5BMVB

Crystal structure of tubulin-stathmin-ttl-vinblastine complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 171
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5bmvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5bmvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5bmvB01
5IYZB 4X1YA 5BMVA 4ZHQB 2VAMA 4O4IB 1FFXA 4HNAB 4ZOLB 5JQGA 4YJ3B 4FFBA 5LP6B 3JAKB 5LOVB 3HKBA 4WBNB 3WGJA 3WGNA 5M7EA 3RYHB 2R6R1 5JVDB 5LXTA 5CA0A 4DXDA 4U3JA 4EB6B 5JH7A 2XKAA 4XCQA 2BTQB 5EYPA 5KMGA 4EI9A 5J2TB 2VXYA 4B46A 3ZBPA 4I55B 4IIJA 3RYIA 4F6RA 3JALA 3N2GA 3CB2A 5CA1B 5IJ9A 1RQ7A 4X20B 4O4LA 5FNVB 3RB8A 1TVKB 1SA0A 5ITZB 3HKEA 4TV8A 4B45A 4IHJA 5JCOC 3JAWB 3WGLA 3ZBQA 4ZI7B 1SA0B 3WGKA 1TVKA 5EIBD 3JARB 4LNUB 4X1IB 5KX5A 4X20A 1W59A 2GVIA 2VAPA 5CA1A 4X1KA 1TUBA 1W581 5IJ0A 4I55A 4IIJB 3RYIB 1JFFA 5KMGB 5C8YB 5EYPB 3VOBA 4DRXA 4DRXB 1W5BA 5C8YA 1Z5VA 1JFFB 5CA0B 5IJ0B 4WBNA 1TUBB 5LOVA 2Q1YA 4FFBB 4X1KB 4YJ3A 2RHJA 5JQGB 4HNAA 4ZOLA 5KX5B 4X1IA 4O4IA 4LNUA 3JARA 1FSZA 3VO8A 3V3TA 4ZI7A 1OFUA 3JAWA 4IHJB 5MN4A 3HKEB 4TV8B 4ZHQA 5ITZA 5IYZA 3ZIDA 4O2AA 3M89A 1Z5WA 5FNVA 4I50B 5LYJB 4O4LB 4I4TB 3R4VA 5IJ9B 3UT5B 3JALB 3N2GB 4F6RB 2VAWA 4YJ2B 5EZYB 4EI7A 4E6EA 4KWEA 4EI8A 5J2TA 2R751 2RHLA 4U39A 4TV9B 5GONB 3N2KA 2BTQA 4M8IA 5JH7B 4U3JB 4TUYB 4EB6A 4O4JA 3RYFB 5LXTB 5JVDA 3RYHA 3E22A 3HKDB 3HKCA 3HKBB 1W5FA 3JAKA 5LP6A 3VPAA 1FFXB 2RHHA 5CB4B 1W5AA 5J2UB 1RQ2A 5BMVB 4X1YB 5MN5A 5MN6A 5J2UA 5EIBC 5CB4A 4O4HB 2Q1XA 2XKBA 4O2BB 3E22B 3HKCB 3HKDA 5LA6A 4O4JB 5LYJA 3RYFA 3RYCB 1W5EA 4TUYA 3JASB 5LP6C 3JATB 3C8LA 3JATA 3N2KB 4TV9A 3JASA 5GONA 3RYCA 1RLUA 3WGMA 3VOAA 3M8KA 3VO9A 5EZYA 5LA6B 4YJ2A 4O2BA 5JCOA 3UT5A 2BTOA 4I4TA 4O4HA 4I50A 2RHOA 4O2AB
