5BMIA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
molecule keywords Immunoglobulin G-binding protein G
molecule tags Immune system
source organism Streptococcus sp. group g
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmiA00
5BMHA 1HZ6A 4OZAA 2PLPA 2KDMA 4D2KA 2ZW0A 2IGHA 2LHEA 1K53A 2ZW1A 1K51A 2OEDA 5BMGA 4KGSA 4HKZE 3UI3A 2EELA 1FCLA 1FD6A 1F2RI 2IGGA 2PW9A 1K52A 2J53A 2QMTA 2GI9A 2KQ4X 5JXVA 2GB1A 1GB4A 1Q10A 1P7EA 4IOIE 2JSVX 4IKGA 1C9FA 2I38A 4GLSC 3GB1A 4KGTA 2JWUA 1EM7A 1IBXA 1GB1A 1XF5L 4WH4A 1XCQL 2NMQA 2I2YA 2RPVA 2IGDA 2JXTA 1IGCA 5HFYA 2LGIA 1HEZE 3V3XA 2RMMA 1F2RC 1KH0A 1MHHE 2N9LA 1JMLA 3FILA 1YNTE 1P7FA 2QSDA 5BMIA 1MVKA 2PTLA 5HHDG 1MPEA 1IBXB 2JZPA 1PGBA 1K50A 2K0PA 2JU6X 2KWDA 4OZCA 1QKZA 3FILB 1MI0A 2LHDA 1UWXA 2LUMA 5HI1A 1FCCC 2ON8A 4KGRA 4OZBA 3MP9A 4MACA 1D4BA 2N7JA 1MHXA 4HJGE 2J52A 1IGDA 1XCTL 2KN4A 2N9KA 5HG2A 1PGAA 2ONQA 1YMHE 1HZ5A 1PGXA 1ZXHA 2KACA
chains in the Genus database with same CATH superfamily
1E8ZA 1HZ6A 3HM6X 3I57A 2C7HA 1E8YA 1SF0A 2WXKA 3B08A 2YEPB 4NZLB 1KLUD 2IO2B 2MJDA 1UBIA 1ACCA 1JWBD 3P4RB 2J0KA 2IZVB 3TJPA 3MJ5A 5D7GA 4A3OA 4ZYNA 1J7BA 2AQ1B 3OG5A 1KLGD 2JUOA 2KZRA 1Q5WB 3ZO5B 3AE2B 2WXHA 5H8YE 2ZVOA 1XO3A 2VH1A 3FAHA 4BKGA 4MT5A 3VH4B 3P63A 2GBJA 4I6PA 4ITKA 5KHQA 1V97A 2KC1A 4HDOA 2JT4B 2MBBB 3B0AA 4ACFA 2CHZA 4NAWB 3APFA 2L3ZA 3URYA 3JW0X 3NY5A 1ZGUB 2BT6A 1TIFA 4US8A 1AW7A 3SD5A 2M56B 3NS8A 2D5GA 2H88B 3AEEB 3N32A 1WYGA 4LJPB 4NJCA 3WAMA 1P1AA 1QKZA 1EWYC 2KNBA 1F9JA 2IDYA 2V4IB 4R3DA 5G2NA 1MI0A 4A9AA 4M8MA 1FCCC 3TEWA 3L16A 2KT7A 1AARA 4QAYA 2L83A 1ET9A 2J4XA 2JRIB 2DWQA 1HE8A 5TR5A 2FCQA 1YOVB 2FBWB 1C76A 4BFRA 2KACA 4OZAA 3W1YA 1PUTA 2O6VA 2HE7A 2BYFA 1F1HA 3DVNV 2MHJA 2C60A 4TV3A 3RNGC 1TKEA 2M0XA 2G3QB 4MDKE 1SIFA 2GOWA 3TMPB 2GB1A 1GB4A 2E3TA 4FA6A 1P7EA 4JE3B 1KM7A 3BK1A 3RN9C 3NS1A 3AECB 3DHGC 2MWSB 5KHOA 2FIFA 2WP9B 1D5XC 2GRIA 2I2YA 1CQVA 1I42A 2DYMA 1VZ6A 4N59A 2MJ3A 4C00A 3W2DA 1L4DB 2OJWA 1C4CA 5AEKB 2KJ6A 4RGMA 2W54A 3FILA 1YNTE 3IT4B 2J0MA 2L00B 2O6VD 2QSDA 3ZLZA 2M8SA 2WLBA 3MC9A 1YX5B 1ZDXA 1WXQA 3M63B 1ZUD2 4IM2A 1IPGA 2LXAA 1TGZB 2MBOA 3EUB2 3UGBB 4AOFA 2KTRA 3A9JA 1BT0A 4KZCA 1WF9A 3ONSA 2VZKB 1TS3A 1G6JA 2BQQA 2MP2A 4HWIB 3ZJVA 1ZOYB 2NR2A 4GN1A 2XN9C 5LXHA 1SGHA 1JWSD 2IJ0A 2Z0DB 2KLCA 1ZE3D 2YEPF 4AP4C 4LLGM 4BOZB 1WXMA 2L8JA 1Z5SB 1GJZA 1NEKB 4E71A 4GIVA 2V3SA 2JYEA 1EU3A 3CMMB 5BMHA 3VUWA 2JY6A 2WXQA 2D2QA 4K3BA 4LNOA 2CHWA 2JYTA 1N5WA 2WXMA 3MJWA 3OWEB 1WY8A 2SAKA 2NPTA 3KW5B 3UF8A 4TUUA 2LFIA 4WAFA 3O13A 1S3SG 4A90A 2GBKA 1T3QA 4J6IA 3BYYB 2JVCA 1FEHA 2JWUA 2JQRB 3AE6B 2PEAA 5BYQA 2GBRA 3KUZA 3V3XA 3AE5B 3WCQA 2PVOD 2IY1B 4P1CC 3Q3NC 2A4ZA 3Q3JA 3ZNGC 4PK1A 2RGFA 2DZIA 1F77A 4ZRIA 3X0WA 2LJ5A 1MPEA 3W1SA 1L0XB 1OQYA 4WURA 4K7SA 1PGBA 3RI7C 3R7QA 1K50A 2KWVB 5E6OA 3UIOB 1YQ4B 2LXCA 2JU6X 1MG4A 2BF8B 4ARIA 4LCDE 2V4LA 3OAWA 1V5TA 2BGFA 5HI1A 3EA6A 2KWCA 1OTRB 2R61A 3RNBC 4A8XC 4OZBA 3HIZA 1KLVA 4S0RA 3V05A 3RPFC 1IGDA 4ZRPA 3AU4A 2FE8A 2WDQB 3RMKC 3AEFB 4L23A 3PGEA 2D11A 1WE6A 1EO6A 2TSSA 3N3KB 2QILA 2NVUI 2SEBD 4W9EA 3NRZA 4C80A 4XGAB 5DPRA 3E56A 4B9KA 2N4FA 3A1QA 2K6QA 2ZPNA 1ROEA 2JPHA 4DQOC 2LGYA 4K7WA 3VTVA 1FCLA 4YSXB 1WSPA 2BYVE 1KTKA 4B95A 4WWPA 3JSVB 2C9WB 3U2SC 3V62A 4NJ7A 2NMQA 4MJSB 3R8BA 2RDHA 3CWIA 4XDCA 1MHHE 2LVQA 3FC4A 1GUAB 3PVLA 1WIAA 1KJTA 2YLMA 2BS4B 2DYBA 1WMHB 1TY0A 1UNSA 1DGJA 2KX3A 2JZ3B 1WX9A 4EOYA 4F7ZA 3BY4B 2BBCA 4C7YA 3U4EG 4UDUC 4ASWC 1N60A 1LXDA 2LGXA 4BAXA 3NVYA 2DLBA 4ANWA 3DBRB 4N9F4 3PRZA 3EGRA 2KANA 4CQNA 3PT2B 1JWAD 2DBYA 3TEYA 3PTFC 2GMIC 2K8BA 4HPPA 5AUKA 4RF0A 1TS2A 1FXIA 2C5LC 4ZHOA 1C1YB 2RPQA 2WXIA 4MSMB 3W9CB 1J7AA 1L7YA 3PHXB 4P16A 3QHTA 3ZGZA 1VD2A 3IVFA 3RNCC 4D2KA 3L17A 4EFOA 3VQIA 2LHEA 2CKHB 3DBLB 4CO7A 3AE1B 4NNJB 2EELA 2J53A 5JXVA 3IXSA 3ZTCA 4DXFA 4IUMB 1CMXB 5G5GA 4DBGA 1FXAA 4KV2A 1P0RA 3CSFA 1JWMD 3ML9A 1JALA 3E9SA 4MJSA 3KLSX 2IGDA 2MEKA 1T0QC 5EE3A 2J42A 2AWTA 1T0YA 2KMAA 1L5PA 4ZRQA 2N1VA 3EFCA 1JMLA 4NQKE 3NZUA 3MC8A 1R4NI 5FR6A 2ZNVC 1TZOA 3FKYA 3AE4B 3LB8C 3AEGB 1XXGA 5EE1A 1YJ1A 1C79A 1TJEA 2N9EB 3ZNHB 2BWES 5MPOA 1ZXIA 2EKEC 1MJDA 3SHQA 3AE7B 4K1RB 1C77A 3J9CA 1WXVA 4KKIA 1PFDA 4N58A 1D5MC 3KH0A 1WJ4A 2EMSA 4KSLC 4FULA 3VUXA 2W55A 4HPLB 2Y3AA 1LO5D 1FRRA 1I7HA 5CX3A 2PPHA 3BINA 2J52A 3N1YC 1C3TA 1SXTA 4DXGA 3QK0A 2K8CA 2N0SB 1YMHE 1NDDA 3AE3B 3A4SC 3AXCA 5HKHA 3TEZA 1FO4A 2UU7A 1PGXA 3P42A 1TY2A 1B9RA 3LYYA 4FJVB 1WXAA 5D2MB 1VJKA 3HRDD 1FM0D 4PS8A 1OFFA 4KDIC 2ZW1A 1FD6A 2HTHA 5J2RA 2GI9A 3KUCB 2G4DB 1ISNA 5DPTA 4KIKA 2KDIA 4MH8A 1LGRA 1N62A 2INCC 3M3JA 1WX8A 4MM3A 1SB3C 2FCNA 3HHMA 1XCQL 3RD2A 5JH5C 2O6VB 1IUEA 2BYTA 4I6LB 2UYZB 4MELA 1FXTB 4II2B 4WJNA 2V9HA 3AU5A 2N9XA 1KH0A 4DXAB 3VXWA 3DCGA 2KTFA 3APCA 5IOIA 1GC6A 1K8RB 1JQ4A 1T0RC 2EMTA 5CHWA 3W5VB 2WU5B 1SE2A 2KDEB 3KUDB 3U8ZA 2OHFA 2FNJB 2WGSA 4LJOB 1WI0A 4RGTA 4W9FA 4G0NB 4LNFA 1P3QU 3FILB 4TQ1A 1UWXA 3NUHB 3VR9B 1YQBA 2Z8LA 2LGSA 1QILA 2BYEA 4A3PA 1RYJA 2RDBC 2KTRB 3A9JB 5IN7A 1BMLC 1Q0WB 2CR5A 2MSED 1TT5B 4LNNA 4AJWA 1HZ5A 2JRHA 3DOWA 2D3CA 4PS3A 1I35A 2MP2B 4IDIA 1NI2A 1ESFA 1SSNA 2KK8A 4RGOS 2MH7A 4REZA 1JROA 1TKGA 4WIPA 2OEDA 5BMGA 2M4NA 