;  4N58 A;  4BKS A;  3OAW A;  2RMM A;  4KGR A;  4NAW A;  2G1E A;  3OG5 A;  2XNA C;  1L6V A;  3ZO5 B;  3U8Z A;  4CHK A;  1XF5 L;  3OJ4 B;  4NQK E;  4OVV A;  4FJV B;  4K7U A;  3IFW B;  2X8X X;  1WFY A;  3EFU A;  2KXJ A;  1K8R B;  1E0Z A;  2OHF A;  4JGH B;  2PTL A;  3H1U A;  4DQO C;  4EOY A;  4M01 A;  4EUT A;  2LGY A;  2V3S A;  4GB9 A;  2KFK B;  1D6E C;  3NHE B;  1WR1 A;  1MPE A;  3ZDT A;  2MLB A;  3N32 A;  3TEY A;  3ZKJ C;  2ON8 A;  2JXT A;  2KX0 A;  3HK0 A;  1ZPS A;  1K53 A;  4EKU A;  4A8X C;  2GB1 A;  2KWV B;  5J17 A;  3UIN B;  1UBI A;  3VUW A;  4L23 A;  3MTN B;  2JSV X;  2G4D B;  2WXQ A;  1P98 A;  2WYQ A;  3KWL A;  4MGY E;  4MGZ E;  4WQM A;  4H2A A;  4MT5 A;  4ZRQ A;  3RNG C;  3LXF A;  1V1P B;  4FN2 A;  5LLI A;  1HA5 A;  3DBS A;  2C7N B;  2QMT A;  1TS2 A;  2WXN A;  4C4V A;  2PE9 A;  2XK5 A;  5G5G A;  5IO9 A;  1WM3 A;  1L2N A;  3FC4 A;  1UH6 A;  1TT5 B;  1WI0 A;  4P1B C;  3UQA A;  2J0M A;  4KX6 B;  3RYT A;  2UWQ A;  3EEC A;  1MJD A;  2DYB A;  2L3Z A;  4HJG E;  3RNF C;  3PRP B;  2KD0 A;  1I4G A;  3DBH B;  3P4R B; 
#chains in the Genus database with same CATH homology
 1EWY C;  2MH7 A;  3W2D A;  3ZGZ A;  4YSZ B;  2KDM A;  1FRD A;  2WNM A;  1JAL A;  1K51 A;  1TZO A;  1YN5 A;  2PIA A;  2IGH A;  1YQ4 B;  3AV8 A;  4WUR A;  2MJD A;  5JXV A;  3URY A;  3P4Q B;  4KGS A;  2WU5 B;  1HQR D;  1JWA D;  4O1N A;  4US9 A;  1SSN A;  4JX1 C;  3BVG A;  3HUI A;  3VR9 B;  2WXJ A;  1YMH E;  2PKO A;  5H8Y E;  2GI9 A;  1P7F A;  4B0E A;  2RDG A;  3BYT B;  5E6J A;  1RWS A;  5GXG B;  2WS3 B;  4RGT A;  2L1A A;  3I9V 1;  1E10 A;  2JYT A;  1QOG A;  3VRA B;  1D5Z C;  1KTK A;  3W5V B;  1DOI A;  1TS5 A;  4NAW B;  2LMC A;  1FNU A;  2ZW1 A;  5HG2 A;  2WDR B;  4WIP A;  1L0Y B;  1WGK A;  2D5G A;  2SAK A;  4ARC A;  5BYQ A;  3NS1 A;  4FXC A;  1N5W A;  1SIJ A;  3DWM A;  2MJE A;  2W54 A;  1SEB D;  2ACZ B;  2SEB D;  1KH0 A;  2YEP B;  3NUH B;  1Y56 A;  1C77 A;  1GOZ A;  3B2G A;  3EUB 2;  3GB1 A;  3W1S A;  1QF6 A;  5LNK 1;  3OWE B;  1HEZ E;  1VZ7 A;  3GP7 