chains in the Genus database with same CATH superfamily
3FNIA 3ADDA 1PJLA 1H5NA 3AR4A 1RC0A 4MUBA 3PCTA 4GOKA 3PT9A 4GEKA 4Z4GA 1FFBA 3MTQA 2IHVA 4EG3A 3E7DA 4DADA 3H8JA 4QNHB 3ASVA 3HVRA 1D2AA 2IW3A 4FWTA 2VUIB 3F98A 3RUEA 1WP7A 2IYOA 4ZQEA 2QD4A 3QLEA 4PG8A 1VQOF 1FU7A 3DGEC 3L4BA 1DFIA 1R0KA 1V5EA 4IJWA 3T3MB 5HF9A 3DPUA 2Y4OA 3K08A 1V7PC 2ABWA 3GPIA 3L79A 5EKSA 2EILB 1C50A 3G71F 1X74A 2QRJA 3HP1A 3RYIA 2F95B 1G5HA 1OSNA 4JL6A 5DDIP 5A9GA 5ECWA 1FYJA 1ENYA 1NQAO 2VPIA 5F33A 1DAMA 1USVA 2AS0A 1L4GA 4M88A 1VL5A 1KY2A 2X42A 5FBHA 3GRFA 3QE0A 1G42A 2W2OA 4UE2A 1Q2UA 5BSHA 3ZRWA 4IIYA 5BSTA 4LNUB 4YCJA 5L3QB 3NKFA 2VHCA 5EXTA 1AQ6A 4ED9A 1E2QA 1Z5OA 1ZLXA 4DA4A 3K5OA 3R2JA 1C3XA 3A3YA 2OTJV 1TJ3A 1MMFB 5GAJA 2ZUSA 3ORSA 4BIIA 1UOEA 3K0EA 4CQLA 3RJ9A 3L92A 1R0WA 5K1XA 3IQFA 4RPKA 3GWOA 2G6BA 4HXYA 3HWRA 4AY3A 2LCFA 3LY7A 4GKVA 3CRRA 5E79Z 2WU1A 4LZOA 5B3JC 4FJCC 2H2FA 3D7MA 5EZ6B 3UMRA 5EJ5A 4MH0R 4O4IA 3IOEA 3LTNC 1QQBA 4ABMA 3VO8A 4BJ6A 1FDIA 4QVGA 2FF7A 4I0XB 5JQWA 3OPNA 4BEBA 2GCPA 1MH1A 2XWBF 3EAFA 3K8OE 2BYTA 1ETHA 1NM5A 1Z06A 2I4TA 3OWXA 4GI5A 4WEQA 1H94A 3FN4A 3RAJA 4EEQA 2QB5A 5CT4A 5IKEA 5JCXA 2J8ZA 1JDTA 4DWWA 2EJ7A 5CBGA 2WBLC 1DCFA 1IQPA 1NE7A 1IN8A 1XVLA 1Q81W 3GJ7A 3IKJA 3OIDA 2XMSA 4BVSA 1SAYA 3RU9A 3W8EA 4EWLA 3OTIA 3F0EA 5EC1C 2BCEA 2K4MA 2OCIA 2J5QA 3CWQA 2RGYA 4C1NA 4EFDA 5DIFA 1K7YA 5IN5A 4JC0A 4CUKA 1QZTA 2XUGA 3L4SO 1PQPA 4G5GA 2O2YA 3F4BA 2O0HA 4I99A 3JYOA 2LGJA 3WNBA 3CVVA 2QTSA 1MP0A 1P80A 1JEYB 4BMZA 1TM1E 5BMVB 5IEJA 1M2VA 3L18A 2L18A 1MQ9A 2IXAA 3GN2A 4L4YA 1SQSA 2BISA 2JKZA 2WNSA 2Q1XA 2MSCB 1JAIA 3E9MA 3QMMA 5TIIA 1WHTB 2O2XA 3JY6A 2V9PA 1NQTA 1SVSA 4FE4A 2QIOA 3R74A 3GFTA 3RGBA 1XVTA 2PHZA 4IMPA 4RHUA 4CCWA 