4FN2A 3R3MA 1F2RI 2M19A 2CU3A 4NAMA 4XC2A 1XLQA 3LXFA 1E8XA 2BS2B 2KHWB 2K39A 4C7ZA 1XEEA 3PHWB 3B2GA 1C4AA 2MCNB 3SU8X 3SFDB 3ZUNA 3GZNB 3DWGC 2X38A 2DAFA 3DPDA 3PS6A 1OQQA 3IHPC 2FUHB 4KDLB 2LUEA 1AN8A 2NS5A 4WJOA 2NPTB 3AE8B 4M02A 3T3NA 3BVZA 5BMIA 4ZRKA 1NENB 4ICVA 5D3DA 2RR9A 3A4RA 1FMAD 1TKYA 2JWZA 4RGNA 2MRPA 1ZDVA 4PS7A 4WWNA 2PJHA 1TS4A 2XBBC 3JVZX 3VAWA 1L0YB 2NTSA 1V1OA 1I4GA 5G5HA 3B9JA 4KZ0A 2DZJA 3N9YC 2RSUA 3SEBA 3OJ3A 2LVOA 1WR6E 2LHDA 2LUMA 3MFGA 4KGRA 2NBVB 4PYUA 1ZW7A 3S2AA 3KVFB 1FNWA 3CIRB 1XLOA 3T3OA 3AEAB 5EE9A 2G9HD 2CU1A 5HG2A 4G11A 2WU2B 1WH3A 3AEBB 2G45B 3KWVA 1UD7A 1BUIC 2Z59B 3IG3A 2KDMA 1EF1A 4RH6A 2Y5CA 5IAAC 1K53A 4WWOA 4DHZB 3L4PA 3ZNZB 5FR3A 3VDZA 5E6NA 2DAJA 1JRUA 1VDVA 1L2NA 1N63A 3H7PB 4IOIE 4IKGA 2QDFA 3PO0A 4HJKA 2LMCA 4W9DA 3RNFC 4XYCA 4ZOHC 1CK1A 2K1FA 3A1QB 1NBFC 3L10B 2BB5A 1F2RC 1OQRA 3ZXVA 1HTQA 1I4QA 2PKOA 2REXA 3EECA 5CHVC 4BKSA 3R66C 2OOBB 5DPWA 2RD0A 5AZGA 3I63C 3DBHB 4WJQA 2PVGC 4L1BA 3N30A 4JLCA 5LXIB 1QOAA 1XQQA 4J3OD 2MX2A 4A20A 4MH0E 2HD5B 1LM8B 3MC0B 5IA7A 2FIDA 3DDCB 2DZKA 5JHAA 4MGIE 2O2VA 2KJRA 3EFUA 5IKCM 3Q3OC 4OVUA 2NBUA 2XK5A 5C3JB 2K8HA 1YN3A 2Z0EB 3QC8B 4OVVA 4MACA 3RYTA 3QA8A 1OEYA 2BPSA 1UH6A 3I9V1 4HJGE 4BKSD 2WQYB 2N9KA 5CHFA 3W1SC 3DVGY 3P2BA 5EDSA 1PGAA 3R2IA 5T8IA 2LRUA 1E8WA 4CYEA 4BVUC 1XT9B 3SDLC 3U30A 3RFZB 3AV8A 5J17A 4FHKA 2M17A 3KQ4A 4HXDA 3KYDD 4KSKC 1SJED 3Q8FA 2IGHA 3PV1A 3R7RA 4YL8A 1EF5A 2BKFA 1V6EA 2MW5A 1SE4A 4KX6B 3T9LA 1WGYA 3H7PA 4W9KA 1R7SA 1J8CA 1FIQA 2KAJA 3ZKJC 2UWQA 1GNUA 3C8YA 3K9PB 3ETRA 3CSTA 3Q8CA 1UWMA 2RPVA 1NYRA 2ZJDA 3V61A 1UGMA 3N20C 4GOCA 1I4PA 3PZDA 1UF0A 5BYSA 1RFKA 1L4ZB 2K5PA 3RNAC 3DWMA 1P7FA 1FNVA 4PYZA 3GOEA 1A70A 4FBJB 1WJUA 4CHKA 1N61A 2HDEA 3B1LX 1J0GA 4M0WA 5H92C 3BVMA 2LWPA 2AL6A 2WXJA 1XD3B 4FXCA 3ENEA 1P9DU 1GPXA 4AS1A 2WDTB 4YSYB 4MGYE 5BO4B 3K9OB 2NBWB 2MBQA 1I4HA 4RCOA 1V1PA 1NVID 4NJ6A 4OVZA 2HJ1A 1SEBD 2WXPA 5LLIA 4IM0A 4IC7B 3ZJTA 1HQRD 4II3B 1SE9A 3C19A 2J0JA 3PREA 4GDLA 4MEMA 4W9LA 2IY0B 1XCTL 2KN4A 5LNK1 5FK9C 3L08A 2N7EA 4WQOB 2KVRA 2X8XX 3QX1A 2CHXA 3HVDA 1WE7A 4LNKA 1R4MB 3QIJA 2ZCCA 2KDBA 1AYFA 2ZW0A 1KOTA 5E6JA 1WGGA 3PSEB 1EU4A 2WHIA 4ZDVA 4IWPA 3UI3A 1PDXA 2IGGA 5C1ZA 3VHTC 3BVGA 2QMTA 5C2TB 2VRRB 1H8CA 2AQ3B 2ZCBA 1MG8A 2C7NB 4G3XB 2ASQA 2KYWA 3NZSA 5EE0A 2B76B 2FCSA 1WRDB 4P7IA 1DOXA 1XF5L 1YJJA 2V3PA 4ANVA 1IGCA 3U7DA 4AQ7A 1L6VA 2QJLA 1I4XA 4KIKB 1PQSA 4KKJA 2WDVB 2K22A 5I4DA 2D3AA 2PTLA 3ZW3A 2LASA 4DDID 4MM3B 1AWDA 1LFDA 2JZPA 3BIID 1KRHA 1E10A 1JW9D 4TKNA 1J19A 1CJEA 2LVPA 2XEWA 3C0RB 1IYFA 3GE8C 1WYWB 5D3IB 4XWTA 3MTNB 3QJZA 4DHJB 2HTME 2VH2A 2KX0A 2ON8A 3PZ8A 4JL9A 4RF1A 4WQMA 1DOIA 3ZYYX 1E6EB 1FNUA 4A6QA 1NYQA 2ICIA 2AX5A 1WM3A 2NCNA 4MGZE 2WDRB 3NVWA 2ZPYA 2JX5A 2JXXA 3ZDTA 2MQJA 2BWFA 5FKAC 4JX1C 2KQ7A 1V86A 4E3CA 4H2AA 5JHBA 4FLHA 1GAQB 3WANA 2WS3B 2L0FA 2KOXA 4HDQA 2MJEA 5TSSA 3T8MA 3RZFA 2AYOB 2JZZA 3HK0A 1R4NB 4KGSA 3RCZA 4EEWA 4X57B 4EE2A 3U7ZA 2IPKD 5AZFA 2KXJA 3DQVA 4RFBA 4GB9A 4ZYSA 2MBHA 2WXGA 4B0EA 3PLVA 2R2QA 2RDGA 2JSVX 2WXRA 3VRBB 2JF5A 1ZKHA 1EM7A 2PE9A 1IBXA 2LEKA 2N1WA 3UQBA 2MLBA 1HEZE 4GDKB 3EC8A 1Y56A 1T5XD 4ANXA 4XX5A 1T0SC 4NQLB 2WWZA 1FFVA 2KMMA 1QQRA 1C4PA 4JGHB 3WALA 2DNFA 2I1JA 2KFKA 1ZP0B 2DX5B 4PT5A 1YJIA 3QCAA 4OZCA 4FJZA 3RZWC 4M00A 1EUVB 4W9JA 1F52A 1DYQA 3PPAA 1E7PB 3SFEB 3RNEC 2M0AA 2CS4A 4LK0M 3L0WB 2IYDB 1QOGA 1UGJA 2A5UA 4K3CA 1J7CA 2AQ2B 1SBBB 2MBEA 4EZLA 2HJ8A 3WAPA 4C4VB 4AWJA 2G4SA 3DHIC 3APDA 3Q14C 4AJYB 2PLPA 4IG7B 4E74A 4LDTD 1KFYB 1TS5A 4DHJD 1VZ7A 3AE9B 3NVZA 1QF6A 2KFJA 3QQ8B 3IFWB 4FADA 2W3RA 3P1MA 4JQWC 5BYRA 2BW2A 4W9CA 1E7VA 1T6BX 3NJTA 2QHOA 3AI5A 2L0TA 3GE3C 4B6WA 1RRBA 4KGTA 1WFYA 1YN5A 1HA5A 3DBSA 1XLNA 4BBNC 4GDKA 3GZNI 4EKUA 3H8HA 3ZDMC 3BK2A 3SR6A 2IO0B 3WIMA 2D10A 2L1AA 4A55A 1RLFA 2J7QB 4ANUA 1D6EC 2W82A 1RFAA 2BS3B 1HXYD 2ACZB 2LGDA 4EZJA 2LD9A 3O65B 3ABVB 3V6EB 3X23A 3QWZB 4BZAA 1STEA 3Q2AC 3Q8AA 4XZ4A 4HLEA 2K0PA 3Q8EA 1N5XA 2L05A 2V0GA 1M94A 4TMAB 3RT3B 4LTUA 1LQBA 1D5ZC 4OHJA 2PMVA 1V81A 2AL3A 2BB6A 3GS2A 4FHJA 3AULA 4DWFA 2B3AA 4RMAA 2BTEA 1C78A 2N7JA 2ZEQA 4HEA1 2K25A 3I3TB 1DOYA 1E7UA 3OLMD 2KJHB 4C56C 3UINB 2O2VB 4C4VA 3Q6BA 1V8CA 1WM2A 2XK5B 3Q3MC 3Q8BA 4JWUC 2KQSA 3TBLD 3ZTDA 3OJ4B 4USAA 4BBNF 1K51A 3TSSA 1WJ6A 4O1NA 1WX7A 1NI3A 1WZ3A 4GSWA 3ZRFA 4HKZE 2WXNA 1K52A 2KVZA 1QOFA 3AB5A 1UZXB 4K81A 1SE3A 3BYTB 3ALBA 2CJNA 4NAWA 1WGDA 4HKQA 3H7SA 3M95A 3BWUD 3PRPB 2KO3A 1N6ZA 1H4RA 2WX0A 1GB1A 3H9DA 4I6NB 2JXTA 1YN4A 4NY0A 2RMMA 4RNAA 2W3SA 3R2TA 3DHHC 3NZ3A 1V49A 5AUIA 3KWLA 2GBMA 1Z2MA 3NVVA 3QAQA 4ICUA 4US9A 1UUPA 3VUYA 3DBHI 3IAS1 2W9NA 2DHZA 4G50A 3TCAA 4YSZB 3JYUA 5CTRC 5E6PA 2I1KA 3P4QB 4GGQA 1YD8U 1FRDA 1E90A 2L52A 2WXFA 2LJIA 2WYQA 4XE0A 2IO1B 3VVWB 1BXTA 4M0WB 3ML8A 4XWWA 1L6UA 1WR1A 1YX6B 3ZIMA 3TUOA 3UIPB 2KMCA 2QEJC 1YQ3B 5GXGB 3Q69A 3ZJUA 4GXBA 1FPYA 1V1PB 3VFKA 2QC8A 3MHZA 1MFWA 1WWTA 2QCZA 4Q2JA 2MA9B 3N1ZC 1OEYJ 2IBIB 3Q3FA 4KVGB 4DHZE 1A5RA 3IAM1 4W9HA 4GDLB 1QLBB 4N6EB 1RM6C 2G1EA 3HUIA 2GLSA 3PLUA 1VCBA 2KQ4X 1ENFA 4L2YA 3EHVA 1E9MA 3VTUA 1S1QB 2D07B 1ZPSA 1F0ZA 3M62B 1FFUA 4LNIA 2BKRB 1E0ZA 1TBEA 3A33B 3LDZE 5D94A 1PYWD 2XNAC 3H1UA 