A;  3RPF C;  1FCC C;  4USA A;  1MHH E;  3R8B A;  1KLU D;  3TEZ A;  2KAC A;  1QQR A;  3IXS A;  2B76 B;  2NTT A;  3NRZ A;  1JW9 D;  4IOI E;  1TYG B;  2BBC A;  1FXA A;  4KKJ A;  1ET6 A;  3Q8F A;  1TY0 A;  2LFI A;  4OZB A;  3FIL B;  1ESF A;  3WCQ A;  4N59 A;  3AED B;  1QOF A;  3U52 E;  1SB3 C;  2DBY A;  3HVD A;  1YQ3 B;  3SFD B;  2W3R A;  1VRA B;  3PO0 A;  1CK1 A;  1ZOY B;  2IPK D;  3MP9 A;  3P4P B;  4JWU C;  4XWT A;  2I2Y A;  5AUI A;  4HKQ A;  2J52 A;  1DOX A;  1YJI A;  4OVZ A;  1XXG A;  5EE0 A;  4MH8 A;  1HZ6 A;  1E6E B;  4NAM A;  4RCO A;  4RGN A;  1XLQ A;  1XLP A;  2BS4 B;  3L4P A;  3TEX A;  2W3S A;  1MVK A;  3SFE B;  2LHE A;  1FFV A;  1F77 A;  1P7E A;  3RFZ B;  4LK0 M;  1UGJ A;  1T3Q A;  1N63 A;  3HRD D;  2E3T A;  3IT6 B;  4ZOH C;  1N61 A;  1QOA A;  4YT0 B;  2WXI A;  4US8 A;  1CQV A;  2KN4 A;  3SR6 A;  2N7J A;  2PVG C;  2Y5P A;  3SEB A;  3T3O A;  3P42 A;  4J3O D;  3O13 A;  1KLG D;  2Q5W D;  3KLS X;  3TSS A;  3AEB B;  4YTP B;  1SE2 A;  1EWC A;  1TS4 A;  2IJ0 A;  2JYE A;  3LB8 C;  3C8Y A;  2G9H D;  2R61 A;  2KMM A;  1ZE3 D;  1IBX B;  2N0S B;  1GB1 A;  4MM3 B;  3VQI A;  4RNA A;  1N60 A;  3BII D;  1NYR A;  1UUP A;  3TEW A;  2VZK B;  4EE2 A;  4C7Z A;  2MJ3 A;  1EU4 A;  2BTE A;  2LUM A;  3AE5 B;  3NVV A;  3AE8 B;  1DYQ A;  2Y3A A;  1UNS A;  3EGR A;  1JWM D;  5BYS A;  2RPV A;  1EM7 A;  2YEP F;  4L2Y A;  3AN1 A;  2QSD A;  1JCK B;  2K9X A;  1PYW D;  3CWI A;  5HI1 A;  3AEC B;  3AE1 B;  2IGD A;  4TQ1 A;  1JML A;  5BMG A;  1BXT A;  2ZW0 A;  5T8I A;  2NMQ A;  4WWM A;  3ABV B;  2JZP A;  3IAS 1;  4D2K A;  1ZXH A;  2JU6 X;  1RYJ A;  2JQR B;  3MHZ A;  1XO3 A;  1ET9 A;  2PMV A;  1AW7 A;  1VZ6 A;  1Q10 A;  1L6U A;  4HKZ E;  1I4X A;  1ENF A;  3AE2 B;  3ZJV A;  5AUK A;  1FD6 A;  4IDI A;  4RGM A;  5HFY A;  3EA6 A;  3AE7 B;  1NEK B;  2WXK A;  3ZQ4 A;  2V3N A;  1QIL A;  3IAM 1;  1K52 A;  4LLG M;  1V1P A;  4P16 A;  2QJL A;  1NVI D;  1F0Z A;  1C76 A;  1STE A;  5D3D A;  3R2T A;  1WXQ A;  3R2I A;  3Q8B A;  2TSS A;  3MFG A;  3AEG B;  3FAH