5BMVB

Crystal structure of tubulin-stathmin-ttl-vinblastine complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 171
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5bmvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5bmvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5bmvB01
3JASB 5IYZA 3E22B 5JCOA 1SA0A 3HKCB 2R751 5M7EA 4YJ3B 5LP6A 4B46A 5J2UB 5GONA 3ZIDA 5EYPA 5ITZA 3VO9A 2XKBA 3V3TA 4B45A 3R4VA 4O4LA 4EB6B 3HKBA 4TV8A 3HKDB 5EIBD 1JFFB 1Z5WA 4LNUA 2RHHA 4ZI7B 4X20A 3VOAA 1W5AA 4O2AB 3RYIB 5JVDA 4I55B 3RYFB 3HKEA 3M8KA 1TUBA 5EZYA 4DRXB 4O2BA 4O4HB 5IJ9B 4O4IB 5JQGB 4TV9A 3JASA 5BMVA 3E22A 3HKCA 3JAKA 4YJ2B 3M89A 3WGMA 4M8IA 4YJ3A 4O4JB 5KX5B 5J2UA 2RHLA 4FFBB 3JATB 4X1KB 4ZOLB 4TUYB 4EB6A 5CB4A 3HKDA 5FNVB 1JFFA 4I50B 2BTQA 5JCOC 5LA6B 5MN4A 4ZI7A 2VAMA 4XCQA 4O2AA 5LP6C 3RYIA 5LYJB 3JAWB 3JALA 3JARB 3CB2A 5CA1B 4HNAA 4I55A 2XKAA 3RYFA 4DRXA 1W59A 4O4HA 4X1YB 4O4IA 5C8YB 1FSZA 5KMGB 1W5EA 5CA0A 4EI7A 3N2GB 1FFXA 2RHOA 3VPAA 4YJ2A 1OFUA 5KX5A 4O4JA 3N2KB 2RHJA 3UT5B 4IIJB 5LXTB 3RYHB 4ZHQB 4TUYA 5FNVA 4I50A 3WGJA 5LA6A 4X1IB 2R6R1 5CA1A 2Q1YA 4KWEA 3ZBPA 3ZBQA 5EYPB 4I4TB 4U3JB 4IHJB 4O4LB 4X1YA 5C8YA 4TV8B 2GVIA 5MN6A 5JH7B 1RQ7A 3N2GA 1TVKB 4WBNB 2VXYA 5IJ9A 5JQGA 3RYCB 3UT5A 4EI8A 5LOVB 5EZYB 4IIJA 3C8LA 3WGNA 5LXTA 3RYHA 4ZHQA 4DXDA 5IJ0B 5EIBC 4FFBA 5BMVB 3JATA 4X1KA 4ZOLA 3JAKB 5J2TB 4F6RB 5MN5A 4X1IA 1W581 4U39A 5IYZB 2VAWA 3RB8A 3VO8A 1SA0B 4I4TA 4U3JA 5LYJA 4IHJA 1W5FA 5LP6B 3JAWA 5CB4B 3JARA 1W5BA 2BTQB 5GONB 5JH7A 4EI9A 5ITZB 1TVKA 3WGKA 4WBNA 3JALB 3HKBB 5KMGA 3RYCA 1Z5VA 4HNAB 4LNUB 1RQ2A 4X20B 2VAPA 3VOBA 5LOVA 1RLUA 4E6EA 5JVDB 5IJ0A 5CA0B 3N2KA 5J2TA 2BTOA 1FFXB 3HKEB 1TUBB 4O2BB 4F6RA 2Q1XA 3WGLA 4TV9B
chains in the Genus database with same CATH superfamily
4MWBA 3ZLJA 5G3ZA 3K0TA 3HKBA 1DFIA 3N2EA 2YOGA 4POAA 3F0TA 1HT3A 1VGRA 4FN4A 1S3JA 2V74B 4CZZA 1NVVR 1IONA 3B82A 4PYMA 3ZWKA 3CCVV 1PJQA 5FHQA 4XLTA 2DXIA 3PQCA 4Y2RA 2ZJ4A 5TNXA 1BH6A 5DHUA 4XSGA 4UTOA 4CV2A 3UK6A 2QTGA 4UE3S 3ZK7A 1NXSA 4ARBA 1OC2A 1JEOA 1F14A 2HP3A 4CH3A 4BEJA 1H4TA 1ZBDA 2BBWA 4WLUA 2EFDB 1QMGA 4AZ3A 1QR2A 3WLQA 3ETGA 3MBMA 4ZHQA 3GZJA 2RD2A 1WB5A 3Q3VA 1BS9A 3A31A 5T6BA 4LZNA 3H18A 4QUEA 3EEBA 3BK2A 5BN4A 5IJ0A 3QTBA 3B3AA 1HOXA 3W6PA 5L45A 4FMDF 4OJKA 2QROA 2FMXA 3CF2A 3K1AB 4O02B 4FSXA 1XXHB 3GRUA 4GGOA 1QYWA 4OJNA 3GHHA 1YS1X 3IQXA 3TLGA 3H2JA 2WTMA 2NVUA 1YTFD 1IWOA 2PO5A 4LGVA 1XT6A 2PCJA 4Y2QA 2VNJA 4OBXA 4L15A 4OQMA 5HR5A 5DB4A 1ZRNA 2FEMA 1NRXA 4F86A 3HGMA 2FP4A 4Z1MG 2VRNA 2R6R1 3N4ZA 4CLOB 4JAAA 1PUXA 1YFZA 1NJIW 1KDOA 2VL7A 2R6HA 2B92A 1ZGAA 2O48X 2AR9A 3ROMA 5LZ9A 4U39A 3RVQA 1I6LA 3EVNA 3SFVA 1TCUA 4IDGA 2VYVA 1LI5A 3CX8A 4UVGA 4JKYA 2XGGA 2PWYA 3NC1C 1A9RA 4FR5A 4KPUA 1EQ2A 2H4ZA 5D3MB 5ICFA 3EULA 4CZ2A 1Z37A 3L0CA 4R0MA 1G16A 3K1ZA 3VO1A 3GK3A 2GXAA 3WK7A 2OP1A 5LLSA 2OXRA 4A4DA 4QBFA 3V1MA 5DMHA 2ZRBA 4U7WA 2COUA 3M5CA 4HWTA 4L3OA 3UPUA 4ALMA 3HM2A 1NVPD 3W6NA 1FVHA 3RAFC 1I2ZA 5DHRA 1NNUA 1A8PA 4HP8A 3WWDA 2FSVC 4IJQA 4RXTA 5I45A 4MKZA 3H8VA 1V2HE 5JH7F 1XR3A 4OGGA 2IJGX 4E2LA 1ZVVA 2ZE5A 5CGZA 2XTAA 3DXRB 1MXHA 3W1VA 4U7HA 2B8NA 5C52B 5ERGB 1IPAA 1KC1A 1RS0A 4X7BA 4IHJA 1KD1H 3V97A 1FYJA 2GM4A 1Z5VA 3EXIA 4DARA 3L0PA 4EL0A 3WNZA 3HXLA 4JITA 1N2CB 1XZGA 4JHXA 1DAEA 2E4UA 3BL8A 5KSYA 1P3JA 5LLDA 4JOQA 2ECQA 4M8NE 4V0MA 5DGIA 2DWEC 4A3SA 4FOPA 5C37A 2WTUA 1P8AA 5FF9A 4AWBA 4V0KA 4V38A 4Y2TA 1Y6XA 3T35A 4B33A 3FWYA 1YB6A 4EFDA 3WQQA 3OOSA 2NP6A 4JC4A 4JI7B 4IXMA 3W9BA 3JALA 2BHNA 4BYGA 3VR6H 4M4SA 1IWBB 1ZNZA 2E5LB 2XA2A 4DPKA 2BCGY 3QHQA 4XAQA 1Q3KA 4GOMD 3C3CA 3GRVA 1UM8A 3C3YA 3MQ4A 1AILA 1J4AA 4HB3A 4MQ6A 4KVAA 3KFLA 1NIJA 1PDWA 4GYYA 1RE0A 2X2FA 2GLTA 4CF5A 1ACLA 2XNDD 5IUKC 4R5HA 5JFGA 1VGQA 3KZOA 4D3XA 2OTLF 1UIRA 3T99A 3RUFA 4L7VA 4IS2A 1YR2A 2JGLA 4RL4A 4ND7A 1U96A 1RYYA 4DXHA 3STHA 3CZQA 1I7QB 3P0ZA 4RA6A 4PHHA 3TFWA 1GTMA 2YXBA 5BMOA 1DXQA 3NTQA 1K6IA 4AO6A 2G67A 3EDOA 3RJ5A 4LOLA 5GJBA 3MQWA 4B2LA 1DUVG 1SQPH 4FDUA 2GCPA 1GO3F 3PR3A 2OXTA 3TCNA 4QQFA 4K6MA 2WJ3A 1C8BA 2XHEA 3KCNA 5FTNA 5CMLA 2ZAMA 2YFQA 2ZB8A 2JVKA 2I71A 5GIOC 1XAJA 5SYAA 1OLXB 1E9AA 4KMMA 4Q3EA 1YIAA 2I76A 4G81A 2E7ZA 3GWGA 2VZ9A 2HFKA 3K4QA 5J4HA 5G53C 3RK1A 5I9IA 5G3YA 1ID1A 3H05A 5LOVA 4Q4HB 2PY6A 1SHTX 3IKVA 1C3EA 1K89A 3VR1A 5HTOA 1W8DA 4IZHA 3PDJA 3QU5A 1GSOA 1XD9A 4BNDB 1I0ZA 7YASA 2JRIA 3H1EA 5CVUA 5FTWA 2EGUA 2ODPA 4O4HF 3FMOB 1XQ8A 4Q4LA 1BWQA 4M54A 2J4CA 4MK4A 4AP5A 4FDLA 4U5XA 1CIJA 3B5JA 4EK9A 1RHRA 2V9ZA 1DC4A 1O5OA 1ZIOA 4E31A 2IJIA 1XZHA 3OFJA 2ZROA 1H2YA 2JS7A 2NV2B 4ZDJA 3N2LA 1K7XB 4M1KA 4IIJB 5L3DA 4D7SA 4H7PA 2Q9BA 2DUMA 2NM0A 4OLFA 3LKVA 1NUQA 4K6CA 5EWJB 3HA2A 5CXXA 5BXQC 1DHTA 3IJEB 2EG9A 2COKA 2FSFA 1USKA 1KVRA 4LBWA 3TQCA 3VPDA 2EWCA 5B1NA 3Q15C 5E6RB 3TQTA 1CY1A 2GAOA 1O97C 4ZZ1A 1XOIA 5I7WA 3JQAB 4OHYA 4Z2AA 2I8CA 4NJMB 4GRIA 2C5BA 1PZMA 3FDIA 3VU1A 3UMCA 4UAVA 1QXSA 4UFNA 2WM8A 5L6LB 3KNZA 4ZI2A 1RRMA 4R3NA 3JVVA 4QBKA 1X13A 1WP7A 1D4OA 3KZCA 1DPGA 