4ZRJA 3ZXRA 4WAAA 4FJYA 2AEHA 2WNMA 1L0VB 1RWSA 1E5WA 4OW0A 1V2YA 4M8NA 2FAZA 2Y5PA 1WXSA 3P4PB 3MHSD 3B2FA 1QOBA 2KWDA 4F8CB 3L13A 3VR8B 1IP9A 2N9PC 4W9IA 1SIJA 5C23A 2OJRA 1WGHA 1TYGB 3VRAB 4JPSA 2VZKD 2D3GA 5L95C 2LRWA 3WA0A 3U52E 3TIXA 2ONQA 3WAOA 5DPSA 3GP7A 3V60A 2Q5WD 3KYCD 2FCMA 1GOZA 2K6DB 1M4VA 2L7RA 3RUIB 4MSQB 3ZRCA 3DBRI 1P98A 1U4AA 5D6JB 1R4MI 1YIWA 4F1SA 2KD0A 3TL5A 4IM3A 2ZVNA 2PW9A 2R2OA 2ZNVB 4ARCA 1Q10A 3NHEB 5IO9A 4P1BC 4EUTA 4GLSC 2E6XA 2KKCA 4K7UA 3H6NA 2K3UA 3L54A 2KC2A 1XLPA 3AEDB 1VZ8A 1D3ZA 2N7DA 5HFYA 3A9KB 3LJ3A 5AZHA 3RULA 2IO3B 4RM8A 1V5OA 4RM9A 3DBLI 1VLBA 1Q1OA 4MGKE 5G55A 4DDGD 1MVKA 3TEXA 3VTWA 1QZEA 1WGKA 3HM3A 3QARA 5GMVA 1IBXB 1QT9A 1JWUD 1WJNA 1WZ0A 1ET6A 1TTNA 3ZNID 2CJOA 1V80A 4AUQC 4P6VF 2DYOA 3AH7A 2K9XA 1WRIA 2KWUB 1V9JA 3BZDB 4EZKA 1CZPA 3N1XC 4BOSC 3MP9A 4DK5A 4YTPB 4HROA 2PE6B 4NPNA 3I5JC 2L76A 1D4BA 1MHXA 3P4SB 2KFKB 3UQAA 1OGWA 4GMVA 4LDTB 4XDDA 2KLGA 2NTTA 1JCKB 3JSVA 2V1YA 3ECIA 2KN5A 3DVGX 4B0MA 1ZXHA 3AM9A 1TZ1A 3AMZA 3NOBA 4HPMB 2LI5A 1VRAB 4WWMA 2PIAA 1I4RA 4JWSC 1GG3A 2INPE 5DCNA 2WXOA 2YVCA 1SJHD 4HCNB 4S17A 2INDC 1C9FA 1UELA 2I38A 4W9GA 3GB1A 4IWOA 4ZHPA 1WMHA 2QIEB 4YTMB 5L83A 4WH4A 3ZQ4A 4IWQA 3DVNU 4HRSA 2LGIA 3W5UB 3A9KA 3VH3B 4M01A 4BKTA 3D32A 4HVBA 2N9LA 2V3NA 2ZZPB 3PRMB 2WX1A 4TSSA 1WGRA 3IT6B 1Y8RC 2FUG1 1X1MA 5HHDG 1EWCA 4YT0B 1B1ZA 2KDFB 3PZ7A 1VR9A 2M1MA 2Y5BB 1KF6B 3IBEA 2DENB 5J18A 3AN1A 2C7MB 4GU2A 4IW0A 2H89B 3V6CB 4YTNB 4HK2A 2GBNA 4URKA 2INNE 3ZVVA 2EKIA 5IP4D 4WJPA 2LZ6A 4YXDB 2L32A 2WXLA 4HCPB 4JIOU 2D3BA 4YWGG 4TQ0A 1GC7A 3CF6E 1JRPA 1UBQA 3HVZA 3NG0A 2BVCA 5JZEB 1RAXA 1HTOA 2DZMA
chains in the Genus database with same CATH topology
4JWUC 1HZ6A 3I57A 3Q8BA 3AV8A 3RFZB 3KQ4A 1SF0A 2WXKA 4D2KA 1SJED 3Q8FA 3VQIA 2IGHA 4USAA 2LHEA 1K51A 2YEPB 3TSSA 4NZLB 3AE1B 4O1NA 1NI3A 1KLUD 4HKZE 2MJDA 2EELA 2WXNA 1ACCA 1K52A 2J53A 1JWBD 1QOFA 3AB5A 3P4RB 5JXVA 3IXSA 1SE3A 1SE4A 4KX6B 3MJ5A 5D7GA 4DXFA 3BYTB 1R7SA 1J7BA 2AQ1B 1FIQA 1KLGD 2CJNA 2KAJA 4HKQA 5G5GA 1FXAA 3BWUD 3C8YA 1GB1A 1JWMD 3AE2B 3ETRA 2WXHA 1JALA 3E9SA 3Q8CA 5H8YE 1XO3A 1UWMA 2RPVA 3KLSX 2IGDA 1YN4A 1NYRA 2JXTA 2MEKA 3FAHA 4MT5A 2RMMA 4RNAA 5EE3A 2J42A 2W3SA 4ZRQA 1L5PA 3P63A 3R2TA 4ITKA 1I4PA 1JMLA 5BYSA 1V97A 1RFKA 3NZ3A 1L4ZB 2K5PA 3DWMA 1P7FA 1FNVA 5AUIA 3KWLA 1A70A 1TZOA 4NAWB 1N61A 3URYA 2HDEA 3NVVA 3AE4B 4M0WA 3LB8C 3AEGB 1XXGA 5EE1A 4US9A 1C79A 1UUPA 3BVMA 5H92C 1TJEA 3IAS1 2WXJA 2BT6A 5MPOA 4FXCA 4US8A 1AW7A 1GPXA 2M56B 4AS1A 1ZXIA 2D5GA 2H88B 3AEEB 4YSYB 4YSZB 1WYGA 4NJCA 3AE7B 4RCOA 1C77A 1I4HA 1QKZA 1EWYC 1NVID 1V1PA 2IDYA 2V4IB 3J9CA 4KKIA 4OVZA 4R3DA 1MI0A 1PFDA 1SEBD 3P4QB 4A9AA 1FRDA 4N58A 1D5MC 2WXPA 1FCCC 2L52A 2WXFA 2LJIA 4XE0A 3TEWA 3ZJTA 1HQRD 1BXTA 2W55A 2Y3AA 4XWWA 1LO5D 1FRRA 1I7HA 1L6UA 2J52A 1XCTL 2KN4A 5LNK1 2L83A 5FK9C 1ET9A 2J4XA 1SXTA 3TUOA 4DXGA 2DWQA 2FBWB 2QEJC 1YQ3B 5GXGB 3Q69A 2N0SB 1YMHE 3AE3B 3TEZA 1C76A 3ZJUA 1V1PB 1FO4A 3MHZA 1WWTA 1PGXA 3P42A 1TY2A 4Q2JA 2KACA 1B9RA 3HVDA 3LYYA 4OZAA 1PUTA 1VJKA 1AYFA 2ZW0A 3HRDD 5E6JA 1FM0D 3IAM1 1OFFA 2ZW1A 4GDLB 1QLBB 1EU4A 4N6EB 1TKEA 1PDXA 3UI3A 1FD6A 1RM6C 2IGGA 2G1EA 3HUIA 3BVGA 2QMTA 5C2TB 2GI9A 2KQ4X 2GB1A 1ENFA 4L2YA 1GB4A 2AQ3B 2E3TA 1E9MA 1P7EA 4JE3B 4MH8A 3BK1A 1ZPSA 5EE0A 2B76B 3NS1A 1N62A 3AECB 1F0ZA 2WP9B 1SB3C 1DOXA 1D5XC 1XF5L 1FFUA 2GRIA 1XCQL 1YJJA 2V3PA 2I2YA 1CQVA 1IUEA 2DYMA 1IGCA 2BYTA 1VZ6A 4N59A 1E0ZA 2MJ3A 4AQ7A 3W2DA 1KH0A 1L4DB 1C4CA 1L6VA 2QJLA 1PYWD 4RGMA 1I4XA 2W54A 2XNAC 3FILA 1YNTE 3IT4B 4KKJA 2QSDA 2WDVB 2WLBA 2K22A 5I4DA 1ZDXA 2PTLA 1WXQA 1ZUD2 2WNMA 1L0VB 1RWSA 4MM3B 1AWDA 4OW0A 1JQ4A 2JZPA 3BIID 1KRHA 3EUB2 3W5VB 1E10A 1JW9D 2Y5PA 2WU5B 1CJEA 1SE2A 3P4PB 5D3IB 2OHFA 3B2FA 4XWTA 1QOBA 2KWDA 2VZKB 4RGTA 1TS3A 3VR8B 2HTME 3FILB 4TQ1A 1UWXA 3NUHB 2ON8A 1SIJA 3PZ8A 4RF1A 1ZOYB 4WQMA 3VR9B 3ZJVA 1DOIA 3ZYYX 2Z8LA 1E6EB 1FNUA 1TYGB 2XN9C 3VRAB 4JPSA 4A6QA 2VZKD 1JWSD 1QILA 1NYQA 2ICIA 1RYJA 2IJ0A 2AX5A 2WDRB 3NVWA 1ZE3D 2YEPF 4LLGM 3U52E 1BMLC 2JX5A 2ONQA 3GP7A 1NEKB 2Q5WD 1HZ5A 1GOZA 5FKAC 4JX1C 2JYEA 4H2AA 1EU3A 1M4VA 4IDIA 5BMHA 1GAQB 1ESFA 2WS3B 2WXQA 1SSNA 4RGOS 2JYTA 1N5WA 2MH7A 2MJEA 5TSSA 4REZA 1JROA 1TKGA 2WXMA 4WIPA 2OEDA 3OWEB 5BMGA 4KGSA 4EE2A 2SAKA 1F2RI 2M19A 2PW9A 3U7ZA 2IPKD 2CU3A 4NAMA 4ARCA 4RFBA 1XLQA 4ZYSA 1Q10A 3LXFA 2LFIA 4WAFA 2BS2B 2WXGA 4B0EA 4C7ZA 3O13A 4A90A 2RDGA 2JSVX 1XEEA 2WXRA 3B2GA 1C4AA 3VRBB 1T3QA 4GLSC 3BYYB 2E6XA 1FEHA 2JWUA 3SFDB 2K3UA 1EM7A 3DWGC 1IBXA 2JQRB 2LEKA 2X38A 3AE6B 1XLPA 3AEDB 1VZ8A 1OQQA 5BYQA 5HFYA 1HEZE 4GDKB 3V3XA 1AN8A 1Y56A 3AE5B 1T5XD 3AE8B 3T3NA 3WCQA 2PVOD 3BVZA 1VLBA 5BMIA 1MVKA 3TEXA 1WGKA 1NENB 1F77A 1FFVA 5D3DA 2KMMA 1QQRA 1C4PA 1MPEA 1FMAD 1TKYA 1IBXB 4RGNA 3W1SA 1QT9A 1JWUD 1L0XB 1ZDVA 4WURA 1ET6A 1PGBA 1TS4A 2CJOA 1K50A 1ZP0B 1YQ4B 4P6VF 1L0YB 2DYOA 3AH7A 2NTSA 1YJIA 2JU6X 1V1OA 4PT5A 2K9XA 1I4GA 5G5HA 3B9JA 4OZCA 4ARIA 1WRIA 3N9YC 3SEBA 2LHDA 2LUMA 3BZDB 5HI1A 3EA6A 3MFGA 1DYQA 1CZPA 4KGRA 2R61A 4A8XC 1E7PB 3SFEB 4OZBA 3MP9A 1FNWA 3CIRB 2M0AA 1XLOA 4YTPB 4HROA 4LK0M 3T3OA 3AEAB 1D4BA 3V05A 5EE9A 3RPFC 1MHXA 2G9HD 3P4SB 1IGDA 4ZRPA 1QOGA 1UGJA 4XDDA 5HG2A 2WU2B 