3CUKA 1GXSA 3HB1A 3KZ1E 2G5CA 4CZ2A 3GX1A 4EBFA 3TF5A 3ZVMA 2H52A 4Q1CA 4R8CA 1C0LA 1LPAB 4LY0A 3HJTA 5KYVA 4D74A 4Y7DA 2JKYA 2XNDD 3BFPA 1N0NA 1KEZA 4QLBA 2ZM6O 3GLGB 1FTYA 1X7ZB 3B40A 2FMHA 2GF2A 1WHTA 2JANA 3QI7A 3VOTA 3CCRF 2HHAA 5HX7A 3RAEC 2JAPA 5TXGA 5CGZA 2EDAA 3WL6A 1UJCA 2QGFA 1AGYA 3O31A 2HPZA 4H17A 4TT3A 4UMVA 2C3UA 3PHJA 2H85A 1GYRA 1O0SA 3M1YA 4G24A 2IWRA 3DT8A 1UJNA 4YEDA 1Y7TA 2OAGA 2J3LA 1N2XA 3R75A 1UOOA 5FUBA 4E5VA 1LH0A 2R85A 2Z2XA 1OLOA 1ZC4A 1T8YA 5IJAA 1YC5A 2PQ2A 2FMIA 5AW7A 4EB6B 1Q3EA 2FZWA 3W1VA 4H1WA 2I2WA 4XDYA 2C7OA 4EM6A 4I9QA 3I53A 1H85A 3FNFA 3H2GA 1VLVA 4A6PA 5LD2C 1NZDA 2A5FA 1SCUB 3ONDA 5AI6A 5CW1A 1JIXA 1Y7HA 1WCIB 2XITA 3VU9B 3E18A 5I6DA 3T61A 3S6JA 1XEWX 1VKHA 4BMYA 5C46F 3QFTA 1Q21A 4B7XA 2IYAA 4UUBA 1OWLA 3UJHA 1JJIA 2QY9A 5ITZB 4MW8A 1SJ9A 2P30A 2VUUA 4RYLA 1ZI8A 2CV2A 2MR6A 4JL5A 2O0LA 5BN5A 2QE6A 4L8LA 3RW0A 4QSMA 2DQYA 5ALQA 1GILA 4NV3A 1PS0A 1NG1A 1PFKA 2WWIA 1XZGA 1M1UA 1RYMA 3AR3A 5EJ6A 3SF0A 3S02A 1Y6RA 3FR8A 3IT2A 3T4UA 3MS2A 3ZCUA 4D80A 4CV2A 4L9RA 3A04A 5IMSA 4LDRA 2GM3A 3ET5A 1SF9A 1IZ8A 1VBMA 3BL8A 2RHTA 3RC3A 1WDTA 1Y1LA 2P62A 5ESRA 2GZ3A 3L84A 3ORHA 3QTTA 3AF6A 4ZOQI 1I3KA 4Q1AA 1PS9A 2QGNA 3PFFA 4PYLA 2ZKIA 4QECA 1F6DA 4WLUA 3DDUA 1YACA 2B35A 1C3OA 4DY6A 5HW0A 5AI0A 2DR0A 2BSXA 1FOEB 4LF9O 5A6SA 2XMBA 3LWRC 2F43B 2J5KA 2ONKA 3NTOA 2Z98A 4PIVA 6GPBA 2ISCA 1NH2B 2PXXA 4JA2A 1L4LA 4V0OA 1T9HA 4A3SA 4J1TA 8ADHA 3L7CA 1W6UA 4EQZA 3GP8A 4YPVA 4O25A 3DC6A 1HETA 2XRYA 3CVOA 3ABSB 4X7PA 3RUIA 1MFPA 4GS5A 3H99A 4EOGA 2FVYA 5J5VA 1KI7A 1K4CC 3WNQA 3O74A 2CKDA 4UAVA 1BDIA 1RHMA 4K6KA 3VI3B 3PPYA 3L5KA 4E70A 1DC4A 5L3BA 4OI0A 2WIKA 3CZ4A 3TNYA 4DV2O 1F51E 3FPCA 2G06A 3R3VA 4M9RA 2DF8A 3IEVA 3BWEA 1EIZA 