4JODA 5A6VA 4MR9B 1A9TA 1Z63A 3FKSA 4C08A 1I6MA 2IYLD 4FGLA 4F56A 4REMA 1PQUA 3K1TA 2F9FA 3A4NA 4QQNA 1J97A 5LBQA 2XXJA 1QWSA 3QWAA 1ROPA 5EXXA 4Q15A 3W7WA 3OCJA 2EQBA 4S1TA 5DLDA 4DMUB 4QYTA 2HQSC 2FRXA 2XUPA 3N0WA 2NMUA 5BSUA 4QDKA 5IN5A 3IH5A 1UFVA 2D5BA 3UGJA 1L8DA 1BZKA 1HZZC 1ZJYA 1C1XA 1O77A 2CZGA 4OXQA 3SLKA 3TGLA 3NASA 3HJHA 5KYXB 2VEDA 1Y74A 2QAGB 4CUJA 3T1YB 3DQPA 4CH4A 4J0QA 2CTRA 1UDCA 3WWCA 3AG1B 3ZWYA 1RT9A 4J3FA 2Y69B 1AP5A 4NCHA 1VE1A 2J67A 3JSAA 3WWEA 1IZ8A 5KKCA 1N0WA 1R4AA 4UM8B 3ABRB 4NYMR 1SVKA 2OO7A 4XGNA 3FI9A 4INZA 2H1IA 2RMKB 3GUCA 4BYMA 3BXXA 1TU0A 1L5SA 4RF4A 4N5IX 4P3NA 2W6OA 1YF2A 1YCGA 2J08A 1FK8A 3M81A 4YJHB 4I5GA 1T1SA 4PPGA 2C7QA 3QWBA 5C46F 1YI8A 5AUPB 2C95A 5G2OA 3AY0A 2BIFA 2P6NA 3ESJA 3KKZA 1QM5A 4K0KO 3UFXA 3E7WA 3H5LA 3C1UA 3CSDA 4DQDA 2XJ4A 3CXRA 2QY6A 3KKYA 2B8TA 4C7OA 2JJ2G 3DBHB 4YRNA 1IFXA 1IN8A 4LXTA 3VXKA 3H17A 1DAHA 1TGVA 3OEEA 1MGOA 1PS0A 3SOZA 5HX7A 3A6HA 4WH0A 2B0CA 1A9PA 2DPGA 3G5LA 3SEFA 1QAOA 4BNLA 2F1KA 1B76A 3WB0A 4ER3A 2NSHA 3SBXA 4JI2B 1NN0A 1IOVA 2NXWA 1CUAA 2OQVA 2XX3A 4X65O 2XXAB 2JLYA 2BMVA 1LLFA 3UMJA 2IVZA 3HVJA 1A88A 1GFZA 3K0CA 4IV8A 3OHMA 2JLXA 1PK8A 1AMOA 3OIFA 2QHXA 1JU4A 3DE3X 3ZBPA 3OF2A 1OX5A 1OXVA 2PUBA 2DPXA 5D5HA 3G2LA 3ABQB 1OA1A 3NVIB 5F9MA 1ZN2A 1X1TA 1WLEA 2V7QD 4AJOA 1II8A 3HDJA 3OIUA 1TQHA 1YDEA 1P4RA 3E1GA 2QUAA 3VZSA 3R7DA 2JHFA 1LDBA 4JUDX 1RPTA 3BCUA 1GILA 3EXFA 2Z98A 3HMQA 2WR8A 3V4ZA 4JB0A 3IR9A 4Y6QA 4Z4GA 2W0SA 3D8BA 1R1DA 4FM2A 5TJ9A 3OTQA 4JJIA 5KJCA 1HE8B 2GJSA 4E15A 2PWZA 2WFLA 3D5QA 3O2QB 1VQ8V 3U10A 2OGTA 2W90A 3CJRA 5U1PA 4HX2A 4H08A 1PZXA 4OQDA 5DM2A 4RV9A 1MUUA 3IAM6 3RPEA 1IIRA 1NU6A 1I80A 1YS4A 3CO0S 3MAQA 2X6RA 2X19A 1W0KD 1AXEA 3VMFA 4HAOA 4L2IA 4LFAO 4FDMA 1P77A 3H1GA 3IAFA 2ZRAA 4B82A 5CAEB 4ZGBA 3HNPA 4A6XA 2EGHA 4PA9A 5GVRA 2CLSA 5LQCA 2UUAB 3AJRA 5DHAA 1ZLYA 3JQDA 3B78A 2HIAA 5BQPA 4PCUA 4U7DA 2N05A 3JASB 1J07A 1OJLA 3U7RA 4BVHA 3LC1O 1Z0FA 1H94A 1JEAA 4RJKA 2YHIA 1XP5A 3DE0X 3RUIA 3VMMA 2H3EA 5B1DA 4TYWA 1XFAA 1N6HA 2QN3A 2IS1A 2AOUA 3AJEA 4PZDA 4D4LA 1WXFA 3K2IA 3O7MA 1E1LA 3J80M 1E3SA 2F3UA 9GPBA 5CEFA 4HGOA 4CTMA 3FFWA 4KXVA 1LBEA 4OGWA 3I42A 1WBBA 1R0BA 2FC3A 2FDRA 3FMIA 2MYNA 1M6VA 2BGTA 1R0KA 3EHDA 3OKPA 4UXIA 1IMJA 4CR8A 4DSAA 2FPIB 3U4CA 2OHVA 3L7DA 3P71T 4RSGA 1N36B 1WZIA 4G36A 1E6KA 2KB0A 3OJXA 4LYDA 1QVZA 2F9ZC 1P2TA 1IY9A 4UE6A 4L1KA 2C29D 1YB5A 4RZHA 4X88A 4FLMA 3IAEA 1KJIA 3ADPA 3CCEF 2WK1A 4FMPA 2X4DA 4ROSA 5U4QA 1WY7A 5C35A 3VBEA 5HRCA 1A5ZA 2XEDA 2ZWVA 3PV0A 1AO3A 1A82A 2FUKA 3MHTA 3EX7C 3U0BA 4QRDA 2P0EA 1UBSB 5LB4A 3R9IA 4BKUA 3D31A 3HRIA 5IEBA 2VDUE 1MHPA 2C2ZA 3LYUA 2H65A 3BA1A 4BVJA 1EVKA 1JILA 1HY3A 2GHIA 1DIOB 3BA8A 3K92A 4DLWA 4UXHA 1UWKA 4LOKA 2QRLA 4ZAXA 3CLVA 3IULA 3RS8A 1D2RA 3D02A 3PFFA 3IVCA 4CEHB 2LBXA 2P27A 4CQLA 4X8HA 4KB5A 2C2XA 2PMPA 5IDYA 1VRVA 2O5CA 4ITVA 1WY5A 2XDQB 3T3IA 4HYQA 4G0UA 4G37A 3VU8A 1L0BA 3MMNA 5F21A 3ZU4A 3N8HA 2H5IA 4F3CA 3NWBA 2HHLA 5DIFA 3RBXA 1BHAA 4ZEMA 2Q1TA 3OZIA 4GBGA 4RIFA 3ZOKA 4BC0A 1ZOPA 3HB3B 2RKBA 2BAGA 4UUAA 3S8MA 4KE6A 5CD9A 1XU9A 3T3NA 1Z4OA 2QGNA 1YI0A 1OASA 3G2KA 3GLRA 2IF0A 3TO5A 1OHHG 2DWPA 4K26A 4M6WA 1PP4A 4L9WA 2P6RA 1Z0JA 2WLSA 1YMVA 5HEKA 2DYKA 3DVAA 4FDTA 4G97A 5GQSA 1RPNA 3NU1A 2REQA 4Q24A 3FB4A 2NO4A 3CR7A 3ELDA 2CN1A 2DQ3A 3CCBA 4FOTA 4MPPA 4MAFA 4MR8B 2HNBA 4NPCA 2A6PA 4BMCA 3OPYA 4L8YA 5EMNA 1CXZA 3IKMB 2D0PB 1UFOA 4CM7A 1DQNA 3IQIX 2X1HA 3WTCA 4FDAA 3BG5A 1BVYF 3RVLA 4BLPA 1TIBA 2X4IA 1H0KA 5EZYA 4CF6A 2PWPA 1QGED 3L5OA 2C4UA 3IC5A 2O3RA 2VFAA 1KIMA 1FP4B 4E7PA 3D2AA 4YALA 4BLTA 2DLCX 5KTOA 5BR4A 3B4SA 3VHXB 3RHZA 3VYSC 1AD2A 1PK9A 2HPZA 3I2JA 2I2DA 3ANLA 3AR3A 4K6HA 5T41A 1Q82W 3UF0A 1S2OA 4HBZA 3BD9A 3L6RA 5ECGC 2ZBDA 4M0EA 4OYYA 1ZAKA 3N9IA 3UGKA 2AN4A 3ZD9A 1H85A 4A0FA 2OVFA 3KKEA 1JJFA 5LQKA 4DLSA 3AFHA 2UUPA 4WFGA 1D8TA 3VO9A 4RKQA 3ID6C 3EFBA 2OZEA 2W48A 2EL7A 3BREA 4IVQA 1I4OA 1NTOA 3CTPA 3Q2IA 4AZ3B 2ZRGA 1YB1A 2UUOA 3Q3CA 2CMGA 1NBME 4PDLA 1ZRSA 3DWGA 1GZSA 4TN5A 1AKQA 1NF3A 3ZE8A 3SVTA 2HQ1A 3DOUA 3K1AA 1N0UA 2K4MA 3G13A 2NMVA 4IFTA 1XXHA 3TXSA 5KYTA 1RVV1 3SHVA 1DC8A 2X2PA 5C5CA 2HTFA 1SH7A 2HX0A 4LXGA 3TLCA 3WHLA 1DIGA 2V9YA 1PLJA 4PWZA 3LSQA 2RHCA 4GIBA 3OAAD 2OLEA 3PKZA 4FHGA 1RHQA 1MRSA 1J5XA 3K5HA 3R5TA 4CLOA 2O19A 2O9JA 2NVUB 5EBLC 1QNMA 2GEJA 1KYWA 1YA4A 2AMLA 2H8PC 4FLXA 1RCTE 3G6WA 5FOQA 2ZTSA 2Z8YA 3IELA 4TV9F 1Y1SA 3IEMA 1TJPB 4TSKA 4YP6A 2PKCA 3GN1A 4Q3AA 3FG9A 4RPKA 1UJMA 4L02A 4A16A 2P11A 1MABA 2P6YA 1V25A 1A8IA 1P44A 3LO8A 4V0NA 1KVSA 3KE1A 3OZDA 1XAIA 4B4DA 3MHSC 5D3MA 5H0IA 5A3VA 1K5SA 3NWOA 2Q6TA 2G28A 3T3DA 1JU9A 3HA3A 4FP9A 4FXOA 5CLJA 4KPUB 3UOAB 1OAOA 1JHAA 3EWSA 2X5XA 1SURA 2RI1A 5EQTA 4PA7A 3V9AA 5KDOA 3BZBA 3DDUA 3DV0A 3U37A 4D3YA 3GJTA 1JOYA 4DB4A 5E7IA 2VDKB 1EG7A 1RI5A 2I6RA 4ZMRA 5K6AC 1JJ7A 2PUGA 3DXRA 3LNNA 1KC3A 1NNI1 1UBJS 3WIUA 2HIMA 4DB2A 3FX7A 5AVTA 1N4CA 4CQMB 1JPUA 2O4UX 2J0UB 5MHTA 4JJ7A 3OZFA 3KSZO 1N4AA 4KO4S 1J9ZA 1N0HA 1GGNA 5EXDA 4R7CA 3PLAC 3S0JA 