A;  2LHD A;  2AQ2 B;  1ACC A;  1JWU D;  2QIL A;  2ONQ A;  1KFY B;  2Y5C A;  1F2R C;  3CIR B;  1CJE A;  2H88 B;  4GDL B;  1JQ4 A;  4TSS A;  2BYT A;  1SE3 A;  1NEN B;  3PZ7 A;  1FMA D;  2LEK A;  4HRS A;  4A55 A;  2WU2 B;  2J42 A;  2WXO A;  4RFB A;  4UDU C;  5G5H A;  2K3U A;  2N9K A;  1HXY D;  1IGD A;  1WSP A;  1ZDX A;  1SXT A;  4N6E B;  1N5X A;  1KRH A;  1OQQ A;  1SJE D;  4XE0 A;  1TKG A;  3E56 A;  4M0W A;  3P63 A;  1M4V A;  1N62 A;  1YJJ A;  2WDV B;  3FIL A;  2M0A A;  1HZ5 A;  4JE3 B;  1JWS D;  2WXH A;  1NI3 A;  2JX5 A;  2HDE A;  3E9S A;  1A70 A;  4NZL B;  1FCL A;  2IGG A;  4YTM B;  3BVZ A;  4YSY B;  3VR8 B;  1WWT A;  1FIQ A;  1E7P B;  2WXM A;  4WH4 A;  1PDX A;  1WRI A;  4HEA 1;  1OQR A;  2JWU A;  1C78 A;  1J7C A;  1TKY A;  1VLB A;  2FE8 A;  1I4R A;  4A9A A;  4C56 C;  1CZP A;  4CQN A;  4JWS C;  2AQ3 B;  1TKE A;  1BUI C;  1C9F A;  4TQ0 A;  5H92 C;  1PGA A;  4ARI A;  1FNW A;  3ZJU A;  1AN8 A;  2BS3 B;  2LJI A;  2WXF A;  3TUO A;  4XDC A;  2J4X A;  5TSS A;  3BVM A;  3J9C A;  2ICI A;  1D5X C;  5FK9 C;  3P1M A;  1MI0 A;  2Z8L A;  1TY2 A;  3U2S C;  4AS1 A;  2NTS A;  2AQ1 B;  1BML C;  1J7B A;  1FEH A;  4ZRP A;  3W9C B;  5D7G A;  3BYY B;  1JWB D;  1C4P A;  1SJH D;  2CJN A;  3ZYY X;  3AEF B;  2EEL A;  1GPX A;  1J7A A;  3U7Z A;  1B9R A;  3BZD B;  1VDV A;  3MJ5 A;  2V3P A;  1L0V B;  5BYR A;  4OHJ A;  1I4Q A;  1XEE A;  2DYM A;  2K0P A;  2KAJ A;  2V4I B;  4B0M A;  2V0G A;  5I4D A;  1IGC A;  2VZK D;  1GB4 A;  1TS3 A;  2PW9 A;  4C7Y A;  2KQ4 X;  1KF6 B;  1SE4 A;  1YNT E;  2DYO A;  1YN4 A;  3N9Y C;  4OW0 A;  1L4D B;  2BB5 A;  4DXF A;  1F2R I;  1PGB A;  1LO5 D;  2CU3 A;  1V97 A;  5EE3 A;  1T6B X;  2L32 A;  3NVY A;  4RF1 A;  5FKA C;  2QIE B;  4DXG A;  4RGO S;  1ZUD 2;  2WP9 B;  2BT6 A;  3VRB B;  4A6Q A;  1GAQ B;  2PLP A;  2PVO D;  3AE3 B;  1JRO A;  2WDQ B;  1T5X D;  2MEK A;  2W55 A;  5C3J B;  4YXD B;  1FFU A;  2HTM E;  2AX5 A;  3NZ3 A;  1QKZ A;  5BMH A;  1L0X B;  1K50 A;  4REZ A;  4ZHO A;  2J53 A;  1UWX A;  3Q69 A;  3I57 A;  1AWD