1J7CA 2AQ2B 1SBBB 2FE8A 3AEBB 2WDQB 2NTTA 3AEFB 4L23A 1JCKB 3KWVA 1BUIC 4B0MA 1ZXHA 2TSSA 3AM9A 2QILA 2PLPA 2SEBD 2KDMA 3AMZA 3NRZA 4C80A 3E56A 4RH6A 2Y5CA 1KFYB 1VRAB 1K53A 1TS5A 4WWMA 1VZ7A 1I4RA 2PIAA 4JWSC 1ROEA 3AE9B 3NVZA 4DQOC 1QF6A 3L4PA 5FR3A 2INPE 1FCLA 2WXOA 2W3RA 3P1MA 4YSXB 1WSPA 1SJHD 1VDVA 5BYRA 1KTKA 1N63A 2BW2A 4IOIE 1T6BX 4IKGA 1C9FA 3PO0A 2I38A 2LMCA 3GB1A 4ZHPA 4KGTA 2QIEB 4YTMB 1YN5A 4ZOHC 1CK1A 3U2SC 1HA5A 4WH4A 2NMQA 3ZQ4A 3R8BA 1XLNA 4HRSA 2RDHA 2LGIA 2BB5A 3CWIA 3W5UB 4XDCA 1F2RC 1OQRA 3H8HA 3BK2A 1MHHE 2N9LA 2V3NA 1I4QA 3SR6A 4TSSA 2PKOA 3IT6B 3FC4A 2L1AA 4A55A 2FUG1 1D6EC 5HHDG 2PVGC 1EWCA 2W82A 4L1BA 4YT0B 2BS4B 1B1ZA 1TY0A 2BS3B 1HXYD 1DGJA 1UNSA 2ACZB 3PZ7A 1VR9A 1QOAA 1KF6B 3ABVB 2BBCA 4J3OD 4C7YA 3AN1A 3U4EG 4UDUC 1STEA 3Q8AA 2K0PA 3Q8EA 1N5XA 2H89B 1N60A 2V0GA 4YTNB 3MC0B 4TMAB 2INNE 2DLBA 2EKIA 3NVYA 4LTUA 1D5ZC 4OHJA 3EGRA 2PMVA 4YXDB 4CQNA 2L32A 2WXLA 2BB6A 1JWAD 3GS2A 2DBYA 3TEYA 5C3JB 1YN3A 4YWGG 2BTEA 5AUKA 4MACA 4RF0A 1C78A 2N7JA 1TS2A 4HEA1 1FXIA 3I9V1 4TQ0A 4HJGE 4ZHOA 2WQYB 2N9KA 1DOYA 1JRPA 2WXIA 3HVZA 1PGAA 3W9CB 4C56C 3R2IA 1J7AA 5T8IA 4P16A 3ZGZA 1V8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMH A;  1HZ6 A;  4OZA A;  2PLP A;  2KDM A;  4D2K A;  2ZW0 A;  2IGH A;  2LHE A;  1K53 A;  2ZW1 A;  1K51 A;  2OED A;  5BMG A;  4KGS A;  4HKZ E;  3UI3 A;  2EEL A;  1FCL A;  1FD6 A;  1F2R I;  2IGG A;  2PW9 A;  1K52 A;  2J53 A;  2QMT A;  2GI9 A;  2KQ4 X;  5JXV A;  2GB1 A;  1GB4 A;  1Q10 A;  1P7E A;  4IOI E;  2JSV X;  4IKG A;  1C9F A;  2I38 A;  4GLS C;  3GB1 A;  4KGT A;  2JWU A;  1EM7 A;  1IBX A;  1GB1 A;  1XF5 L;  4WH4 A;  1XCQ L;  2NMQ A;  2I2Y A;  2RPV A;  2IGD A;  2JXT A;  1IGC A;  5HFY A;  2LGI A;  1HEZ E;  3V3X A;  2RMM A;  1F2R C;  1KH0 A;  1MHH E;  2N9L A;  1JML A;  3FIL A;  1YNT E;  1P7F A;  2QSD A;  5BMI A;  1MVK A;  2PTL A;  5HHD G;  1MPE A;  1IBX B;  2JZP A;  1PGB A;  1K50 A;  2K0P A;  2JU6 X;  2KWD A;  4OZC A;  1QKZ A;  3FIL B;  1MI0 A;  2LHD A;  1UWX A;  2LUM A;  5HI1 A;  1FCC C;  2ON8 A;  4KGR A;  4OZB A;  3MP9 A;  4MAC A;  1D4B A;  2N7J A;  1MHX A;  4HJG E;  2J52 A;  1IGD A;  1XCT L;  2KN4 A;  2N9K A;  5HG2 A;  1PGA A;  2ONQ A;  1YMH E;  1HZ5 A;  1PGX A;  1ZXH A;  2KAC A; 
#chains in the Genus database with same CATH topology
 1E8Z A;  1HZ6 A;  3HM6 X;  3I57 A;  2C7H A;  1E8Y A;  1SF0 A;  2WXK A;  3B08 A;  2YEP B;  4NZL B;  1KLU D;  2IO2 B;  2MJD A;  1UBI A;  1ACC A;  1JWB D;  3P4R B;  2J0K A;  2IZV B;  3TJP A;  3MJ5 A;  5D7G A;  4A3O A;  4ZYN A;  1J7B A;  2AQ1 B;  3OG5 A;  1KLG D;  2JUO A;  2KZR A;  1Q5W B;  3ZO5 B;  3AE2 B;  2WXH A;  5H8Y E;  2ZVO A;  1XO3 A;  2VH1 A;  3FAH A;  4BKG A;  4MT5 A;  3VH4 B;  3P63 A;  2GBJ A;  4I6P A;  4ITK A;  5KHQ A;  1V97 A;  2KC1 A;  4HDO A;  2JT4 B;  2MBB B;  3B0A A;  4ACF A;  2CHZ A;  4NAW B;  3APF A;  2L3Z A;  3URY A;  3JW0 X;  3NY5 A;  1ZGU B;  2BT6 A;  1TIF A;  4US8 A;  1AW7 A;  3SD5 A;  2M56 B;  3NS8 A;  2D5G A;  2H88 B;  3AEE B;  3N32 A;  1WYG A;  4LJP B;  4NJC A;  3WAM A;  1P1A A;  1QKZ A;  1EWY C;  2KNB A;  1F9J A;  2IDY A;  2V4I B;  4R3D A;  5G2N A;  1MI0 A;  4A9A A;  4M8M A;  1FCC C;  3TEW A;  3L16 A;  2KT7 A;  1AAR A;  4QAY A;  2L83 A;  1ET9 A;  2J4X A;  2JRI B;  2DWQ A;  1HE8 A;  5TR5 A;  2FCQ A;  1YOV B;  2FBW B;  1C76 A;  4BFR A;  2KAC A;  4OZA A;  3W1Y A;  1PUT A;  2O6V A;  2HE7 A;  2BYF A;  1F1H A;  3DVN V;  2MHJ A;  2C60 A;  4TV3 A;  3RNG C;  1TKE A;  2M0X A;  2G3Q B;  4MDK E;  1SIF A;  2GOW A;  3TMP B;  2GB1 A;  1GB4 A;  2E3T A;  4FA6 A;  1P7E A;  4JE3 B;  1KM7 A;  3BK1 A;  3RN9 C;  3NS1 A;  3AEC B;  3DHG C;  2MWS B;  5KHO A;  2FIF A;  2WP9 B;  1D5X C;  2GRI A;  2I2Y A;  1CQV A;  1I42 A;  2DYM A;  1VZ6 A;  4N59 A;  2MJ3 A;  4C00 A;  3W2D A;  1L4D B;  2OJW A;  1C4C A;  5AEK B;  2KJ6 A;  4RGM A;  2W54 A;  3FIL A;  1YNT E;  3IT4 B;  2J0M A;  2L00 B;  2O6V D;  2QSD A;  3ZLZ A;  2M8S A;  2WLB A;  3MC9 A;  1YX5 B;  1ZDX A;  1WXQ A;  3M63 B;  1ZUD 2;  4IM2 A;  1IPG A;  2LXA A;  1TGZ B;  2MBO A;  3EUB 2;  3UGB B;  4AOF A;  2KTR A;  3A9J A;  1BT0 A;  4KZC A;  1WF9 A;  3ONS A;  2VZK B;  1TS3 A;  1G6J A;  2BQQ A;  2MP2 A;  4HWI B;  3ZJV A;  1ZOY B;  2NR2 A;  4GN1 A;  2XN9 C;  5LXH A;  1SGH A;  1JWS D;  2IJ0 A;  2Z0D B;  2KLC A;  1ZE3 D;  2YEP F;  4AP4 C;  4LLG M;  4BOZ B;  1WXM A;  2L8J A;  1Z5S B;  1GJZ A;  1NEK B;  4E71 A;  4GIV A;  2V3S A;  2JYE A;  1EU3 A;  3CMM B;  5BMH A;  3VUW A;  2JY6 A;  2WXQ A;  2D2Q A;  4K3B A;  4LNO A;  2CHW A;  2JYT A;  1N5W A;  2WXM A;  3MJW A;  3OWE B;  1WY8 A;  2SAK A;  2NPT A;  3KW5 B;  3UF8 A;  4TUU A;  2LFI A;  4WAF A;  3O13 A;  1S3S G;  4A90 A;  2GBK A;  1T3Q A;  4J6I A;  3BYY B;  2JVC A;  1FEH A;  2JWU A;  2JQR B;  3AE6 B;  2PEA A;  5BYQ A;  2GBR A;  3KUZ A;  3V3X A;  3AE5 B;  3WCQ A;  2PVO D;  2IY1 B;  4P1C C;  3Q3N C;  2A4Z A;  3Q3J A;  3ZNG C;  4PK1 A;  2RGF A;  2DZI A;  1F77 A;  4ZRI A;  3X0W A;  2LJ5 A;  1MPE A;  3W1S A;  1L0X B;  1OQY A;  4WUR A;  4K7S A;  1PGB A;  3RI7 C;  3R7Q A;  1K50 A;  2KWV B;  5E6O A;  3UIO B;  1YQ4 B;  2LXC A;  2JU6 X;  1MG4 A;  2BF8 B;  4ARI A;  4LCD E;  2V4L A;  3OAW A;  1V5T A;  2BGF A;  5HI1 