2DG2A 1EN4A 4F4CA 1Z0DA 1LBTA 3DM9B 2RAUA 4MR7A 2CLHB 5H82A 3PJEA 4R3WA 3OD4A 3RGWS 4YRZA 5HS4A 3CLSC 4F4UA 5HBRA 1JB1A 2C0QA 2DPXA 3PFHA 4QARA 5J9FA 4MRMB 4Z7NB 1PQ4A 2VRBA 2FFAA 2IXDA 2YW9A 5DHRA 1O4WA 1W0KD 3MRSA 3OJXA 3TLJA 1JLMA 4NL4H 1SUBA 1G5PA 2WMYA 2GN8A 3K73O 3W6PA 4RTOA 1AKQA 1GL7A 1P9RA 4QAQA 1Z7EA 2P0AA 3GRVA 2ZINA 2LP4Y 5D85A 4CKXA 3HPQA 5EKDA 1NYTA 1Y9EA 1H1DA 5T41A 1ILEA 2J3IA 3BRQA 3MWDA 3TEFA 4JT2A 4H0LB 1HV8A 1J9EA 1MIHA 1PJZA 4DLWA 2XIJA 3FPFA 5B2FA 3BPZA 2OFXA 5DNCA 3X1WA 1JECA 4G9GA 1LRKA 1VJ0A 3Q8KA 4UCTA 2IL1A 4H3KB 1UKZA 4D26A 1R0SA 3I4CA 2E5LO 1E79D 1NNEA 1NBOA 3IMFA 1VPDA 4PVCA 5F2NA 1UL1X 3FTNA 4AJKA 4HJXA 4J9VA 2D1RA 5FT9A 2HMAA 5G0VA 1EFPA 5HMLA 5DTIA 4EHBA 7MHTA 2FVXA 2DWCA 1XRRA 1GZUA 3B6KA 3MDSA 3ESDA 4KMOA 3BCCH 5EJIA 1U8TA 5BWBA 1SELA 3CN7A 2I9KA 3G59A 1J00A 2GLUA 9MHTA 1LD3A 1RKUA 1JVBA 1T9GS 4P53A 1URPA 1H8EG 3DR3A 3HUEA 3ZV7A 3LHDA 2QIPA 2V4UA 5JIBA 1BKSB 1S5JA 1FSSA 5LBUA 1C0EA 5C31A 4RV9A 4CMHA 2BFBA 3IBSA 4I55B 1CERA 3R77A 1X14A 4PAMA 3SOZA 1JNYA 4D82A 1T2AA 2XASA 1E3QA 3TR0A 4DAEA 3JYLA 1XSEA 2DYRC 4C29A 1MG5A 1OE0A 3AG4C 1GRVA 3E8SA 1YJNV 2Q1SA 4WXEA 4EFNA 3BRCA 1T2DA 2VF5X 1UPCA 2GJ8A 3S2UA 4A0FA 3FLBA 1JLLB 2XT9A 5A3JA 4J0CA 1DTWA 2F9LA 1VIBA 4GEGA 5EIBD 3Q3JB 4UHFA 2L42A 5BQ3A 3TFOA 1PLJA 5CA1A 3JD4A 3D8UA 4KVAA 2FSHA 1DTSA 3P9RA 2UZ1A 4ZZ3A 4ICIA 4D41A 1U9CA 1ZXLA 5JALA 3RADC 1OPRA 5B58T 5LZ2A 1U11A 1UBOS 1DARA 2HGZA 3QPUA 3K5MA 2ORWA 1NAHA 2X15A 4GLJA 5COQA 1ZR2A 3G0HA 2FWMX 4QQFA 3VR3A 2MSNA 4F21A 4TXHA 1RWKA 1BOOA 1VDMA 2YIVX 2O3RA 2ZJBA 3E3MA 3CF4A 4LGYA 4ZP1A 4MQFA 4D9FA 3X2FA 3QPVA 4ZCMA 1F4VA 3AEIA 1ORWA 1EBOA 1QHNA 2Q7OE 4EKEA 3L1JA 2H1FA 4EENA 1F1JA 1NATA 4OXQA 3RA6A 5HM8A 1Z8HA 3NYIA 