4EARA 4IDQA 1M9NA 1N2CA 1JG6A 3MCTA 4QDXA 1U3DA 3RK0A 5BWCA 3FW1A 1NN1A 3NI2A 4F4DA 3EE6A 4NG5A 1DBWA 4M8LA 3AB3A 1ECGA 5DIZA 4MHTA 4LFBB 1VDMA 3MLBA 2WD8A 3V8BA 1GN4A 1NAHA 3UTDA 4G09A 1PNOA 3WDKA 3EXIB 2YW9A 2QTNA 2WE8A 5EMLA 2HYDA 1D4AA 4I4LA 4CYMA 4UTPA 1P0FA 1I3LA 2Q1YA 1UPAA 2J09A 1CEZA 2A9PA 2BKEA 4UOQA 2O07A 3W5UA 4MAAA 1DIHA 4MROA 4V0RA 4YMWA 4KUHA 1BQZA 3D2BA 3RSOA 1P1KA 2K2QB 1RYDA 4MS4A 2JKZA 4RIGA 5HFJA 2IOHA 3JALB 4JX9A 1JQBA 4FZVA 4UNPA 3HJWC 2OQIA 4GO1A 4AF7A 4HAZA 3P0EA 3PC8C 4IYIA 2CJYA 2GCIA 4ERXA 3GDGA 4DCMA 4DV6O 4BIOA 4FEYA 1VL0A 4UCUA 4LBYA 5DCLA 5FFNA 3K03A 2C96A 2M1XA 3VQWA 3OA0A 2JK0A 4FONA 3UJCA 4X92A 3GUYA 1MPXA 1CJUC 2HAEA 5EPUA 1Y81A 5K0GA 5KINB 2VT2A 4BEBA 4HEJA 1STOA 1U2PA 1T6NA 2JKVA 3PNPA 1LLQA 1BW9B 1TAHA 1RAIA 4QATA 3ZHXA 1U65A 2PLWA 2X2OA 3ET4A 3N6RA 3RRZA 4JI0B 1PDOA 2D00A 3MPOA 5B8FA 3REGA 1B0UA 5HJ7A 2BYTA 3PHIA 2I03A 1J39A 3VR5D 1OLXA 4HH1A 4HWSA 1D0SA 3FCSB 2BN4A 1AY0A 1ZQ1A 4G5OA 3O0DA 1F8UA 4US1R 4DR5B 3OM1A 3AONB 4JEIA 1QBGA 1Z5OA 5JJCA 4NLLA 4RNCA 1RC1A 4MW4A 3WLHA 1SZXA 4QJ3A 2FW9A 2C3OA 1MV5A 1CJSA 3BILA 3KD2A 4H0CA 2P5UA 2H1RA 4Z2YA 2HK7A 1TIPA 3BHNA 1JB1A 2VN8A 1SUCA 3NH6A 1W35A 2HJ9A 1M54A 4Q4HA 4I1SA 4LCJA 4KRGA 3QTLA 4QPDA 5ALPA 5EEGA 2F23A 1SCDA 3T7CA 3ZI4A 1ZLXA 3Q0EA 3IDQA 4ECAA 4BNDA 3DHEA 3GZTB 2FX5A 4M0MA 1TZMA 5CA1B 2A88A 1RZUA 5I7UA 4DJEC 2AG6A 1AA9A 1KZ4A 5MFPA 2QZPA 3Q3HA 2PM8A 4UCOA 3OJFA 4BZQA 4LKRA 4YCSA 5DP1A 1JPVA 3IT1A 4BX0A 4LDZA 3HN6A 1OZHA 3RYCB 3GFSA 2OIEA 4IIJA 1I4LD 3OFSA 4QUHA 2E4WA 2JDIA 2ZPTX 2UXBB 2RGDA 3WGHA 4I2VA 4HZIA 5FLXN 1QNLA 3K9BA 3FMPB 3AP3A 1JHDA 5FKJA 3WQHA 2ZB3A 5EWJA 4R2WA 621PA 1X1SA 2FW8A 3PXCX 2RGUA 4B8ZA 1RQRA 1YVEI 3EZ7A 3FFTA 4KTTE 1M8KA 5EE1A 5E6RA 1RMYA 5ADHA 2HK6A 3WLNA 4D4HA 1U2RA 3JQAA 2DFNA 2I62A 1BOOA 1H4QA 4NJMA 1N33B 3CJHB 5BMVA 5HK9A 2NO5A 3OD5A 4NP6A 3FE2A 3B3JA 3STLC 3NBYC 1KC8H 1LC3A 1OU0A 5IC4A 2O8CB 2V4UA 3GFTA 4E5NA 3VV2A 5B58T 4HEA6 4FNGA 4GP6A 3GLIE 1JDJA 4WLNA 4BUCA 5KIAA 2HK8A 2GM5A 5GANK 4CTNA 4DQVA 2IOQA 5KVAA 3K8ZA 1BAPA 4IIFA 5FI3A 1W75A 4Q3KA 5J9PC 1GADO 5ADUS 4P08A 5DZSA 3VH1A 1CRQA 2ATCA 2JAWA 4K9LA 3IXLA 3NHKA 5KYXA 3LAWA 3QU4A 3FTPA 1Y6GA 3BEDA 2QAGA 3K8OE 4I1UA 2ZUDA 5JS7A 1JF8A 2Y4TA 4H44B 5JLAA 3LWNA 1W34A 5K0BA 3M6MD 4BHTA 3FD8A 4DC0A 2Q9CA 2HPHA 2ADMA 2R66A 3T1NA 5TJHA 2VPZA 1ZOSA 4XQ9A 3K1JA 4PI0A 2P2YA 2RMKA 4I5DA 3X3HA 3TR5A 4PC7A 1RW4A 2QTBA 2WP8J 2UXXA 4WNCA 1YQEA 4BKRA 2GFHA 1P2SA 3HJBA 3I5DA 3IEUA 4HDKB 1CUSA 5FQNA 1DJOA 5KVVA 3G88A 4A8TA 3FRJA 1L3IA 3SZOA 4Y2HA 1W2WB 1SHZA 3SVLA 3E3MA 1PWHA 1IEXA 3SIPA 2H2WA 1V3TA 2JVIA 1Y6ZA 3DBHA 2O05A 1R66A 2EERA 3P9ZA 4K0RA 1ZNQO 2G8LA 5FTMA 2WJYA 3AG2C 1XN1A 2RB9A 3VBCA 4MYSA 1RZ3A 1Q0PA 2WC1A 1XQ6A 2JLWA 1WM1A 2FFRA 1VQ4F 1EFKA 4Z8XA 4MV7A 3ZTTA 3KB8A 3H04A 4TN1A 4XSVA 4P58A 4CMIB 1E9SA 4NCNA 4GOKA 1H93A 2IS2A 3LSTA 3DCJA 3ZMUA 1PK7A 1N2JA 5ELMA 3R6GA 3FH0A 2XXAA 2OV3A 1XNGA 4KUGA 5CRIA 4ALJA 3GG2A 5DBOA 3TSCA 4MUAA 3Q9LA 4EKEA 1FXKC 4DQ0A 3CVXA 1IV1A 2DOSA 1NZFA 2O2SA 4TL6A 4Q66C 2YDYA 2CSXA 1V0JA 2QUKA 1VE5A 3RB8A 3RYTC 4YK7A 3BJRA 5ALHA 4HFJA 4LHWA 3CMAF 4JQZA 4AZTA 5KCZA 5KSZA 4ME6A 1HMPA 2DYRC 3P30A 4JS0A 1KBZA 3FCXA 3P4UA 2WILA 4DBLC 4MINA 4CMJA 1IXKA 3S0WA 3S2ZA 3TBKA 2JK5C 1N8TA 4IY1A 1T4MA 4GBED 1XCPA 3BRQA 3TNDA 4RF5A 4JYYA 3CHYA 4ZGGA 5BXZA 2V9CA 5DBGA 3PEEA 1NW9B 2JI9A 1O95C 2IYVA 1ZD5A 2PMKA 2QKYA 5GPBA 2QVBA 4B3RO 1GARA 5C7IO 2WHQA 3WHIA 3ETDA 5LGTA 5D1NA 3EC7A 4J0HA 5JNWA 3VKGA 4KOAA 1QVFU 3RJTA 3K53A 2HBZA 5JWHA 3P10A 2X3FA 1XMQB 3EIXA 1A2KC 5IASA 4LRQA 5I7HA 3H2HA 3PK0A 5THXA 5A0VA 2NYVA 5GONF 3EORA 1T10A 5AW8A 5LQAA 3O4VA 3GLGB 1U1DA 3EMBA 5K3BA 3ZVRA 3WZLA 4BFXA 3HWX1 2H08A 2ODNA 5CAEA 4NZMA 3L7QA 2ADOA 4OXKA 4UAJA 4PYLA 2BGGA 4RWUA 1UJ6A 3VOAA 3F6YA 4OK5A 5TQ2B 4PYIA 3T2MA 3JASA 1R88A 3DOCA 1DFGA 2P4EA 2M6LA 3JYCA 2LV8A 3P0IA 2QE6A 2YWDA 3ANNA 1H69A 3FTFA 4U02A 4F9TA 1DBRA 3FD5A 1XZKA 1F8XA 3P9XA 1DKRA 3GDFA 3E3AA 4Q7QA 5TARA 3G79A 2BHSA 3T95A 3FVQA 2HSZA 3MUEA 4GPAA 2OSBA 5ENVA 3I9V6 3W5VA 1V47A 5EC1C 2PZAA 2ZVDA 2MYTA 3C48A 4TV8F 1XF1A 3DPUA 4F8JA 4AZSA 3ENVA 3KZXA 2YVAA 5B30A 3H9VA 2PYDA 1NKSA 2FPOA 4FXPA 1A1VA 2O6LA 1M2WA 4OFZA 5JDCA 4MO9A 1F9AA 2EF1A 4OUDB 3GJ7A 3WICA 5BR8B 4O4JF 2QVZX 2C9ZA 3ZE1B 3KXKA 3PN1A 4UV8A 1YDXA 4TSFG 1E1NA 1S4QA 4EB8A 1I4DD 5LHIA 1GZVA 2UU9B 1RDFA 4O1MA 1C2TA 3O82A 4JGSA 3KUKA 2OBNA 4BNMA 4E30A 2ZBPA 3NTVA 1Z25A 1SC4A 4XOUA 4P7FA 3KR9A 3MTDA 1YZVA 5ISMA 2AGAA 1U80A 2CNBA 2JAXA 3QEOA 4FOOA 4YWJA 2VQ3A 2QI2A 1Z07A 4BB5A 2Q5EA 2HBQA 4UC0A 4X8AA 1EESA 2QE7A 1N0JA 1Z68A 1XL0A 5BWMA 2HT1A 2F8SA 1UMDA 3FJOA 4DC9A 1C50A 2NXEA 1EEXB 4B5KA 4PGGA 2VBFA 1P9NA 4UD6A 4BN4A 1Y3IA 2W6NA 3VKHA 4P2GA 3GU3A 1PNTA 1ZC4A 1JBKA 2UZ0A 2WYHA 1J23A 2XDQA 1V1RA 3DV9A 1E5TA 3WV5A 3SHWA 4UMVA 4PX5A 4BVEA 2HT6A 4XWKA 4C14A 3U19A 3IP1A 4B73A 3K15A 1BHQ1 4JUBA 5GZ6A 2BCEA 1AI6A 2CDAA 1BCRA 5E7MA 3TQQA 2ACKA 5KTTA 3G71V 2ZBFA 3DF9A 2SCUB 2GVNA 4Y30A 4YCLA 1FUYB 2KYRA 3C6ZA 3I1IA 4HX5A 5AJZA 2VJAA 