A;  3EA6 A;  2KWC A;  1OTR B;  2R61 A;  3RNB C;  4A8X C;  4OZB A;  3HIZ A;  1KLV A;  4S0R A;  3V05 A;  3RPF C;  1IGD A;  4ZRP A;  3AU4 A;  2FE8 A;  2WDQ B;  3RMK C;  3AEF B;  4L23 A;  3PGE A;  2D11 A;  1WE6 A;  1EO6 A;  2TSS A;  3N3K B;  2QIL A;  2NVU I;  2SEB D;  4W9E A;  3NRZ A;  4C80 A;  4XGA B;  5DPR A;  3E56 A;  4B9K A;  2N4F A;  3A1Q A;  2K6Q A;  2ZPN A;  1ROE A;  2JPH A;  4DQO C;  2LGY A;  4K7W A;  3VTV A;  1FCL A;  4YSX B;  1WSP A;  2BYV E;  1KTK A;  4B95 A;  4WWP A;  3JSV B;  2C9W B;  3U2S C;  3V62 A;  4NJ7 A;  2NMQ A;  4MJS B;  3R8B A;  2RDH A;  3CWI A;  4XDC A;  1MHH E;  2LVQ A;  3FC4 A;  1GUA B;  3PVL A;  1WIA A;  1KJT A;  2YLM A;  2BS4 B;  2DYB A;  1WMH B;  1TY0 A;  1UNS A;  1DGJ A;  2KX3 A;  2JZ3 B;  1WX9 A;  4EOY A;  4F7Z A;  3BY4 B;  2BBC A;  4C7Y A;  3U4E G;  4UDU C;  4ASW C;  1N60 A;  1LXD A;  2LGX A;  4BAX A;  3NVY A;  2DLB A;  4ANW A;  3DBR B;  4N9F 4;  3PRZ A;  3EGR A;  2KAN A;  4CQN A;  3PT2 B;  1JWA D;  2DBY A;  3TEY A;  3PTF C;  2GMI C;  2K8B A;  4HPP A;  5AUK A;  4RF0 A;  1TS2 A;  1FXI A;  2C5L C;  4ZHO A;  1C1Y B;  2RPQ A;  2WXI A;  4MSM B;  3W9C B;  1J7A A;  1L7Y A;  3PHX B;  4P16 A;  3QHT A;  3ZGZ A;  1VD2 A;  3IVF A;  3RNC C;  4D2K A;  3L17 A;  4EFO A;  3VQI A;  2LHE A;  2CKH B;  3DBL B;  4CO7 A;  3AE1 B;  4NNJ B;  2EEL A;  2J53 A;  5JXV A;  3IXS A;  3ZTC A;  4DXF A;  4IUM B;  1CMX B;  5G5G A;  4DBG A;  1FXA A;  4KV2 A;  1P0R A;  3CSF A;  1JWM D;  3ML9 A;  1JAL A;  3E9S A;  4MJS A;  3KLS X;  2IGD A;  2MEK A;  1T0Q C;  5EE3 A;  2J42 A;  2AWT A;  1T0Y A;  2KMA A;  1L5P A;  4ZRQ A;  2N1V A;  3EFC A;  1JML A;  4NQK E;  3NZU A;  3MC8 A;  1R4N I;  5FR6 A;  2ZNV C;  1TZO A;  3FKY A;  3AE4 B;  3LB8 C;  3AEG B;  1XXG A;  5EE1 A;  1YJ1 A;  1C79 A;  1TJE A;  2N9E B;  3ZNH B;  2BWE S;  5MPO A;  1ZXI A;  2EKE C;  1MJD A;  3SHQ A;  3AE7 B;  4K1R B;  1C77 A;  3J9C A;  1WXV A;  4KKI A;  1PFD A;  4N58 A;  1D5M C;  3KH0 A;  1WJ4 A;  2EMS A;  4KSL C;  4FUL A;  3VUX A;  2W55 A;  4HPL B;  2Y3A A;  1LO5 D;  1FRR A;  1I7H A;  5CX3 A;  2PPH A;  3BIN A;  2J52 A;  3N1Y C;  1C3T A;  1SXT A;  4DXG A;  3QK0 A;  2K8C A;  2N0S B;  1YMH E;  1NDD A;  3AE3 B;  3A4S C;  3AXC A;  5HKH A;  3TEZ A;  1FO4 A;  2UU7 A;  1PGX A;  3P42 A;  1TY2 A;  1B9R A;  3LYY A;  4FJV B;  1WXA A;  5D2M B;  1VJK A;  3HRD D;  1FM0 D;  4PS8 A;  1OFF A;  4KDI C;  2ZW1 A;  1FD6 A;  2HTH A;  5J2R A;  2GI9 A;  3KUC B;  2G4D B;  1ISN A;  5DPT A;  4KIK A;  2KDI A;  4MH8 A;  1LGR A;  1N62 A;  2INC C;  3M3J A;  1WX8 A;  4MM3 A;  1SB3 C;  2FCN A;  3HHM A;  1XCQ L;  3RD2 A;  5JH5 C;  2O6V B;  1IUE A;  2BYT A;  4I6L B;  2UYZ B;  4MEL A;  1FXT B;  4II2 B;  4WJN A;  2V9H A;  3AU5 A;  2N9X A;  1KH0 A;  4DXA B;  3VXW A;  3DCG A;  2KTF A;  3APC A;  5IOI A;  1GC6 A;  1K8R B;  1JQ4 A;  1T0R C;  2EMT A;  5CHW A;  3W5V B;  2WU5 B;  1SE2 A;  2KDE B;  3KUD B;  3U8Z A;  2OHF A;  2FNJ B;  2WGS A;  4LJO B;  1WI0 A;  4RGT A;  4W9F A;  4G0N B;  4LNF A;  1P3Q U;  3FIL B;  4TQ1 A;  1UWX A;  3NUH B;  3VR9 B;  1YQB A;  2Z8L A;  2LGS A;  1QIL A;  2BYE A;  4A3P A;  1RYJ A;  2RDB C;  2KTR B;  3A9J B;  5IN7 A;  1BML C;  1Q0W B;  2CR5 A;  2MSE D;  1TT5 B;  4LNN A;  4AJW A;  1HZ5 A;  2JRH A;  3DOW A;  2D3C A;  4PS3 A;  1I35 A;  2MP2 B;  4IDI A;  1NI2 A;  1ESF A;  1SSN A;  2KK8 A;  4RGO S;  2MH7 A;  4REZ A;  1JRO A;  1TKG A;  4WIP A;  2OED A;  5BMG A;  2M4N A;  4FN2 A;  3R3M A;  1F2R I;  2M19 A;  2CU3 A;  4NAM A;  4XC2 A;  1XLQ A;  3LXF A;  1E8X A;  2BS2 B;  2KHW B;  2K39 A;  4C7Z A;  1XEE A;  3PHW B;  3B2G A;  1C4A A;  2MCN B;  3SU8 X;  3SFD B;  3ZUN A;  3GZN B;  3DWG C;  2X38 A;  2DAF A;  3DPD A;  3PS6 A;  1OQQ A;  3IHP C;  2FUH B;  4KDL B;  2LUE A;  1AN8 A;  2NS5 A;  4WJO A;  2NPT B;  3AE8 B;  4M02 A;  3T3N A;  3BVZ A;  5BMI A;  4ZRK A;  1NEN B;  4ICV A;  5D3D A;  2RR9 A;  3A4R A;  1FMA D;  1TKY A;  2JWZ A;  4RGN A;  2MRP A;  1ZDV A;  4PS7 A;  4WWN A;  2PJH A;  1TS4 A;  2XBB C;  3JVZ X;  3VAW A;  1L0Y B;  2NTS A;  1V1O A;  1I4G A;  5G5H A;  3B9J A;  4KZ0 A;  2DZJ A;  3N9Y C;  2RSU A;  3SEB A;  3OJ3 A;  2LVO A;  1WR6 E;  2LHD A;  2LUM A;  3MFG A;  4KGR A;  2NBV B;  4PYU A;  1ZW7 A;  3S2A A;  3KVF B;  1FNW A;  3CIR B;  1XLO A;  3T3O A;  3AEA B;  5EE9 A;  2G9H D;  2CU1 A;  5HG2 A;  4G11 A;  2WU2 B;  1WH3 A;  3AEB B;  2G45 B;  3KWV A;  1UD7 A;  1BUI C;  2Z59 B;  3IG3 A;  2KDM A;  1EF1 A;  4RH6 A;  2Y5C A;  5IAA C;  1K53 A;  4WWO A;  4DHZ B;  3L4P A;  3ZNZ B;  5FR3 A;  3VDZ A;  5E6N A;  2DAJ A;  1JRU A;  1VDV A;  1L2N A;  1N63 A;  3H7P B;  4IOI E;  4IKG A;  2QDF A;  3PO0 A;  4HJK A;  2LMC A;  4W9D A;  3RNF C;  4XYC A;  4ZOH C;  1CK1 A;  2K1F A;  3A1Q B;  1NBF C;  3L10 B;  2BB5 A;  1F2R C;  1OQR A;  3ZXV A;  1HTQ A;  1I4Q A;  2PKO A;  2REX A;  3EEC A;  5CHV C;  4BKS A;  3R66 C;  2OOB B;  5DPW A;  2RD0 A;  5AZG A;  3I63 C;  3DBH B;  4WJQ A;  2PVG C;  4L1B A;  3N30 A;  4JLC A;  5LXI B;  1QOA A;  1XQQ A;  4J3O D;  2MX2 A;  4A20 A;  4MH0 E;  2HD5 B;  1LM8 B;  3MC0 B;  5IA7 A;  2FID A;  3DDC B;  2DZK A;  5JHA A;  4MGI E;  2O2V A;  2KJR A;  3EFU A;  5IKC M;  3Q3O C;  4OVU A;  2NBU A;  2XK5 A;  5C3J B;  2K8H A;  1YN3 A;  2Z0E B;  3QC8 