3P0RA 4QU8A 5JZSA 4S1VA 3GEGA 5FQNA 1M7HA 2PF4E 1X7ZA 2FRDC 1UWCA 1RM5A 2N48A 2I2FA 1ZX3A 5B3SB 2NTNA 3DS8A 2Z04A 3LDTA 1KQSF 2FETA 4RWUA 1JWAB 2GERA 2C5BA 1VKJA 2YUTA 4NULA 1SQQH 4QUHA 1J33A 3MMZA 4E6PA 3SE0A 3QOXA 4F5YA 2GCIA 1YB4A 2CJYA 1CEEA 5JBNA 2FN9A 1UJWB 4C7XA 2ITCC 2O6LA 4LEIA 1W30A 4RXUA 1O0BA 3SZ3A 3F5WC 3E15A 1ZJ4A 2FNAA 4V0LA 5EHQA 3GYGA 2AWNA 4OGKA 3TQRA 2NUPB 3LWPC 3MGAA 3JQ9C 3CJRA 1G3IA 3EXEA 1DLJA 3UWDA 5K3EA 2ANBA 4DM7A 3RODA 3T9AA 4XFJA 3TAHA 3SVTA 4BO4A 3NOQA 5MN6A 2B5OA 5JAPA 3RRMA 1SOVA 3E9EA 3ZP7A 1QE5A 3L9DA 3HXMA 3HTXA 4NDZA 4RHFA 1ZH2A 3NDPA 2GVNA 3GUZA 4QJIA 5F9FA 2I33A 1P1JA 2HA5A 1P7YA 4NZNA 1DJQA 1N7GA 3EMVA 1Q0LA 1MVLA 3G5UA 1IPAA 1R4MB 1YC2A 3AVOA 2LW7A 1CXZA 1TDJA 2RHDA 1DV2A 1FXUA 1TKBA 3AFOA 5DCYA 1U6KA 4Q00A 3E86A 4N5MA 2XOKG 3UPDA 2JFUA 2Z5VA 4IWNA 4F6EA 1T43A 5GAPK 3S2FA 3ZEDA 1NR1A 3C7DB 1I7NA 2OZPA 4KN8A 2CDYA 3VGPA 5DXFA 4O4HA 1H47A 1VGRA 1XROA 2UKDA 2AT1A 2VT3A 4BE4A 1U97A 5EVJA 1PDWA 2PZBA 5KKCA 3LHIA 5GV7A 1IV1A 4FS8A 4MS1B 5CAEA 1MEEA 3FFAA 3DEJA 4NOKA 4TQUS 4N5LA 4IQ8A 1BDHA 2H2DA 1JY8A 1K5GA 5CX1B 5D1NA 1CIJA 3HYLA 3K70C 4E1AA 1V1MA 3CIOA 3QO7A 1OBFO 2A5YB 2QSJA 2ZG6A 3S99A 3WFZA 1BMQA 1V16B 4CTJA 3TE6A 1DC6A 2AJCA 2JZNA 2QXTA 2BFCA 2WVHA 3CC2V 4IGAA 1PGJA 4P58A 4UTXA 1W2BF 2REQA 4Z1OA 4J80A 4L75A 3QK7A 1F8GA 4TLCA 4QPNA 1V8PA 1OPXA 3PC7A 1V96A 2H7YA 3ZU6A 2VSFA 1G5RA 1BCCH 3D3IA 3B2QA 3ZBPA 5LNK6 4RENA 4M9UA 3GIDA 4N3AA 1I2ZA 4S2UA 4A82A 1KOGA 4WD3A 4DWOA 4CUJA 2DH6A 4QELA 3TQSA 3D36A 3Q2OA 1ZINA 2ZM5A 4DIBA 4HEA6 1F0KA 1GG2A 4JI2O 4ZMBA 2W6MA 3R5JA 2P67A 3DMDA 4BRZA 1EESA 1ITZA 3DF9A 2C2ZA 2QT1A 1JSLA 1EKXA 3FSGD 3W9SA 4CKYA 4LGCA 1HE1C 1P5FA 4Q9HA 3TD6A 4CM7A 5LLTA 3F9CA 4EB8A 1LK5A 2VAPA 