3OHSX 1IUOA 4PS0A 1PJAA 1PRYA 2CTWA 3A1NA 3CNNA 2R7NA 1XHZA 1PT5A 3PAFA 1PFGA 2I9PA 4OHVA 1I2AA 2Q3JA 1KJNA 4J7ZA 5L3EA 2JEOA 4DUZB 3MTGA 4S1WA 4P7GA 3VOSA 1E32A 1FVOA 4M6WB 1G9XA 3HKDB 1S2IA 3F6PA 3UKMA 3DVAB 3DOIA 4DXWA 4M9ZA 4X94A 4NCAA 4G23A 1RPRA 1FEZA 3HUUA 5H9CA 4J11A 2N04A 1ORHA 2J5XA 4DPLA 3DOHA 1U8AA 4UB6Z 4GKVA 1KAOA 3EVTA 2ZVYA 1CXZB 3E1SA 3F3SA 5AVWA 5EN4A 1FP4A 4A03A 1BDHA 3CTMA 1BQ3A 4HNRA 3ILVA 1GTL1 1YITV 3VHXA 4AP6A 1IDSA 1D0IA 3EQZA 4RMGA 5EZYB 2EFCB 4US2R 1P8JA 5KHAA 3MILA 3OPNA 2FVXA 2L0XA 3EZ2A 5E2AA 1DQYA 4JIMA 3M6IA 3Q41A 2IZ0A 1X9GA 3EZ6A 1JNYA 4EIWA 4PGAA 3HYCA 3UO2A 3UXYA 4DV5B 2BZSA 2F66C 4D56A 3LPMA 5J2UB 4RKEA 4WFFA 1ZD3A 2Q6IA 3SE0A 2QZSA 3BE4A 1CU1A 4HVTA 4Y2VA 1QLEC 1BXRB 3O21A 4NNOA 4CCSA 1RXCA 3STUA 1LWOA 5IXJA 4NU5A 3OW2F 1GLNA 1JEJA 2R9VA 2LO1A 2OFXA 2D7CA 2O8EA 4ODIA 1B41A 2C3UA 2KQUA 4OLHA 3AZQA 3WQSB 1RI2A 4FILA 2JBWA 3GH1A 4W9RA 1W25A 2GM9A 4F2PA 2PL9A 4EAQA 4BVLA 5MN5A 4U6QA 2V8BA 3FVVA 4Q48A 3LBAA 2CHFA 4R5MA 4JB8A 1TC1A 3G1TA 4BP3A 1I5RA 4KIUA 3LUJA 4CM9A 3AK4A 1TXGA 4B46A 1U3WA 3OSZA 3N3BC 1I3KA 1SULA 1LJUA 1TJ4A 2PUVA 4QL3A 2HBRA 4F4LA 3KAQA 1UJCA 1LJLA 4ENRA 4TS3A 4DFDA 2B21A 2CF5A 4FW8A 3WJ7A 4L0DA 3S7ZA 3ZE6A 3NUZA 3UJNA 4EELA 1H2XA 5BN3B 3K0AB 4NEHB 2I1QA 5JQGF 2EIKB 5KS2A 2L82A 4H3VA 3HWRA 1F20A 2WLIB 2FV8A 2HF8A 1RJFA 2CE2X 5ALWA 1S76D 1FCJA 2Q7XA 2QDXA 2WTXA 2W8BB 4HH4A 2WWTA 3ILSA 1IZ0A 2BF4A 4QEKA 3VGPA 5EMHA 5AQEA 4KYUA 4XBFA 1MABB 1YB7A 2LCQA 4C4XA 3L40A 1E18A 5B3JC 4PI2A 3PEUA 5A5EA 3O1HB 5C9ZA 1AQUA 4PRZA 4NYJQ 3VNSA 2IP2A 2OHXA 1RLJA 3VC7A 5JBQA 2GPNA 1H2LA 1QIDA 2AZTA 2VBGA 1M56B 1GL7A 1CB0A 5K1XA 2XUJA 4NECA 2HU2A 5HKAA 3CZMA 1LTKA 4EVIA 2G4CA 4P3KA 2DKNA 4GGPA 1CZRA 3DV0B 4YJ2F 4CQMA 1XZDA 2J0UA 4AY5A 3E8GA 4MTGA 1QIKA 5JCOC 3O8BA 2J59A 1EM6A 3RVOA 1GZDA 1ZIYA 4G25A 5AHWA 4FBLA 1BDMA 2V7VA 4NCKA 4JLSA 3NEPX 4HGZA 3CMCO 3CD6F 2W8ZA 1AT1A 4DV1B 5EUBA 3CE2A 4GOXA 1FJHA 3T7AA 1IOZA 1PJLA 3F5MA 1GKIA 3GLUA 1FP7A 4V03A 4GMKA 4MKFA 4C01A 3G0DA 4QPJC 2X2EA 2JGUA 3RSFA 1G42A 2F48A 1WN7A 4PANA 4YV0A 3H9JA 1P5ZB 3PUZA 1EXMA 1VIYA 2QVLA 2Y6VA 3APQA 1KEPA 3EZYA 5KOHA 3CW8X 2WW8A 4DRXB 2BJVA 2G80A 4G84A 1O9BA 2JJ2D 2DWCA 2CXPA 3GBSA 1AJPA 5SZHB 5JXJA 5FWDA 2P9CA 3TZLA 4A8HA 5JS1A 4QXQA 1E1QA 4MS4B 2RGAA 2IOYA 2JHCA 4FZRA 2X0DA 1R9JA 5LD2B 1LVGA 5JJJB 1HYQA 2DE0X 2FN3A 1D4ZA 1YASA 2LP4Y 1K06A 3BSYA 3ZCQA 2ZR2A 3OWHA 4LPKA 5I7EA 5DBEX 1I9GA 2Z1DA 4YJKA 4YRKA 3VPFA 1BW9A 4TZZA 4TKUA 2POCA 5L4LA 2GZDA 1SY7A 4J7KA 5ED0A 4RULA 3L3BA 5CFLA 2X0EA 4P5PA 1GPBA 5JMOA 9MHTA 1X2EA 1RLUA 1WPRA 4LSWA 4X60A 3ND9A 1CIVA 1BG6A 4DWVA 3J80N 4NDZA 1AZTA 3AYZB 4V24A 1XQYA 5AI9A 4PLYA 1JWAB 2VUTA 1G6OA 1YHYA 3EBPA 1D7AA 2OOKA 2JIRA 3NBZC 1PZEA 3GPDG 3CCUF 4J91A 5DRTA 1KRWA 3E05A 1F12A 2GF0A 2NU6B 4XIIA 1I7NA 4ZVVA 5KX5B 1KB9F 2XYRA 2FPKA 3DEHA 5A71A 1FXWA 1DDGA 1LQ2A 1CLIA 4UBIA 3COWA 3U7QB 2RHOA 3SNKA 1VBNA 3ZGYA 2DLDA 1SD1A 1TQ4A 2I6UA 3IHWA 4CTJA 3QLUA 4LJ7A 5CA1A 1QTNA 1VI2A 4R1SA 3COYA 3WIVA 1P0CA 4MW6A 1JIQA 3Q0TA 3E53A 5JW6A 3IQDB 1V54B 2EZOA 3ZXYA 2BDUA 2OZBA 1ML3A 2FQXA 4L08A 4GBJA 1ULTA 2DCUA 3T1OA 1POWA 3GJ6A 2O59A 3RYCA 1EIWA 2GZHA 4NS4A 4INOA 4JY7A 3CPWF 5GJWC 2HCJB 5T8KC 4XPIB 1Z74A 5A1JA 3R4VA 5ESRA 4Q19A 1GYQA 2A5FA 2G5GX 2FWRA 1CTQA 2CJXA 3T5MA 5FPOA 3LPLA 4PV1B 1YKSA 3LMEA 4HLDA 1Q86W 3WDMA 4PDRA 1W94A 1PT7A 4L85A 1SUBA 2GTIA 3OQVA 1AM4D 2VWPA 2Z6UA 1E1YA 3FUVA 3CJHA 3K31A 1O9GA 1KFEB 4GPIB 4EI7A 2ZR9A 1NP7A 1P91A 1QFMA 1OVMA 3E5RA 2I8AA 3GA7A 3NIFB 4G1CA 2O8CA 4L27A 4UHBA 4J90A 2MR5A 1QRDA 3RNLA 5C2JB 2I99A 3LA6A 3FPEA 4KX5A 3UMSA 1VHQA 4DWJA 5BMVB 2R2AA 3UV7A 4I0WB 3DLBA 3LNCA 1QGZA 2FHPA 1YVPA 3W4JA 4IUBS 4DJ5X 1QFJA 3PI7A 4U7GA 1VQ7V 3EXHB 3KFXA 4OGLA 1RIFA 3HKCB 1WULS 4EYSA 1T2FA 4REQB 2FI1A 4FS3A 1GSIA 2C20A 1G41A 3KSDO 2Q3LA 2V6GA 4UFZA 4YV2A 3HN2A 3K9HA 3J81A 2AC7A 2B37A 1OW3B 1WPQA 4X0EA 2R72A 4KLAA 3I0ZA 721PA 2C1XA 1B06A 4CKBA 1I2BA 3BPSA 3TQHA 4MP8A 2YN4A 4S04A 3F9RA 1E2UA 1LA2A 3SPIA 5T5QA 2FKXA 3ABKC 1ZK2A 2P41A 5KNBD 1N2HA 2G0TA 1VIAA 3SR0A 1AKWA 1SOWA 1Z0DA 2UXNA 2DPMA 5HOQA 2VHTA 3PYMA 3BA6A 4IQGA 2GXQA 4LJRA 2XV1A 1WDMA 5B7PA 4HDKA 4C04A 1F2VA 4GE3A 4YT5A 3E5MA 3NAZA 2J5QA 2Z5FA 3L6DA 5DN9A 4ARVA 4CS2A 2UV8A 1EJBA 4RVSA 2I78A 3C15C 5EIFA 5GOTA 4HN2A 2Q6OA 2EKDA 2YASA 5H82A 3O8RA 5IMBA 4DILA 4YCNA 3G6EV 5HW0A 2HA6A 3KU4A 4HV4A 1AG9A 4EA8A 4BFWA 1Y3CE 1JEDA 4ES6A 5F51A 3LDDA 3E3LA 1MQAA 2IEGA 4CMIA 3Q4HA 5FH9A 1KAMA 3K58A 4ZOLA 3FETA 1GJRA 4ENWA 2B99A 5L3BA 2A59A 2F9LA 2JZNA 4MUYA 1EP3B 3KQLA 2YYYA 1OHHD 4PSAA 2VOJA 4AQDA 4QQRA 3AILA 3DBIA 1JIKA 2VK2A 1KTVA 4RLQA 4IGKA 2NLOA 2ATVA 1ONSA 1VHWA 2X0IA 3K14A 5TF0A 4D98A 1YUBA 4BQSA 4DR4O 2R2GA 2GAJA 1G8YA 1TT7A 1S5HC 1IG0A 3ICOA 3AM3A 2Z2YA 1Q7CA 4I0XA 1JGTA 2PUFA 4B8WA 4CT5A 1T0HB 2M1ZA 3PX7A 4DREA 5AXBA 3I3FA 3T3HA 5CNIA 3CZCA 3O26A 3V6MA 4GAEA 1LF0A 1NZJA 2C82A 2Z83A 2XZDA 3DKVA 3O03A 1WD7A 3LUAA 4BX2A 5COAA 3V3KA 2IP4A 3EARA 2JLBA 1UC4B 2QRJA 4CCWA 3AL0C 3ABMC 4JKIA 1HYHA 1VIMA 