B;  4OVV A;  4MAC A;  3RYT A;  3QA8 A;  1OEY A;  2BPS A;  1UH6 A;  3I9V 1;  4HJG E;  4BKS D;  2WQY B;  2N9K A;  5CHF A;  3W1S C;  3DVG Y;  3P2B A;  5EDS A;  1PGA A;  3R2I A;  5T8I A;  2LRU A;  1E8W A;  4CYE A;  4BVU C;  1XT9 B;  3SDL C;  3U30 A;  3RFZ B;  3AV8 A;  5J17 A;  4FHK A;  2M17 A;  3KQ4 A;  4HXD A;  3KYD D;  4KSK C;  1SJE D;  3Q8F A;  2IGH A;  3PV1 A;  3R7R A;  4YL8 A;  1EF5 A;  2BKF A;  1V6E A;  2MW5 A;  1SE4 A;  4KX6 B;  3T9L A;  1WGY A;  3H7P A;  4W9K A;  1R7S A;  1J8C A;  1FIQ A;  2KAJ A;  3ZKJ C;  2UWQ A;  1GNU A;  3C8Y A;  3K9P B;  3ETR A;  3CST A;  3Q8C A;  1UWM A;  2RPV A;  1NYR A;  2ZJD A;  3V61 A;  1UGM A;  3N20 C;  4GOC A;  1I4P A;  3PZD A;  1UF0 A;  5BYS A;  1RFK A;  1L4Z B;  2K5P A;  3RNA C;  3DWM A;  1P7F A;  1FNV A;  4PYZ A;  3GOE A;  1A70 A;  4FBJ B;  1WJU A;  4CHK A;  1N61 A;  2HDE A;  3B1L X;  1J0G A;  4M0W A;  5H92 C;  3BVM A;  2LWP A;  2AL6 A;  2WXJ A;  1XD3 B;  4FXC A;  3ENE A;  1P9D U;  1GPX A;  4AS1 A;  2WDT B;  4YSY B;  4MGY E;  5BO4 B;  3K9O B;  2NBW B;  2MBQ A;  1I4H A;  4RCO A;  1V1P A;  1NVI D;  4NJ6 A;  4OVZ A;  2HJ1 A;  1SEB D;  2WXP A;  5LLI A;  4IM0 A;  4IC7 B;  3ZJT A;  1HQR D;  4II3 B;  1SE9 A;  3C19 A;  2J0J A;  3PRE A;  4GDL A;  4MEM A;  4W9L A;  2IY0 B;  1XCT L;  2KN4 A;  5LNK 1;  5FK9 C;  3L08 A;  2N7E A;  4WQO B;  2KVR A;  2X8X X;  3QX1 A;  2CHX A;  3HVD A;  1WE7 A;  4LNK A;  1R4M B;  3QIJ A;  2ZCC A;  2KDB A;  1AYF A;  2ZW0 A;  1KOT A;  5E6J A;  1WGG A;  3PSE B;  1EU4 A;  2WHI A;  4ZDV A;  4IWP A;  3UI3 A;  1PDX A;  2IGG A;  5C1Z A;  3VHT C;  3BVG A;  2QMT A;  5C2T B;  2VRR B;  1H8C A;  2AQ3 B;  2ZCB A;  1MG8 A;  2C7N B;  4G3X B;  2ASQ A;  2KYW A;  3NZS A;  5EE0 A;  2B76 B;  2FCS A;  1WRD B;  4P7I A;  1DOX A;  1XF5 L;  1YJJ A;  2V3P A;  4ANV A;  1IGC A;  3U7D A;  4AQ7 A;  1L6V A;  2QJL A;  1I4X A;  4KIK B;  1PQS A;  4KKJ A;  2WDV B;  2K22 A;  5I4D A;  2D3A A;  2PTL A;  3ZW3 A;  2LAS A;  4DDI D;  4MM3 B;  1AWD A;  1LFD A;  2JZP A;  3BII D;  1KRH A;  1E10 A;  1JW9 D;  4TKN A;  1J19 A;  1CJE A;  2LVP A;  2XEW A;  3C0R B;  1IYF A;  3GE8 C;  1WYW B;  5D3I B;  4XWT A;  3MTN B;  3QJZ A;  4DHJ B;  2HTM E;  2VH2 A;  2KX0 A;  2ON8 A;  3PZ8 A;  4JL9 A;  4RF1 A;  4WQM A;  1DOI A;  3ZYY X;  1E6E B;  1FNU A;  4A6Q A;  1NYQ A;  2ICI A;  2AX5 A;  1WM3 A;  2NCN A;  4MGZ E;  2WDR B;  3NVW A;  2ZPY A;  2JX5 A;  2JXX A;  3ZDT A;  2MQJ A;  2BWF A;  5FKA C;  4JX1 C;  2KQ7 A;  1V86 A;  4E3C A;  4H2A A;  5JHB A;  4FLH A;  1GAQ B;  3WAN A;  2WS3 B;  2L0F A;  2KOX A;  4HDQ A;  2MJE A;  5TSS A;  3T8M A;  3RZF A;  2AYO B;  2JZZ A;  3HK0 A;  1R4N B;  4KGS A;  3RCZ A;  4EEW A;  4X57 B;  4EE2 A;  3U7Z A;  2IPK D;  5AZF A;  2KXJ A;  3DQV A;  4RFB A;  4GB9 A;  4ZYS A;  2MBH A;  2WXG A;  4B0E A;  3PLV A;  2R2Q A;  2RDG A;  2JSV X;  2WXR A;  3VRB B;  2JF5 A;  1ZKH A;  1EM7 A;  2PE9 A;  1IBX A;  2LEK A;  2N1W A;  3UQB A;  2MLB A;  1HEZ E;  4GDK B;  3EC8 A;  1Y56 A;  1T5X D;  4ANX A;  4XX5 A;  1T0S C;  4NQL B;  2WWZ A;  1FFV A;  2KMM A;  1QQR A;  1C4P A;  4JGH B;  3WAL A;  2DNF A;  2I1J A;  2KFK A;  1ZP0 B;  2DX5 B;  4PT5 A;  1YJI A;  3QCA A;  4OZC A;  4FJZ A;  3RZW C;  4M00 A;  1EUV B;  4W9J A;  1F52 A;  1DYQ A;  3PPA A;  1E7P B;  3SFE B;  3RNE C;  2M0A A;  2CS4 A;  4LK0 M;  3L0W B;  2IYD B;  1QOG A;  1UGJ A;  2A5U A;  4K3C A;  1J7C A;  2AQ2 B;  1SBB B;  2MBE A;  4EZL A;  2HJ8 A;  3WAP A;  4C4V B;  4AWJ A;  2G4S A;  3DHI C;  3APD A;  3Q14 C;  4AJY B;  2PLP A;  4IG7 B;  4E74 A;  4LDT D;  1KFY B;  1TS5 A;  4DHJ D;  1VZ7 A;  3AE9 B;  3NVZ A;  1QF6 A;  2KFJ A;  3QQ8 B;  3IFW B;  4FAD A;  2W3R A;  3P1M A;  4JQW C;  5BYR A;  2BW2 A;  4W9C A;  1E7V A;  1T6B X;  3NJT A;  2QHO A;  3AI5 A;  2L0T A;  3GE3 C;  4B6W A;  1RRB A;  4KGT A;  1WFY A;  1YN5 A;  1HA5 A;  3DBS A;  1XLN A;  4BBN C;  4GDK A;  3GZN I;  4EKU A;  3H8H A;  3ZDM C;  3BK2 A;  3SR6 A;  2IO0 B;  3WIM A;  2D10 A;  2L1A A;  4A55 A;  1RLF A;  2J7Q B;  4ANU A;  1D6E C;  2W82 A;  1RFA A;  2BS3 B;  1HXY D;  2ACZ B;  2LGD A;  4EZJ A;  2LD9 A;  3O65 B;  3ABV B;  3V6E B;  3X23 A;  3QWZ B;  4BZA A;  1STE A;  3Q2A C;  3Q8A A;  4XZ4 A;  4HLE A;  2K0P A;  3Q8E A;  1N5X A;  2L05 A;  2V0G A;  1M94 A;  4TMA B;  3RT3 B;  4LTU A;  1LQB A;  1D5Z C;  4OHJ A;  2PMV A;  1V81 A;  2AL3 A;  2BB6 A;  3GS2 A;  4FHJ A;  3AUL A;  4DWF A;  2B3A A;  4RMA A;  2BTE A;  1C78 A;  2N7J A;  2ZEQ A;  4HEA 1;  2K25 A;  3I3T B;  1DOY A;  1E7U A;  3OLM D;  2KJH B;  4C56 C;  3UIN B;  2O2V B;  4C4V A;  3Q6B A;  1V8C A;  1WM2 A;  2XK5 B;  3Q3M C;  3Q8B A;  4JWU C;  2KQS A;  3TBL D;  3ZTD A;  3OJ4 B;  4USA A;  4BBN F;  1K51 A;  3TSS A;  1WJ6 A;  4O1N A;  1WX7 A;  1NI3 A;  1WZ3 A;  4GSW A;  3ZRF A;  4HKZ E;  2WXN A;  1K52 A;  2KVZ A;  1QOF A;  3AB5 A;  1UZX B;  4K81 A;  1SE3 A;  3BYT B;  3ALB A;  2CJN A;  4NAW A;  1WGD A;  4HKQ A;  3H7S A;  3M95 A;  3BWU D;  3PRP B;  2KO3 A;  1N6Z A;  1H4R A;  2WX0 A;  1GB1 A;  3H9D A;  4I6N B;  2JXT A;  1YN4 A;  4NY0 A;  2RMM A;  4RNA A;  2W3S A;  3R2T A;  3DHH C;  3NZ3 A;  1V49 A;  5AUI A;  3KWL A;  2GBM A;  1Z2M A;  3NVV A;  3QAQ A;  4ICU A;  4US9 A;  1UUP A;  3VUY A;  3DBH I;  3IAS 1;  2W9N A;  2DHZ A;  4G50 A;  3TCA A;  4YSZ B;  3JYU A;  5CTR C;  5E6P A;  2I1K A;  3P4Q B;  4GGQ A;  1YD8 U;  1FRD A;  1E90 A;  2L52 A;  2WXF A;  2LJI A;  2WYQ A;  4XE0 A;  2IO1 B;  3VVW B;  1BXT A;  4M0W B;  3ML8 A;  4XWW A;  1L6U A;  1WR1 A;  1YX6 B;  3ZIM A;  3TUO A;  3UIP B;  2KMC A;  2QEJ C;  1YQ3 B;  5GXG B;  3Q69 A;  3ZJU A;  4GXB A;  1FPY A;  1V1P B;  3VFK A;  2QC8 A;  3MHZ A;  1MFW A;  1WWT A;  2QCZ A;  4Q2J A;  2MA9 B;  3N1Z C;  1OEY J;  2IBI B;  3Q3F A;  4KVG B;  4DHZ E;  1A5R A;  3IAM 1;  4W9H A;  4GDL B;  1QLB B;  4N6E B;  1RM6 C;  2G1E A;  3HUI A;  2GLS A;  3PLU A;  1VCB A;  2KQ4 X;  1ENF A;  4L2Y A;  3EHV A;  1E9M A;  3VTU A;  1S1Q B;  2D07 B;  1ZPS A;  1F0Z A;  3M62 B;  1FFU A;  4LNI A;  2BKR B;  1E0Z A;  1TBE A;  3A33 B;  3LDZ E;  5D94 A;  1PYW D;  2XNA C;  3H1U A;  4ZRJ A;  3ZXR A;  4WAA A;  4FJY A;  2AEH A;  2WNM A;  1L0V B;  1RWS A;  1E5W A;  4OW0 A;  1V2Y A;  4M8N A;  2FAZ A;  2Y5P A;  1WXS A;  3P4P B;  3MHS D;  3B2F A;  1QOB A;  2KWD A;  4F8C B;  3L13 A;  3VR8 B;  1IP9 A;  2N9P C;  4W9I A;  1SIJ A;  5C23 A;  2OJR A;  1WGH A;  1TYG B;  3VRA B;  4JPS A;  2VZK D;  2D3G A;  5L95 C;  2LRW A;  3WA0 A;  3U52 E;  3TIX A;  2ONQ A;  3WAO A;  5DPS A;  3GP7 A;  3V60 A;  2Q5W D;  3KYC D;  2FCM A;  1GOZ A;  2K6D B;  1M4V A;  2L7R A;  3RUI B;  4MSQ B;  3ZRC A;  3DBR I;  1P98 A;  1U4A A;  5D6J B;  1R4M I;  1YIW A;  4F1S A;  2KD0 A;  3TL5 A;  4IM3 A;  2ZVN A;  2PW9 A;  2R2O A;  2ZNV B;  4ARC A;  1Q10 A;  3NHE B;  5IO9 A;  4P1B C;  4EUT A;  4GLS C;  2E6X A;  2KKC A;  4K7U A;  3H6N A;  2K3U A;  3L54 A;  2KC2 A;  1XLP A;  3AED B;  1VZ8 A;  1D3Z A;  2N7D A;  5HFY A;  3A9K B;  3LJ3 A;  5AZH A;  3RUL A;  2IO3 B;  4RM8 A;  1V5O A;  4RM9 A;  3DBL I;  1VLB A;  1Q1O A;  4MGK E;  5G55 A;  4DDG D;  1MVK A;  3TEX A;  3VTW A;  1QZE A;  1WGK A;  3HM3 A;  3QAR A;  5GMV A;  1IBX B;  1QT9 A;  1JWU D;  1WJN A;  1WZ0 A;  1ET6 A;  1TTN A;  3ZNI D;  2CJO A;  1V80 A;  4AUQ C;  4P6V F;  2DYO A;  3AH7 A;  2K9X A;  1WRI A;  2KWU B;  1V9J A;  3BZD B;  4EZK A;  1CZP A;  3N1X C;  4BOS C;  3MP9 A;  4DK5 A;  4YTP B;  4HRO A;  2PE6 B;  4NPN A;  3I5J C;  2L76 A;  1D4B A;  1MHX A;  3P4S B;  2KFK B;  3UQA A;  1OGW A;  4GMV A;  4LDT B;  4XDD A;  2KLG A;  2NTT A;  1JCK B;  3JSV A;  2V1Y A;  3ECI A;  2KN5 A;  3DVG X;  4B0M A;  1ZXH A;  3AM9 A;  1TZ1 A;  3AMZ A;  3NOB A;  4HPM B;  2LI5 A;  1VRA B;  4WWM A;  2PIA A;  1I4R A;  4JWS C;  1GG3 A;  2INP E;  5DCN A;  2WXO A;  2YVC A;  1SJH D;  4HCN B;  4S17 A;  2IND C;  1C9F A;  1UEL A;  2I38 A;  4W9G A;  3GB1 A;  4IWO A;  4ZHP A;  1WMH A;  2QIE B;  4YTM B;  5L83 A;  4WH4 A;  3ZQ4 A;  4IWQ A;  3DVN U;  4HRS A;  2LGI A;  3W5U B;  3A9K A;  3VH3 B;  4M01 A;  4BKT A;  3D32 A;  4HVB A;  2N9L A;  2V3N A;  2ZZP B;  3PRM B;  2WX1 A;  4TSS A;  1WGR A;  3IT6 B;  1Y8R C;  2FUG 1;  1X1M A;  5HHD G;  1EWC A;  4YT0 B;  1B1Z A;  2KDF B;  3PZ7 A;  1VR9 A;  2M1M A;  2Y5B B;  1KF6 B;  3IBE A;  2DEN B;  5J18 A;  3AN1 A;  2C7M B;  4GU2 A;  4IW0 A;  2H89 B;  3V6C B;  4YTN B;  4HK2 A;  2GBN A;  4URK A;  2INN E;  3ZVV A;  2EKI A;  5IP4 D;  4WJP A;  2LZ6 A;  4YXD B;  2L32 A;  2WXL A;  4HCP B;  4JIO U;  2D3B A;  4YWG G;  4TQ0 A;  1GC7 A;  3CF6 E;  1JRP A;  1UBQ A;  3HVZ A;  3NG0 A;  2BVC A;  5JZE B;  1RAX A;  1HTO A;  2DZM A; 
#chains in the Genus database with same CATH homology
 4JWU C;  1HZ6 A;  3I57 A;  3Q8B A;  3AV8 A;  3RFZ B;  3KQ4 A;  1SF0 A;  2WXK A;  4D2K A;  1SJE D;  3Q8F A;  3VQI A;  2IGH A;  4USA A;  2LHE A;  1K51 A;  2YEP B;  3TSS A;  4NZL B;  3AE1 B;  4O1N A;  1NI3 A;  1KLU D;  4HKZ E;  2MJD A;  2EEL A;  2WXN A;  1ACC A;  1K52 A;  2J53 A;  1JWB D;  1QOF A;  3AB5 A;  3P4R B;  5JXV A;  3IXS A;  1SE3 A;  1SE4 A;  4KX6 B;  3MJ5 A;  5D7G A;  4DXF A;  3BYT B;  1R7S A;  1J7B A;  2AQ1 B;  1FIQ A;  1KLG D;  2CJN A;  2KAJ A;  4HKQ A;  5G5G A;  1FXA A;  3BWU D;  3C8Y A;  1GB1 A;  1JWM D;  3AE2 B;  3ETR A;  2WXH A;  1JAL A;  3E9S A;  3Q8C A;  5H8Y E;  1XO3 A;  1UWM A;  2RPV A;  3KLS X;  2IGD A;  1YN4 A;  1NYR A;  2JXT A;  2MEK A;  3FAH A;  4MT5 A;  2RMM A;  4RNA A;  5EE3 A;  2J42 A;  2W3S A;  4ZRQ A;  1L5P A;  3P63 A;  3R2T A;  4ITK A;  1I4P A;  1JML A;  5BYS A;  1V97 A;  1RFK A;  3NZ3 A;  1L4Z B;  2K5P A;  3DWM A;  1P7F A;  1FNV A;  5AUI A;  3KWL A;  1A70 A;  1TZO A;  4NAW B;  1N61 A;  3URY A;  2HDE A;  3NVV A;  3AE4 B;  4M0W A;  3LB8 C;  3AEG B;  1XXG A;  5EE1 A;  4US9 A;  1C79 A;  1UUP A;  3BVM A;  5H92 C;  1TJE A;  3IAS 1;  2WXJ A;  2BT6 A;  5MPO A;  4FXC A;  4US8 A;  1AW7 A;  1GPX A;  2M56 B;  4AS1 A;  1ZXI A;  2D5G A;  2H88 B;  3AEE B;  4YSY B;  4YSZ B;  1WYG A;  4NJC A;  3AE7 B;  4RCO A;  1C77 A;  1I4H A;  1QKZ A;  1EWY C;  1NVI D;  1V1P A;  2IDY A;  2V4I B;  3J9C A;  4KKI A;  4OVZ A;  4R3D A;  1MI0 A;  1PFD A;  1SEB D;  3P4Q B;  4A9A A;  1FRD A;  4N58 A;  1D5M C;  2WXP A;  1FCC C;  2L52 A;  2WXF A;  2LJI A;  4XE0 A;  3TEW A;  3ZJT A;  1HQR D;  1BXT A;  2W55 A;  2Y3A A;  4XWW A;  1LO5 D;  1FRR A;  1I7H A;  1L6U A;  2J52 A;  1XCT L;  2KN4 A;  5LNK 1;  2L83 A;  5FK9 C;  1ET9 A;  2J4X A;  1SXT A;  3TUO A;  4DXG A;  2DWQ A;  2FBW B;  2QEJ C;  1YQ3 B;  5GXG B;  3Q69 A;  2N0S B;  1YMH