A;  2I38 A;  1EU3 A;  3IT4 B;  2M19 A;  3B2F A;  3T3N A;  1SBB B;  3PZ8 A;  1XLN A;  1D4B A;  1I4P A;  2KWD A;  2INP E;  1FNV A;  4L1B A;  3BK1 A;  1PFD A;  2L52 A;  4AQ7 A;  2IDY A;  4YTN B;  1DGJ A;  1MHX A;  1V1O A;  4ITK A;  1L4Z B;  2BW2 A;  5EE1 A;  1QOB A;  2WXL A;  2X38 A;  1SF0 A;  1YN3 A;  2FBW B;  1RFK A;  2CJO A;  2RDH A;  2XN9 C;  4N58 A;  2RMM A;  4KGR A;  3V05 A;  2G1E A;  5HHD G;  1XCT L;  5FR3 A;  3AE4 B;  2XNA C;  1AYF A;  1VJK A;  1L6V A;  2WQY B;  1XF5 L;  3ZJT A;  2DLB A;  3H8H A;  4ZYS A;  4PT5 A;  2M56 B;  3MC0 B;  1RM6 C;  3Q8C A;  4XDD A;  1E0Z A;  3Q8A A;  1PGX A;  2GRI A;  1C4C A;  4Q2J A;  2OHF A;  2FUG 1;  2PTL A;  4DQO C;  3AEA B;  4NJC A;  4WAF A;  2WLB A;  1I4H A;  3UI3 A;  1D6E C;  3KWV A;  1MPE A;  4ZHP A;  1PUT A;  1VZ8 A;  3AE6 B;  5BMI A;  1XLO A;  4HRO A;  1C4A A;  3BK2 A;  3AEE B;  3KQ4 A;  3TEY A;  1ZDV A;  2ON8 A;  2JXT A;  2K22 A;  3GS2 A;  3Q8E A;  1V8C A;  1ZPS A;  4C80 A;  1K53 A;  3AM9 A;  4A8X C;  2GB1 A;  3AMZ A;  3ETR A;  4IKG A;  1JRP A;  4KGT A;  1DOY A;  1C79 A;  4A90 A;  1QT9 A;  2QEJ C;  1FO4 A;  1FRR A;  4L23 A;  1I7H A;  4YWG G;  3W5U B;  1L5P A;  1NYQ A;  2JSV X;  4P6V F;  1IUE A;  4OZA A;  2WXQ A;  5C2T B;  3U4E G;  4RH6 A;  5EE9 A;  1ZXI A;  3BWU D;  3KWL A;  4MAC A;  4RF0 A;  2LGI A;  1E9M A;  4OZC A;  4WQM A;  4R3D A;  4H2A A;  4MT5 A;  4ZRQ A;  2WXP A;  3LXF A;  2WXG A;  1V1P B;  2OED A;  3AB5 A;  3V3X A;  4GLS C;  2DWQ A;  1FM0 D;  3NVW A;  1WYG A;  5D3I B;  1HA5 A;  2W82 A;  4KKI A;  2N9L A;  1D5M C;  2QMT A;  4XWW A;  1TS2 A;  2WXN A;  3DWG C;  2EKI A;  2INN E;  2K5P A;  4GDK B;  5G5G A;  1UWM A;  3FC4 A;  4LTU A;  4YSX B;  1R7S A;  1IBX A;  1TJE A;  4KX6 B;  2WXR A;  1B1Z A;  1ROE A;  1OFF A;  2BS2 B;  1QLB B;  1ZP0 B;  4HJG E;  2L83 A;  4JPS A;  4TMA B;  1XCQ L;  2H89 B;  3B9J A;  5MPO A;  3LYY A;  3P4S B;  2BB6 A;  2E6X A;  1I4G A;  3AH7 A;  3HVZ A;  3P4R B;  1FXI A;  3NVZ A;  1VR9 A;  3AE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...