5BW4A 1G5PA 3AOGA 4RGBA 1PYGA 2QP3A 3K4PA 2JGKA 3LQYA 1VJTA 4HLQB 2C78A 2A9JA 1YAJA 2G7MC 2I2FA 3FD6A 4CETA 4WWHA 3PDUA 4JXJA 3RKSA 1XZPA 1RKUA 5KAPA 1N8SA 5LQDA 2CHQA 3GLGA 5C93A 4TVOA 5HM6A 2BISA 4YGYA 4YQFA 2TMKA 4E3WA 3HA5A 4B76A 4TUYB 1QRRA 5KC8A 2QTCA 1NURA 4TVBA 2P9GA 2BFPA 4KO8A 5HS6A 5DN6A 5TQ2A 4DMLA 1VQVA 1SBHA 1ADJA 2Y1CA 3HO1A 5AVMA 1YCDA 2YQ5A 4B6OA 2W43A 3D8SA 1YJNV 2EINB 1OROA 2ATXA 3ACDA 2GYWA 1HG0A 1N6PA 5FBWB 3MF4A 1SBTA 3PXDA 4EUSA 1E96A 5IFKA 5EIBC 2IPAB 4IR7A 1ENZA 3K0SA 4ZMSA 4I4CA 3IGAC 2LBTA 1C3OB 1K27A 1KY4A 2KI5A 4C43A 1V1JA 3BH0A 3S4YA 4OHFA 3EJWA 2XOXA 3ZHTA 1F2TB 1T0IA 1OLUB 2HA2A 1FLDA 1GRRA 4GRAA 1IUPA 3VSBA 4GZ6A 1SCKA 4DHEA 4KL8S 5D5QA 4MW5A 2YJNA 4LXIA 2XNJA 4C0HA 4CIVA 4K3AA 1B8UA 5FUQA 2AX3A 1VIBA 4QUKA 1GCOA 4OUDA 1TX4B 1KYTA 2EKQA 2YWXA 1A5SB 1QGUA 1Y37A 5A03A 1FU8A 3FA2A 4P0PB 4LRYA 5AVXA 5EC8A 5F2NA 1E3LA 4DMKA 1I1HA 4U8GA 3GNTA 2PFGA 1Z15A 4IDOA 5D00A 3C7DB 3M9XA 4DSZA 5HP8A 3K2BA 5A4KA 4UDNA 1NTZH 1M1ZA 7GPBA 2QJ1A 1EUCB 2PXHA 2J7PA 2QLLA 1JR3A 3AFIA 2ILVA 1N75A 1U8XX 3EBOA 1GIAA 3C3EA 1NWHA 2H6LA 5KQPA 3VJRA 3DZHA 3LBFA 5K2MA 2AZXA 4OHKA 3KX2A 4EKDA 4G0OA 4ZVNA 1MAHA 2QN7A 3TVTA 4UCQA 3KT3A 4LI3X 3CCCA 3F74A 1V6SA 4AZ0B 4XVCA 1HF3A 3VZBA 4XE5A 1AQ6A 3K2XA 4ZT4A 4ZK6A 5CFZA 3C3BA 1TU4A 3L6CA 1LC0A 5F7XA 1JLLB 4A26A 3FYDA 1UMDB 3AFNA 3L04A 1VXRA 4UVIA 4WCDA 2C59A 3N70A 1LPMA 3OZ7A 2QK4A 4OSEA 1C7EA 3OURA 4QTTB 3NIWA 4L8VA 3VTZA 3HK2A 1NBOA 2Z56A 2QPLA 4DG5A 4JF3A 4TWKA 1I51A 4MV4A 3L49A 3CZ4A 4V1CI 2V0GA 1ZMTA 2AZ0A 2WYOA 1Y33E 2WJAA 1QORA 4IQFA 1V1RB 2OC9A 5TS3A 3E9RA 4L6CA 2SCUA 2XBMA 1YL7A 4WDQA 5I4CA 1MB4A 2KS6A 1UZNA 4UTXA 2XOKG 3PHCA 1SJ9A 2EP7A 1GZHB 2WZDA 1X7OA 1E99A 3WSVA 3E7FA 1BCRB 3NAGA 2E48A 4R69A 2C5GA 5FUMA 1YVUA 1RQNA 1WB6A 3NCHA 2VA9A 3H1LH 4I55B 4Z7JA 4D8YA 2A86A 1S2MA 1CDOA 1KOLA 3U1VA 3HKDA 3RIEA 4LUCA 2VJQA 5TEVA 1KKMA 4EW2A 2GX6A 1PR3A 4I1YA 2NO0A 3IVXA 3SX2A 4J0IA 3RKRA 1PYDA 3TR6A 4LF8B 4ZGWA 3IVMA 3BXFA 1R1BA 3NPMA 2BM0A 5AJVB 3PWSA 3GGJA 1OFGA 1E4YA 4P1ZA 3TTUA 3IEKA 3WLEA 4X1KA 4NG4A 1ZIPA 4D2IA 4G0VA 1Z4KA 2YHAA 4P93A 13PKA 5KPDA 1FNBA 2QM3A 5L3QB 3RG8A 4M38A 3OT1B 4GE0A 4BCCA 4XEHA 3KU1A 3K6RA 1ZD4A 2ZRKA 3WY9A 5IBRA 2LW7A 1IG3A 1EHIA 2X8LA 2OO5C 3WK9A 1IHYA 3WKBA 3CG6A 2ZJYA 1P4JA 3IEPA 3P0RA 4B6RA 4LISA 5J2UA 2B9VA 1T35A 4MR7B 3CMMA 4KLZA 5L4NA 3MTEA 4WD3A 2AFVA 2Q7DA 1BXRA 4TTSA 2G9IA 3V5NA 2RG7A 3V4LA 3NPAA 4WTOA 1I6KA 4DLVA 2R6GA 1GKYA 1TVKB 4XIYA 1YQNA 3DO5A 2B7CA 2RHDA 3QVSA 421PA 2YWBA 2AS0A 1BD4A 3OE4A 3G1UA 4CDRA 3LWOC 2XAGA 3WVNA 1ENPA 2PZEA 4ISCA 1OXKB 2O8EB 4C7XA 3DFKA 4YRGA 1C1HA 4XJSA 2PBZA 5L3VA 1XCGB 3VR4A 1U9IC 1SRRA 3UYLA 4O4LA 4DYHA 1CUIA 3TNFA 4IZ6A 2AYYA 4BBZA 3BPZA 3JR3A 5JXHA 3BCHA 3DTVD 4RK6A 4X97A 3A9RA 2R25B 4LCBA 2HQOA 3IPYA 4EG7A 4AIIA 1LBIA 3OCWA 1E89A 3FOFC 1A32A 1TZKA 1MT0A 2I1LA 2J3HA 3GVXA 1H5UA 3PFNA 3TOZA 5HIKA 4OIMA 4FOLA 2QMYA 3I1YA 4G1VA 5FBZA 3ITNA 5BN3A 1E1CB 3K0AA 4MVYA 2CXRA 1UP4A 1UP7A 2WLIA 4KCGA 2R60A 3JWJA 3PTZA 4JMLA 2W8BA 1KFBB 4GPBA 1KERA 3OX1A 3PX3A 3Q11A 2PVCA 1FTSA 1XZIA 1WMSA 1EAYA 3KC2A 2B98A 1VYUA 3LCRA 4IHKA 2EJ7A 3RTBA 4X66B 2QVCA 1ZONA 4KSYA 1C5KA 2FZGA 2XW6A 3BXZA 2ZCJA 4JC0A 5KDDA 2X8JB 1QANA 3OZUA 3HTNA 4UDXX 1ZU5A 3QVWA 3BK1A 4RETA 5LNK6 3FCUB 2WUWE 3DGEA 4LZZA 1KP2A 1YTFB 4K2HA 1YRYE 1ECJA 2HXGA 2VK4A 3IAUA 4Q03A 1WDKA 1GPWB 3SJBA 2BFOA 2G9RA 5HFLA 3ORFA 1Y0BA 3A2KA 4Y1FA 2PGGA 2RE8A 3CA8A 4RGVA 5E1BA 3JCZA 3IX7A 3KQKA 4DDTA 4RMHA 4AP9A 2PX2A 2WPDA 4H6WA 1S6YA 3GJYA 2JH9A 2DYYA 3EFEA 3C43A 3E5HA 4BNXA 4GC9A 3O75A 5A4AA 1CF4A 4BGEA 1TEHA 2J3QA 1R6AA 4B3MO 2YXPX 4JL6A 3P4YA 2VK1A 2D0DA 5ECWA 5ADWA 3H2SA 3O9VA 1CEXA 1X7DA 1UBHS 4B3FX 4RDHA 3C9RA 4OB8A 4YR7A 4J10A 2XUKA 3ROFA 2K6GA 1T0UA 3Q5GA 4DNOA 4U4AA 5JDIC 3RVRA 4QOIA 3SD7A 4AY4A 4DRXA 3Q3IA 3QEMB 3TEMA 3KBBA 2OILA 1XEWY 2EJUA 2NADA 4AULA 3LC7O 1N6OA 4P92A 1IXZA 3UMGA 4H3HB 1NVPB 2FE4A 4RY0A 2EHDA 3DZGA 5KOHB 1OI7A 1YEWA 4EDFA 3CEAA 1LW7A 1CZKA 4PYRA 1LUVA 5JAPA 4DA7A 4JA2A 2DN9A 1TZCA 2GSDA 3DEYX 4C0XA 5HCUA 2DHCA 3H5VA 3T1HO 1A77A 4MPTA 2MSLA 1M93A 4XDJA 1U6JA 3T4DA 4FLZA 2D0IA 4YJ3B 3GMTA 4IJMA 5KNDH 3HXPA 3NNNA 1CQPA 4NESA 4H2DA 3UKDA 2G09A 4TKUB 1V55B 5A4JA 3NTRA 3RIYA 1C7QA 3DYVA 4BO2A 1XRRA 4OSOA 3KQQA 2XTJA 3VVCA 2NU6A 4IIUA 1ZW6A 3ZHRA 3LE8A 5KX5A 1GCIA 4R1LA 5LVAA 3WB1A 2QN8A 3NZEA 5FADA 3RAJA 1HFKA 1N8NA 4TXMA 1OCZB 1DOZA 1GUYA 3SYQA 1MAAA 2HTEA 3U7QA 2FSUA 4MV5A 2KX7A 2RCNA 1YZFA 4JT8A 4RSMA 2ZXWB 3BSSA 1YWGO 4MT8A 4EGAA 4P36A 3K08A 2R44A 3IOYA 2DBRA 3FHJA 2NOAA 2JJ1G 1LFDB 2CFTA 4EHJA 1W2BF 4KAXA 2OUKA 2VGMA 1NLFA 5CN0A 3TLZA 4LHZA 3WKCA 4B87A 1X2BA 3C7CB 2O14A 4RENA 1D8AA 3E2MA 1BMFG 2WF8A 5KWSA 4K9OA 2ZRMA 1I0HA 3EDYA 3RVSA 5I7RA 4YAGA 4XPIA 4YCJA 4BEWA 1T0KB 4YR9A 3OOWA 4EBBA 5EJ6A 2R9IA 3A4VA 2H7YA 3SS7X 3TL2A 1NQXA 4CM1A 2FUNB 1U2GC 1Y4MA 5A04A 1RZVA 3CLUC 4TLAA 1IUNA 1QIEA 2YEVB 1RWMA 3GARA 3T41A 5A6SB 4D74A 3OT7A 2GJ8A 3ABLC 1VKZA 1PNKA 2AFHE 1SXGA 3D7RA 3OE7A 3F97A 1PFYA 5DNVA 2BO1A 3INRA 