E;  3AE3 B;  3TEZ A;  1C76 A;  3ZJU A;  1V1P B;  1FO4 A;  3MHZ A;  1WWT A;  1PGX A;  3P42 A;  1TY2 A;  4Q2J A;  2KAC A;  1B9R A;  3HVD A;  3LYY A;  4OZA A;  1PUT A;  1VJK A;  1AYF A;  2ZW0 A;  3HRD D;  5E6J A;  1FM0 D;  3IAM 1;  1OFF A;  2ZW1 A;  4GDL B;  1QLB B;  1EU4 A;  4N6E B;  1TKE A;  1PDX A;  3UI3 A;  1FD6 A;  1RM6 C;  2IGG A;  2G1E A;  3HUI A;  3BVG A;  2QMT A;  5C2T B;  2GI9 A;  2KQ4 X;  2GB1 A;  1ENF A;  4L2Y A;  1GB4 A;  2AQ3 B;  2E3T A;  1E9M A;  1P7E A;  4JE3 B;  4MH8 A;  3BK1 A;  1ZPS A;  5EE0 A;  2B76 B;  3NS1 A;  1N62 A;  3AEC B;  1F0Z A;  2WP9 B;  1SB3 C;  1DOX A;  1D5X C;  1XF5 L;  1FFU A;  2GRI A;  1XCQ L;  1YJJ A;  2V3P A;  2I2Y A;  1CQV A;  1IUE A;  2DYM A;  1IGC A;  2BYT A;  1VZ6 A;  4N59 A;  1E0Z A;  2MJ3 A;  4AQ7 A;  3W2D A;  1KH0 A;  1L4D B;  1C4C A;  1L6V A;  2QJL A;  1PYW D;  4RGM A;  1I4X A;  2W54 A;  2XNA C;  3FIL A;  1YNT E;  3IT4 B;  4KKJ A;  2QSD A;  2WDV B;  2WLB A;  2K22 A;  5I4D A;  1ZDX A;  2PTL A;  1WXQ A;  1ZUD 2;  2WNM A;  1L0V B;  1RWS A;  4MM3 B;  1AWD A;  4OW0 A;  1JQ4 A;  2JZP A;  3BII D;  1KRH A;  3EUB 2;  3W5V B;  1E10 A;  1JW9 D;  2Y5P A;  2WU5 B;  1CJE A;  1SE2 A;  3P4P B;  5D3I B;  2OHF A;  3B2F A;  4XWT A;  1QOB A;  2KWD A;  2VZK B;  4RGT A;  1TS3 A;  3VR8 B;  2HTM E;  3FIL B;  4TQ1 A;  1UWX A;  3NUH B;  2ON8 A;  1SIJ A;  3PZ8 A;  4RF1 A;  1ZOY B;  4WQM A;  3VR9 B;  3ZJV A;  1DOI A;  3ZYY X;  2Z8L A;  1E6E B;  1FNU A;  1TYG B;  2XN9 C;  3VRA B;  4JPS A;  4A6Q A;  2VZK D;  1JWS D;  1QIL A;  1NYQ A;  2ICI A;  1RYJ A;  2IJ0 A;  2AX5 A;  2WDR B;  3NVW A;  1ZE3 D;  2YEP F;  4LLG M;  3U52 E;  1BML C;  2JX5 A;  2ONQ A;  3GP7 A;  1NEK B;  2Q5W D;  1HZ5 A;  1GOZ A;  5FKA C;  4JX1 C;  2JYE A;  4H2A A;  1EU3 A;  1M4V A;  4IDI A;  5BMH A;  1GAQ B;  1ESF A;  2WS3 B;  2WXQ A;  1SSN A;  4RGO S;  2JYT A;  1N5W A;  2MH7 A;  2MJE A;  5TSS A;  4REZ A;  1JRO A;  1TKG A;  2WXM A;  4WIP A;  2OED A;  3OWE B;  5BMG A;  4KGS A;  4EE2 A;  2SAK A;  1F2R I;  2M19 A;  2PW9 A;  3U7Z A;  2IPK D;  2CU3 A;  4NAM A;  4ARC A;  4RFB A;  1XLQ A;  4ZYS A;  1Q10 A;  3LXF A;  2LFI A;  4WAF A;  2BS2 B;  2WXG A;  4B0E A;  4C7Z A;  3O13 A;  4A90 A;  2RDG A;  2JSV X;  1XEE A;  2WXR A;  3B2G A;  1C4A A;  3VRB B;  1T3Q A;  4GLS C;  3BYY B;  2E6X A;  1FEH A;  2JWU A;  3SFD B;  2K3U A;  1EM7 A;  3DWG C;  1IBX A;  2JQR B;  2LEK A;  2X38 A;  3AE6 B;  1XLP A;  3AED B;  1VZ8 A;  1OQQ A;  5BYQ A;  5HFY A;  1HEZ E;  4GDK B;  3V3X A;  1AN8 A;  1Y56 A;  3AE5 B;  1T5X D;  3AE8 B;  3T3N A;  3WCQ A;  2PVO D;  3BVZ A;  1VLB A;  5BMI A;  1MVK A;  3TEX A;  1WGK A;  1NEN B;  1F77 A;  1FFV A;  5D3D A;  2KMM A;  1QQR A;  1C4P A;  1MPE A;  1FMA D;  1TKY A;  1IBX B;  4RGN A;  3W1S A;  1QT9 A;  1JWU D;  1L0X B;  1ZDV A;  4WUR A;  1ET6 A;  1PGB A;  1TS4 A;  2CJO A;  1K50 A;  1ZP0 B;  1YQ4 B;  4P6V F;  1L0Y B;  2DYO A;  3AH7 A;  2NTS A;  1YJI A;  2JU6 X;  1V1O A;  4PT5 A;  2K9X A;  1I4G A;  5G5H A;  3B9J A;  4OZC A;  4ARI A;  1WRI A;  3N9Y C;  3SEB A;  2LHD A;  2LUM A;  3BZD B;  5HI1 A;  3EA6 A;  3MFG A;  1DYQ A;  1CZP A;  4KGR A;  2R61 A;  4A8X C;  1E7P B;  3SFE B;  4OZB A;  3MP9 A;  1FNW A;  3CIR B;  2M0A A;  1XLO A;  4YTP B;  4HRO A;  4LK0 M;  3T3O A;  3AEA B;  1D4B A;  3V05 A;  5EE9 A;  3RPF C;  1MHX A;  2G9H D;  3P4S B;  1IGD A;  4ZRP A;  1QOG A;  1UGJ A;  4XDD A;  5HG2 A;  2WU2 B;  1J7C A;  2AQ2 B;  1SBB B;  2FE8 A;  3AEB B;  2WDQ B;  2NTT A;  3AEF B;  4L23 A;  1JCK B;  3KWV A;  1BUI C;  4B0M A;  1ZXH A;  2TSS A;  3AM9 A;  2QIL A;  2PLP A;  2SEB D;  2KDM A;  3AMZ A;  3NRZ A;  4C80 A;  3E56 A;  4RH6 A;  2Y5C A;  1KFY B;  1VRA B;  1K53 A;  1TS5 A;  4WWM A;  1VZ7 A;  1I4R A;  2PIA A;  4JWS C;  1ROE A;  3AE9 B;  3NVZ A;  4DQO C;  1QF6 A;  3L4P A;  5FR3 A;  2INP E;  1FCL A;  2WXO A;  2W3R A;  3P1M A;  4YSX B;  1WSP A;  1SJH D;  1VDV A;  5BYR A;  1KTK A;  1N63 A;  2BW2 A;  4IOI E;  1T6B X;  4IKG A;  1C9F A;  3PO0 A;  2I38 A;  2LMC A;  3GB1 A;  4ZHP A;  4KGT A;  2QIE B;  4YTM B;  1YN5 A;  4ZOH C;  1CK1 A;  3U2S C;  1HA5 A;  4WH4 A;  2NMQ A;  3ZQ4 A;  3R8B A;  1XLN A;  4HRS A;  2RDH A;  2LGI A;  2BB5 A;  3CWI A;  3W5U B;  4XDC A;  1F2R C;  1OQR A;  3H8H A;  3BK2 A;  1MHH E;  2N9L A;  2V3N A;  1I4Q A;  3SR6 A;  4TSS A;  2PKO A;  3IT6 B;  3FC4 A;  2L1A A;  4A55 A;  2FUG 1;  1D6E C;  5HHD G;  2PVG C;  1EWC A;  2W82 A;  4L1B A;  4YT0 B;  2BS4 B;  1B1Z A;  1TY0 A;  2BS3 B;  1HXY D;  1DGJ A;  1UNS A;  2ACZ B;  3PZ7 A;  1VR9 A;  1QOA A;  1KF6 B;  3ABV B;  2BBC A;  4J3O D;  4C7Y A;  3AN1 A;  3U4E G;  4UDU C;  1STE A;  3Q8A A;  2K0P A;  3Q8E A;  1N5X A;  2H89 B;  1N60 A;  2V0G A;  4YTN B;  3MC0 B;  4TMA B;  2INN E;  2DLB A;  2EKI A;  3NVY A;  4LTU A;  1D5Z C;  4OHJ A;  3EGR A;  2PMV A;  4YXD B;  4CQN A;  2L32 A;  2WXL A;  2BB6 A;  1JWA D;  3GS2 A;  2DBY A;  3TEY A;  5C3J B;  1YN3 A;  4YWG G;  2BTE A;  5AUK A;  4MAC A;  4RF0 A;  1C78 A;  2N7J A;  1TS2 A;  4HEA 1;  1FXI A;  3I9V 1;  4TQ0 A;  4HJG E;  4ZHO A;  2WQY B;  2N9K A;  1DOY A;  1JRP A;  2WXI A;  3HVZ A;  1PGA A;  3W9C B;  4C56 C;  3R2I A;  1J7A A;  5T8I A;  4P16 A;  3ZGZ A;  1V8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...