5FR2A 1KGSA 2B35A 3ZVLA 2G06A 1SQ0A 3OPQA 2F3QA 2YDEA 2K2WA 4PPYA 2Z6QA 4O2BB 3QXHA 1Z2PX 1O9HA 3M4SA 3HL4A 3KELA 1QDEA 1OCRB 4DJDC 5EZQA 1U3PA 2XKKA 1JUDA 1SCJA 1K7CA 2Z3YA 4JZKA 5JS6A 4WGFA 1SG0A 2Y76A 4BX9A 4HCJA 2A0LA 3FOEC 4MEAA 2OTLV 1T1JA 3EXHA 3HKCA 1Q0TA 4JJ6A 5BYAA 4UTRA 4REQA 3HVKA 1UEIA 4QVKA 3VFDA 2O3TA 4JBLA 4PG5A 2CMHA 2ZPUA 2FW7A 3NIGB 3D6UA 3KE8A 1P9LA 2JFWA 4R1MA 3V4VB 5CIYA 2D2CB 4MDHA 2YY7A 1QH9A 3E9QA 3QBTA 3UWPA 3IKLA 4N3CA 5BRJA 4RJIA 2Z9BA 1DQSA 1A7UA 1GU7A 1XEXA 5B7GA 2SICE 4TSFD 1M1KW 1SUWA 4PWTA 3VR6D 5FLXA 1RHJA 2XCRB 5DNYB 3M4XA 3EIOA 2F1HA 4B3CA 4CVNA 3JAWA 1JX6A 3LY9A 1VHAA 4O0LA 4DCUA 4LOAA 1H5QA 1GGKA 4ON9A 3FB7C 2WJWA 3A1SA 1CVRA 4QUAA 5IHPA 5K3AA 1Q2UA 1GOTA 1RRPA 3ENWA 3M82A 4FMDB 4M0CA 5JO0A 4CKBB 3MCZA 2C07A 5IT9N 1R3LC 2AW9A 1GGEA 3ELCA 2PMFA 3FYUB 1CY0A 2CMFA 3HCAA 1VMEA 5CT8A 2WF5A 3JQBA 1XEFA 4YAUA 2R96A 3FPAA 4LX8A 4ZQHA 5C1BA 4I6EA 2JVDA 1T2EA 3LHSA 1FS4A 1YKFA 1B6TA 3ZHVA 4QG3A 1MOFA 4C3OB 5DEOA 4AKIA 3CEPB 3QJ5A 2WKPA 3SLRA 2FPGB 1H8EG 2V98A 3SX0A 1KD1W 2N74A 1FDSA 1E6LA 4N7BA 1L5VA 1O94A 2RG1A 2X8AA 1QK3A 1OV9A 1DKOA 1FTWA 2VPQA 3EPKA 3B36A 2AXQA 3U5TA 4HL6A 4E3ZA 4LRTB 2WEKA 4WCFC 1CNEA 1F0KA 1R0XA 1YMQA 1T9HA 5A5VA 3PF8A 5K0ZA 5H4HA 2QT1A 2EZ9A 1Y80A 3DV2A 4DV3B 1YZLA 2DC1A 1S3GA 4MSWC 4UU8A 4KN6A 1ZD2P 1LS1A 4X63A 3NRBA 3LNTA 3OJWA 1TM2A 4L8GA 5LKAA 3W5HA 4EPXA 3KLPX 2C8VA 2GA8A 5J5VA 3Q4HB 4KWTA 4ZI5A 3DLAA 5J9FA 4ZOLB 4FPPA 5DHSA 4PHFA 1M2KA 5I01A 5U9CA 3OU7A 2MWMA 1C2YA 4U7PB 2C0QA 3L82B 3W7AA 4AWXA 3IP9A 1JMVA 3MRSA 1OVGA 3FBWA 2AT1A 2QYHA 3ZRVA 4QLOA 3A9TA 5IG2A 5JH7B 4LHYA 1OH7A 2QTLA 1VG1A 1OV4A 2DPLA 3SSNA 3THYB 5ED4A 1GPUA 3HXOA 1PE0A 5FD8A 1KQSU 2RN9A 1Q5PA 4ZAVA 4I0XB 1SESA 4JT2A 3BL5A 1BL8A 1P3DA 3W3ZB 4ALKA 2JIBA 1ZGHA 1ZH8A 1M0SA 4IIGA 1XC7A 2KTVA 1SCNE 1JP7A 2J07A 4JOSA 2JIZG 2B61A 2V5VA 3ONVA 4GMGA 1SKBA 1B16A 1I0IA 3TAXA 1AI7A 2IV2X 2E18A 3Q9SA 4E70A 3T5TA 2JIQA 2CUZA 3CBGA 3N58A 8LDHA 4LFCB 4MTLA 3CCJF 1AOXA 4JJKA 4C6HA 3FIUA 4BQFA 1XZLA 3ZWVA 4JI3B 5JZSA 1HDOA 1VBKA 3IMPA 1GN2A 3FPIA 4LTMA 3F0GA 1YDMA 1FP6A 4HAIA 1GQQA 3UAWA 1TCAA 2GOYA 4TUYA 4X71A 4B09A 1G2IA 3SQNA 2NO9A 1DJPA 1M2EA 4HVAA 1WSAA 1TU3A 1QO0A 4GGMX 5DNEA 3VQVA 3VSDA 3R9XB 2VQEB 5SV2A 4M86A 2PBRA 1EWVA 1N5LA 3EEQA 1N7IA 1KOFA 3TB6A 4MI9A 1HDGO 4DMMA 1XA3A 4GS5A 1JVMA 3CXHF 3W5IA 2F3TA 1A50B 1C3XA 3SDBA 4TYYA 1C3OA 5G0TA 2FH5B 4AMZA 4C07A 2AMYA 2H59A 1YVRA 2G83A 5I4BA 3MC1A 1T2CA 2CL6X 1PVDA 5LUAA 1WVGA 1SQ6A 1F2TA 3P2JA 5J4LA 4PG7A 1OLUA 1Z6YA 3WLPA 3LECA 4BZZA 3QLTA 4F92B 4WK4B 1QAQA 2PKQO 3GIDA 1DB3A 1R15A 1CNFA 3JTMA 5NLLA 3TK1A 4EJMA 3WDLA 2G72A 1KI4A 3DEZA 4XFKA 4EHNA 1ORIA 3L1HA 1B0AA 1ULHA 2QTRA 3QE3A 3F3YA 3QOFA 1XV5A 4R7TA 3RFUA 3R5HA 2GLUA 3SZRA 4PLVA 1U28A 4PLZA 4Z1MD 4NU6A 3HC7A 3WISA 5J1TB 4BVAA 1T24A 4H13B 5JLJA 3EGEA 4ZCLA 4J1NA 4H33A 1DTOA 1W4AA 1IJBA 1KDTA 3GPIA 1G8MA 4OQZA 5CFNA 1BEZA 1QGUB 2ZM6O 4BLSA 4O1HA 5FWYB 3UOWA 1EUCA 1VKJA 3AIIA 1RPZA 1Z0IA 1K3TA 1A98A 4H0LB 4HFNA 4OFXA 1XILA 4P3YA 2G4LA 3HB9A 1Z6PA 4YBRA 1VL6A 4O4HB 3AF2A 2H8KA 4YMUA 4MYHA 4NBTA 1XL4A 3NQ41 4ZDKA 4AZ0A 1KQOA 1U3GA 1V8OA 3LWVC 2VKQA 2QNIA 1JSZA 1SIUA 1ZVMA 4BTLA 4CXMA 2ZYTX 2ZBGA 3JU3A 3QF7A 3EDCA 1FFXA 2YV4A 4PTZA 4OAOA 2X0RA 1Z56C 1LSSA 2W2KB 1JLLA 2G0AA 4GOJA 3VV3A 3W7SA 2FZVA 1ELOA 2FK7A 3IA7A 3E7PA 5AM2A 3CC2V 1Y67A 3VU9B 4CMEC 4ETIA 4C7MA 1GYPA 2IW5A 5JJLA 2XAAA 1JWBB 2AR7A 1WAMA 4KR3A 1M10A 1BS2A 1E3QA 4JA0A 3O1IC 2JFVA 3S6JA 3ZWNA 5KJ6A 1SC1A 3KJHA 4PY2A 1HNWB 2J4DA 3BAZA 2VDJA 4BRWA 2QR2A 3RW0A 3PBKA 4C4ZA 2C2WA 1Z62A 3SKYA 3ADOA 4DSUA 1MVNA 4LWQA 2HHHO 1ONIA 2WLKA 3QVVA 4RHEA 4TQGA 3ZDZB 2IUFA 1NNLA 4ARCA 3U2QA 3B7WA 3IAS6 3U56A 4I55A 5EA2A 1TGOA 1QHHB 1OZ0A 3MBKA 4WFHA 4C03A 1L5RA 3GLVA 2CK3A 2QQGA 1XRJA 4IDCA 3MELA 2RAFA 2WFMA 4ILEA 4WT7A 3P9YA 3HCWA 4RIHA 5LMUO 4E4TA 4CKEB 3FD9A 3T94A 2PKQP 3JW8A 1QCZA 1EWRA 3QVMA 4D57A 4TMZA 3T54A 3FPCA 1W581 2DYSB 3DBRB 2WP0A 2Z9DA 4EKIA 4WKBA 3A4MA 2OWDA 4E08A 3H6HA 3KOYA 4K6GA 3C6QA 4D44A 4NPHA 1HGXA 2HMYB 1AVMA 4MVZA 1CYEA 2ID9A 4KV7A 2B4QA 1H2BA 5DYIA 2XAQA 4IDHA 2XB8A 3I01A 5L3QA 4NBSA 1FKAO 4U5QA 3MQ2A 2HW8A 5TMEA 3OT1A 3QU7A 2G7ZA 1CCWA 1V4NA 2PS3A 3DOJA 1PVVA 2EX3A 4ZQEA 5IT9M 4X1KB 2VGNA 4IIEA 4DMHA 1OLSB 2O2JA 3S2GA 5K8TA 1NQAO 2UYGA 2YBDA 5ICSA 2QPTA 5DNCA 1IBRA 4ASUA 3HP7A 3OOJA 4HUTA 1K6MA 2JAOA 1T91A 4AJ9A 4BO7A 3LI2A 4NQZA 4MR7A 1MB2A 4MUXA 2R68A 2AA3A 2FPRA 1O58A 4RKFA 3AKZA 4N65A 5J43A 4FKMA 1US6A 4ADSG 1TVKA 3FLEA 3M6WA 1DEOA 4KFUA 4DCTA 2JEXA 3DE1X 2PS9A 3LCCA 4NK5A 2TYSB 4OHWA 4C1NA 1HEIA 3DZKA 3WJ1A 4TXNA 5DWDA 4RVFA 2CW4A 2FOXA 1L6RA 1XNHA 1N2BA 4KQEA 4B32A 3X1DA 3LWQC 1L7BA 5IVIA 1CF2O 3OKAA 2VT3A 3OMXA 4WKOA 3FBAA 3KWMA 1WD5A 1BX3A 1UQRA 4LDQA 2YY5A 3H86A 2V1UA 3EY4A 3OX3A 1H42A 1ZK4A 1EK6A 4D9IA 1ULUA 1M6WA 2ITCC 2A3RA 4O4LB 3RV3A 1G3RA 4LBVA 4J03A 4QDOA 2IELA 3HCEA 1YJCA 2VH1A 1KH1A 4F3RA 4M1WA 1Z8NA 5T64A 3NVAA 3V33A 5LP6F 1J99A 3WAJA 2QKAA 1E1CA 1ZU4A 2P1DA 3T06B 1G2OA 1GNSA 3EMKA 4Z99A 3FB6C 2GF2A 3DPIA 4XA8A 1OXMA 4TWRA 4KMOA 5FR1A 4OQXA 1LUAA 3BAAA 2JLRA 3WG7C 5HZMA 4GR9A 4I1PA 3VPXA 1F48A 2FDXA 1QYIA 4L5IA 1Q83A 1IVSA 4OO3A 4JVMA 4LXUA 4NL4H 1PT6A 4GLXA 4QUIA 4HGNA 2CV1A 3FPHA 5P21A 3AUYA 4FVMA 1WP8A 4YV7A 2WYVA 3PJDA 4GKJB 2X8JA 1ENYA 1J0DA 3HFJA 2JVJA 1M57C 1BSMA 2A58A 5IBPA 3KSMA 1CRZA 3BSWA 5E6SB 3WO0A 1EBUA 3SIUA 2ZNIA 5BV8A 1N5JA 3NMUC 1BX1A 1U02A 3SIRA 3JQ7B 1C1YA 2HCFA 3EIWA 3BMXA 5AUNB 2LCAA 4EYKA 1ISHA 1NM5A 2EP5A 2F1MA 4L4RA 4PSDA 3STVA 1J1UA 4XB1A 1HX7A 3HEMA 4RQEA 1LNSA 1UBOS 1W5AA 1W57A 1F1BA 3AERB 1NXTA 1ZVQA 4FGWA 1RBZA 2GO7A 2XRZA 5ECYA 1NS1A 4QDZA 3KUUA 4C0AC 2VF4X 2NO1A 2B9EA 2QD1A 2PD4A 2REXB 1RR6A 2XQKA 1JA0A 3DLIA 4LOHA 5HIJA 4UHJA 3A1UA 3EVBA 4MRSA 1YZTA 1INLA 2R8RA 2GEKA 3H9BA 4LV5B 1I4TD 3MT8A 4BMSA 1XDDA 4QEDA 4ZT2A 1EFUA 4EITA 3NHSA 5B12A 2AI3A 2P5YA 1UAAA 1OFIA 3QEMA 3QITA 4RSRA 4WJKB 3NXSA 4BW5A 3C1AA 4WZBB 1J2EA 4C0BA 2PKWA 1PL4A 4QELA 3NHLA 2NTNA 4QFMA 5AI5A 4XKJA 3T3OA 1T8YA 1XP8A 4HQFA 4EJFA 3VU0A 1MX9A 1L7VC 1X87A 3OPVA 1N5MA 2E87A 1BVHA 3UK0A 2P7HA 2EW2A 3HPLC 4H31A 5BSMA 1ORQC 4YH1A 2R5FA 1MDBA 3MSXA 2ZRFA 4YI3A 1V3VA 4Q4JA 1WETA 1PBNA 5JD3A 5HXZA 4XQGA 2WALA 3S3WA 2FWPA 3MTAA 5CTJA 5TC4A 5CDGA 4B7KA 3IB3A 1OB5A 1AKNA 3FWNA 2JKYA 4YJ3A 3KRTA 1U7ZA 3S2IA 3DM5A 3OX2A 3GB7C 1G8JA 1TTPB 2E4XA 2LQTA 4DJFC 5CCEA 5CDSA 1PNMA 1YOBA 2R3SA 3BKXA 1J7KA 1JIJA 2BCJQ 1E2HA 2HF7A 4NV0A 1MB3A 1P5JA 3U4QB 3HP1A 2H17A 2HUNA 2DSTA 1E2DA 1CFZA 5J5CA 3LDUA 3B6JA 5KWIA 1JLSA 2EDAA 3HFSA 2QI9F 3NNSA 4KR2A 1RAFA 3H7AA 3KT6A 3LUHA 2XNDA 1TYCA 2WD7B 2XDWA 4X7PA 1C9MA 3LSUA 4GKKO 3A3OA 3GAMA 1SZCA 1U3TA 2A4KA 2YV2A 3A06A 4J1TA 2QG4A 4LP8A 4B7ZA 5LA6F 4CLEA 3ZHYA 1J2RA 5DP2A 1TMOA 2DERA 1K33A 5LC1A 2R8PA 4V0ME 4FEGA 1HP8A 3K0FB 2ODWA 3AIOA 3NHYA 3AJDA 2Q6KA 4JIGA 4ZYYA 2DFDA 1II0A 1A7KA 2DFVA 3RUDA 4P34A 1C3LA 5AKJA 2ZATA 1EZZA 3PENA 5SYMA 2A9QA 2C9MA 4ZHYB 3ZNOA 3ABSB 1D2HA 1NHGA 4OH1A 2RJZA 2IIQA 3B6EA 2Z8XA 2YEVA 3FZYA 3K0DA 2IDJA 4FHCA 5A6SA 2LGWA 3OJOA 1YZGA 4IQ0A 4Q9NA 1S3FA 1QGOA 2GDJA 4I3HA 2QA4V 1JV2B 2P4SA 1S89A 1FNDA 2E4VA 4LNHA 3WRXA 1ZSNA 1F3OA 1N1DA 1ACJA 5T4BA 3C8ZA 4O2BA 3HLYA 2HJFC 3JQPA 3EC2A 4KQJA 1KMHB 2GBFA 4OQEA 3N8IA 3R0VA 5BSWA 4FKBA 3AHEA 5SZJA 4Y1RA 2YS7A 4Y2YA 4DV0B 5CFRA 4FJ2A 5AVKA 2GPSA 3CR3C 1GN8A 3GGDA 1FMTA 3CO5A 2JFXA 3NC0C 4UMEA 4NQ3A 4B4VA 3A26A 5EKXA 2V4ZA 2R1ZA 5DNWA 1R74A 1XLTC 1J8DA 3GJ8A 1K98A 5ARBA 1L8OA 3CV3A 2YRFA 2BE7A 4EUNA 3DL7A 4Z49A 3D36A 3FKJA 3LHDA 1FE8A 4GL4A 5E7JA 2JS5A 1TZBA 4IVNA 3ZY4A 3DTUB 1W36D 2I91A 2W0FC 4DLPA 2C84A 5IDQA 1D6NA 2B5OA 3KVRA 1K73H 4I6GA 4GECA 1U8EA 2QWXA 1YCFA 5JYDA 1X1EA 4KQHA 1XEXB 4UNQA 4W8OA 4E1VA 2ZJ5A 3HZZA 1H9BA 3QNMA 4XD7D 2R70A 3QYAA 4X64B 5LZ5A 3JAWB 4D42A 2OTMA 3U4DA 5AHOA 3FYUA 1Q20A 1NMEA 4MQ4A 2HKOA 2N75A 5HIIA 4YYZA 2BMDA 4UHCA 4JTDB 4RVNA 3WGGA 4X1IB 1KDPA 3UMVA 1PNRA 1TM3E 2CHUA 4YRRA 1YULA 4PAMA 1R0RE 2ETNA 4J2OA 1ISRA 2TMGA 1HUQA 4QGPA 1PIWA 3PLNA 5GZ1A 1R50A 4DR6B 2F8MA 3LP6A 1DF4A 5LCXA 2Y1OA 1MDFA 2BKXA 2FPGA 3ILXA 5DULA 4C87A 3PUWA 4YY3B 4IQ8A 2B4KA 4FM0A 4OYHA 1P62B 4DMCA 4TV9B 5JS2A 5IUJC 2ZYWX 2N42A 5K7SA 2XIJA 3I1FA 1PPJH 3RSGA 4ZFNA 3IMCA 4QFBA 2QNBA 4F9FA 1KS2A 1OBVA 1WG8A 5FNVF 2ZB7A 1ZKMA 5K0CA 2OPBA 2XOKD 3KO8A 2V6IA 3DYIA 2PTHA 4TMKA 2OCHA 1Y8RB 5FL7G 5CW2A 4BEVA 1JCHA 1VE3A 4X93A 1CEEA 1GXSB 3L6EA 3KYCB 4AO7A 4DR7B 2VTKA 5H7XA 1IM2A 3SHTA 1ORDA 3FCCA 2A84A 3JWPA 1HRDA 4I9WA 4FNOA 2QMUA 1M2OA 5F98A 3QPVA 2X0JA 3HY3A 3ROXA 2Q4EA 1FLNA 1PHPA 1AF7A 5JH7A 1XZQA 4CC5A 4FZJA 3THYA 4HFRA 4TTVA 1E1MA 1P1RA 4H7DA 2ADQB 1KPGA 4N6GA 4FGSA 3R5FA 1C4WA 3DAYA 5CB4F 4AUEA 1T29A 5JALA 1O7JA 1VBFA 2CLHB 3P7MA 3QH4A 5IT0A 1YIDA 3I4CA 2OLJA 1TCCA 1RM5A 2ZAIA 1T5LA 3UN1A 2DU8A 5C18A 2YHUA 3M83A 3ICEA 2WJVA 5KTYA 1U0HC 4QBTA 2ZFUA 1XPJA 3QYPA 3JQFC 1YMUA 4BQQA 1LPBB 5A0FA 1XZNA 2CXNA 2IEZA 5EMKA 5B1BB 4JWTA 3M9WA 1HEUA 4ZV9A 4B3SB 2LKDA 5CDUA 4PS1A 2AHZA 5FPRA 1V5IA 1Y7PA 3P2YA 1YQ9A 1KJJA 4DV4O 3C87A 5EQFA 1CUXA 2IOFA 1SXIA 1VBMA 1ZH0A 1MMMA 2VF7A 1G98A 1MX1A 5LJLA 2W6CX 3D0RA 4Y6OA 4EECA 3R9XA 5JR3A 2F93B 4PLFA 5JT1A 2A8YA 1IOWA 4MA0A 4D5EA 4AWAA 2V7QA 2DSNA 1U1EA 2UYQA 2JJ8A 3TTSA 3LVBA 1PL0A 1FFCA 2H94A 4ZJUA 3WK8A 3K35A 2VSXA 1XTJA 3UWSA 1JHYA 5DM0A 3TCUA 1XTBA 2QG9A 1KMMA 4ZK2A 4MNTA 1WMEA 4EH1A 4LHXA 5ALEA 3IB6A 4HAXA 5TB5A 4LV6A 4WOKA 4GI1A 4X8MA 1OH5A 3M5DA 3AVPA 3TD5A 5KREA 3D8UA 3ZU5A 1R4ZA 1ZIDA 2VWJA 1EH5A 4FZ1A 4LRUA 2XQFA 1VQ4V 1N2XA 2ENWA 4RTLA 1YACA 2J9YB 3EVGA 3ESQA 2O2YA 1UPTA 1QU3A 3P9SA 2C4TA 2KWIA 4FYIA 1YI2F 4DR3O 1A4XA 3SDSA 1NUSA 1IN7A 5CB6A 4K9RA 1ZJ6A 1W0KA 2Q2NA 3GGSA 2KG7B 3EGVA 3M3DA 2BFCB 5ALUA 3L71H 2VLBA 2NG1A 2QUZA 5FWYA 2XLCA 4DEXA 3I76A 3ZDYB 1KI2A 2NSYA 1EK0A 1PN3A 1SIBE 3EIEA 4ER0A 3SXUA 1VZ3A 3L0YA 4NXNO 3CMAV 1JDTA 4O4HA 4OYRA 5F77A 3A7DA 1IV4A 4RHXA 4CMBA 4QJBA 3TXXA 3I2KA 4JCCA 1U8CB 4I4TF 5A02A 3QPAA 4EP1A 3V8QA 3HPQA 1ZUNB 1GGFA 1GG5A 5BUSA 3SJCC 1UDBA 2ZITA 5CDHA 3E9NA 3HI4A 2W2KA 3KXLA 4N23A 2WV7A 1XNQO 3N8DA 4J9YB 3CC7F 4DVGA 4Q1DA 1EX1A 2DT4A 5EWLB 1SBZA 1QYXA 4ZVOA 3VU9A 1NSFA 1FFXB 1W48A 1DO2A 3V2HA 1LH0A 1M5UA 1X38A 4J16A 4XH9B 4WXEA 3FVTA 4WXPA 3TGWA 3HJRA 1RP3B 2Q27A 1HV8A 3TLMA 1LLDA 4YCAA 5AXCA 2YS8A 4B0OA 1KK3A 4W7IA 4BBAA 2QTPA 3W9YA 5EWRA 3CUTA 1PJSA 2HK9A 3R7LA 3OUTA 1MVOA 3SIWA 1FIUA 1IU9A 3U7EB 5BT9A 1OWLA 5H5NA 2K1EA 3HZOA 2I7VA 3G49A 5DCUA 2IXTA 2H00A 3ZBQA 3D5EA 1Y1KE 1H65A 3D8CA 1R9MA 1QHHA 1K08A 1ENOA 3F7YC 2XWBF 1LPSA 3BORA 2CWWA 3DQZA 1RM0A 4GUDA 1TRHA 2FWNA 4AQ7A 5TGDA 4B3BA 4G6ZA 3KAJA 3OQIB 4HSGA 2IPLA 1O54A 3QE4A 1AKEA 4CKEA 2VJYA 3RCBA 5AW0A 5A4FS 2J9GA 2AZMA 2EQAA 3DBRA 4IHAA 4F3YA 2IHNA 3VHRA 3LT1A 2WOJA 3T4UA 4J2TA 1W6UA 2C4HA 1GL3A 3G2MA 4RTPA 2QQEA 4MGZR 1HDEA 1BQ0A 5FUXA 4QECA 4HYTA 5C8VA 4WN9A 5E4FA 3QV2A 1A7JA 3PPYA 1I8TA 2WYIA 1G8AA 3L0BA 3N8GA 1YJAA 1F4NA 1KETA 1BXZA 4DF3A 1OLSA 3ZTYA 4DUYO 1AQLA 3IUBA 1XDSA 3WYNA 3MGBA 2Z1TA 4KXUA 2FMLA 4Y7DA 3SYNA 1XE3A 2BBTA 2OZLB 3FNGA 4GQBA 1QOQB 3IBTA 4U7NA 1NBHA 4MVJH 5DLYA 5IDWA 3VC1A 5A9GA 1K8AH 1YIOA 3ZU6A 2YH2A 1MU0A 2HLDG 1G5HA 3PIDA 1THGA 1P0QA 4MGHA 1DDOA 3U11A 1I7DA 1W9HA 4MYDA 1WS6A 1ANKA 3GLSA 4ZI7F 3O3CA 3KM0A 2NXNA 3RVZA 4OXSA 5GTDA 2I4OA 2D1RA 2O0JA 5IULC 4LE1A 3TN7A 3I61A 1VF6A 3W34A 2QWPB 3PCXA 2ETVA 3BCSA 1NMSA 2RSLA 2HRYA 5DYTA 4FI3F 4NYJR 2Y8EA 4PBRA 3U13A 1XMJA 2PAFA 3MYYA 1KTIA 1E4VA 2BR5A 1D5CA 5AOVA 2PPLA 3WIOA 2LKCA 5B4VA 2GI4A 3ZUGA 2IT1A 3C0KA 3NXKA 3V4RA 3M2TA 3QPCA 4DBVO 4BE7B 2OCLA 2VQSA 1SKAA 4XI9A 1EDDA 2QDOA 3AP2A 3O4GA 1E9RA 2OM6A 5FUBA 2SECE 1A8UA 3D4PA 4DIFA 4ZKEA 1ZH2A 1XB2A 1W30A 2QF7A 2PMWB 4DLBA 3BWMA 3REOA 2ES4A 1Q6YA 5JO9A 1GP2A 4KLCA 4C3ZA 4ICIA 4M1YA 3H1TA 1XCMA 3TOVA 3PCRB 2FXIA 1J9GA 9ATCA 4D9GA 4BPBA 4EUFA 2PS0A 3BEHA 4HDOB 3S27A 5HOEA 3QFSA 1CUHA 4EHBA 4IGAA 1THMA 4ZARA 1X80B 2AW5A 5KNCH 3GXBA 4K6KA 4O0MA 4PZPA 1ZMBA 2DAPA 4PV7A 4AKEA 3DHNA 5MN6A 1HK7A 4PG8A 1LJ8A 1NZDA 1UDAA 4B34A 4OPAA 2O7SA 5D3ZA 5E6SA 3AH8A 4BQOA 4MW3A 5GONB 3MT9A 1X19A 5IC6A 4NULA 4MW2A 3DTVA 2F59A 3GWKC 5BNZA 3ZCVA 3JQ7A 3T8YA 3DDCA 3V42A 4ND1A 2XMRA 3OAAA 1ODCA 2D3WA 1OX6A 2XD4A 1NXOA 1Q6ZA 1E2BA 4CV1A 4LDAA 5EG5A 5H4GA 1GEEA 2WSIA 3FI0A 3O4JA 3QUTA 4XTRA 2NO7A 3S1LA 2IZ5A 1BDJA 4BFYA 1RI3A 3AERA 4Q1EA 3Q7RA 2H0AA 3DTYA 4RDCA 5A3SA 4OXNA 1FRFS 1RKVA 3I30X 3D1LA 2HWXA 5ITWA 3ZBTA 3WHPA 2A57A 4UUJC 2BV3A 3GH3A 1Z2EA 4G5GA 1XXHE 4PQGA 1E1KA 2VXYA 1EG2A 4MSUA 4AMVA 3K79A 4DR2O 1KYQA 1AGNA 2R8YA 4BS9A 4J7JA 1FYDA 3M6VA 1R6BX 4KU4A 3RW9A 4WKCA 3IT3A 2V4MA 1HM5A 3ZYCA 4WZBA 2YWRA 4C4TA 4NJOA 4TSRA 4D43A 5FTJA 2X5JO 3I53A 4J80A 1JXQA 2VWQA 3CUSA 2QJTA 1H8ED 4XXHA 2Z5VA 1NI4B 1M73E 1FYVA 4GXNA 1P2BA 3AEIA 1Q1GA 1SETA 2W98A 1K97A 3UH0A 4O4JB 1W9MA 4DG8A 1L4YA 5HCIA 3TE6A 5JD5A 4U0KA 2ZVQX 1OKKD 4FBMA 2FN7A 1UI9A 5CBFA 1SK9A 1J20A 5FOXA 3VSCA 4MA5A 2V54A 4ZT6A 3SICE 2O50A 1K3UB 4XVRA 3CXCF 1MLDA 4Q4JB 4W4KA 4PHZA 5B6IA 4IMJB 4TMWA 1IPEA 4FFWA 3D8NA 2QLBA 7MHTA 3TG2A 4JI6O 4MQLA 2AH5A 4QM6A 3OGIB 3U4QA 1MX5A 2H6EA 3QM1A 1KKLA 1PG2A 1JH8A 1G8HA 3ASOB 4MX8A 1ESDA 3JYQA 3BX1A 4F0JA 3I62A 4QTZA 4IRUB 5B1AC 3IBGA 4KACA 4D3FA 3CRQA 4UBLA 2FZLA 4PTYA 3LLUA 4D6XA 4BNHA 4RQFA 1IBSA 3T15A 1M83A 3AYXB 1CUGA 3JZFA 4HGPA 2ZIXA 3E2EA 2V3WA 4MQFB 4YMLA 3Q9UA 2WD7A 2XOEA 1KPHA 1NRJB 1HW7A 1NSTA 5CFMA 1COWG 4HN4B 4BE4A 3A11A 2C7VA 2ZJ1A 1DX6A 3OI7A 3PT9A 1GQFA 4NR1A 1NLZA 4GW3A 1N2CE 3SFZA 2FFBA 5ICGA 2JIZD 2BFFA 2PH1A 1T5IA 3B6ZA 4U2EA 3GZNB 2ORYA 3K0FA 2GZLA 2ZS9A 1D3AA 4RYLA 4XB2A 5J2TF 8OHMA 4Z9XA 3JQQA 1Q6HA 3L6OO 1WR8A 2J48A 4D8WA 4EW3A 3ER6A 3O65A 4L7QA 3P2KA 3EG5A 5C8ZA 1DWPA 1B6SA 4RHYA 1VKHA 3CD6V 3L8YA 2I67A 3LSSA 3G6BA 1GDHA 4U0JA 3LY7A 3VR5A 4O2AF 4E4RA 5LU8A 1WVMA 1IMOA 4PSKA 3CLSC 1RBQA 1ULBA 3I4LA 3R24A 1J8MF 1CV2A 2KQXA 1UPFA 3HCFA 1PR0A 4KQ1A 4OIFA 2QN6A 4M46A 3R7SA 4XYMA 2X41A 4L57A 1MOQA 2UXCO 1D0VA 1EGMB 2YXNA 4Z9YA 3TUJC 1IDOA 2RGBA 1GPJA 2ZRQA 3SP1A 2M7WA 2VF8A 2C03A 1SUPA 3ISVA 4IEFB 2HR3A 1KMHA 5LR6A 2D8MA 5JSKA 4K8XA 3TZEA 3W7UA 4BNWA 3ESZA 4D6YA 3KKNA 1OPXA 2JIMA 2P9QA 4MO2A 3LUKA 1SXJD 4C9BA 2GN8A 1NP3A 4C4PA 4Y3UA 3SDLA 4ZC8A 1Y7HA 2MINA 2GRJA 3ZRSA 3ZNQA 3D2CA 2I4IA 4W9NA 1E9VA 5HIAA 2ZI4A 1Y7LA 4Y1RB 3B48A 2J5KA 4BX3A 3W2IA 1G4AE 1KI6B 3KWJA 3S5UA 3L7IA 3NONA 5IRCD 3DAGA 1BHBA 3F9CA 2Q4OA 2IKQA 3INNA 4WSOA 4UQOA 3BGVA 1Q8RA 1EN6A 3D4OA 4I9HA 4HJRA 5FV7A 4NXMO 4QHTA 5ALMA 4R2LA 3PJSK 1NRIA 4JQYA 4IJWA 2Z5LA 1P75A 4HNAA 3ANYB 5FORA 1D7OA 1E79G 2WMOB 1JL3A 2QZ9A 3PC3A 3VC2A 2WICA 3C2QA 4B4UA 4KQIA 2HS4A 1F0YA 3HR4A 2ZRDA 1BWRA 2X4LA 1NR1A 4IIDA 4NTYA 1GL9B 4F9EA 5IDXA 5L40A 2WG2A 2EILC 4X1IA 4A36A 2GMWA 2HC9A 4G5SA 5KBYA 1BE8A 2OYCA 5JWRA 4PZAA 1EBFA 2BOBC 3EN0A 3UXEA 3IR6A 1MC1A 4EGSA 3V7UA 3H83A 2ACVA 1ZRHA 4WIAA 5B58C 1NUAA 2AUTA 3EHBB 1URPA 4TV9A 3VR2D 1M6NA 3LXMA 2HMWA 1P3Y1 5K0TA 2VCHA 3AM4A 2HMTA 2Y93A 2ODMA 3EPRA 3NOQA 1M7GA 1SVNA 1BYUA 3B9RA 2YWFA 4V1CA 2PUDA 2Q5IA 4BV3A 5DMXA 4P4LA 5KC9A 5D84A 4ZQGA 4EEQA 1Z29A 1AR1B 3B2EA 4JKOA 4GZ5A 3R7NA 1OI2A 1Y8RA 3MZ0A 4EDHA 4W1PA 1XBIA 3P9NA 3CYFA 1GXSA 4YAKA 3KYCA 5F2KA 3VPBA