4FONA 4H6XA 4JJ7A 1R8QA 2IJKA 3OU6A 5ALGA 4YJGA 1SEPA 1NMZA 1HYGA 5KVVA 4I9GA 4YGXB 2GCNA 1E1KA 1FSGA 2GZSA 1QGZA 3L02A 4A1FA 2JNBA 1KJ9A 4FFSA 5K0SA 2IXFA 4C0SA 4P4GA 1C1DA 4WTOA 2LFSA 1IEXA 3DFKA 3HQ4O 3LPNA 3NAMA 3BY6A 1C8KA 2BT4A 3OPQA 1X52A 1T2VA 1XRPA 3NBFA 1NJ6A 1J1ZA 1E1RA 1S2MA 2ON6A 3DUWA 3QFHA 5I9LA 5KSWB 1AF4A 2A9KA 3FKSA 2A9RA 2B0JA 2YRXA 3I2GA 1QLHA 1VYHA 4LQDA 4N0PA 5SV2A 4BWYA 3MELA 2WD7B 3IUBA 4O2LA 2Y9MB 3O3NB 1UXOA 1EGHA 3QHQA 2FWNA 2VT6A 5JDIC 2WT8A 2OFPA 2QSYA 4KYVA 2CTWA 3PF8A 5KNBA 2QMZA 1QTNA 3ETNA 3N6VA 3MSCA 4RY8A 3A0UA 1ZWIC 3WK9A 3OMNB 3VH4A 1I3LA 3D3QA 3GWGA 2X9VA 4TLMB 5DNYB 2UDPA 1A5TA 5IJXA 4UZFA 1RPAA 2D62A 4QUAA 4YRNA 1TAEA 1RQLA 2GA8A 2J6BA 4Q3NA 5FI5A 3ZNQA 1CEXA 5BSUA 1TT5B 2VFAA 2C1EA 3AG7A 1N2CA 4BVRA 1PTJA 3BRWA 1HO3A 1RXSA 1UCFA 3EISA 1JPNA 3GUHA 1GAQA 3QQ5A 4GYKA 4UHKA 2E49A 2NUAB 4MIOA 3ZY3A 1PW5A 3E1KA 2A0FA 2CL6X 3ECCA 4S1PA 1B6TA 4FD2A 5IYBO 1ZH8A 3H1HH 3ETCA 1X80A 4S04A 4I3HA 3EX7C 2X4LA 3O91A 1WMEA 2F1HA 1F4PA 3S4YA 2I2AA 5G4VC 2CHVA 3B1XA 4FU0A 4NYIR 2Y4UA 4WXYB 2D1TA 4DMMA 1GTRA 1UPBA 4LF8B 3OZDA 4BN5A 4EPWA 2GN1A 3NPMA 4G5HA 2DN9A 3GB7C 1DAIA 3WA6A 4YBRA 4ZBMA 3AKEA 2ZP1A 1SXPA 1PJAA 1KQ3A 4JC5A 2JK0A 3B3JA 4B74A 1AKNA 2W6ID 5EJ7A 4G4YA 5LZ7A 2VZ8A 4I14A 1H0HA 4LMBA 2VHVA 1QYIA 4NG4A 1N8NA 1G7CA 2GLXA 3B1JA 1Y33E 1FUEA 1MX3A 3PPWA 1HFKA 4MUEA 3ISTA 2OXIA 2ZS7A 3IP9A 3KB6A 1JEEA 4DCNA 2J7PD 3ND5A 2RGEA 2FR8C 5EINA 2QN2A 3AR6A 3D4PA 4KLRA 2QSUA 4XXHA 5KOHA 2PUBA 1SR8A 5LU9A 3NAQA 2EZTA 2NSDA 1K7SN 4WBNB 3D59A 3CRNA 1YCFA 4PICA 4XSVA 5JVDB 3AUTA 4YO7A 4W63A 5JS6A 4AJ9A 2NLOA 4DR6O 2I8CA 2YV2A 4QBHA 4ZAFA 4OQDA 2JD1A 3TEMA 1JQ3A 4MR9B 4ABYA 5FBWB 2YWGA 5DTMA 1D2EA 4QFMA 1U5CA 3S2YA 4M46A 1I5EA 2Z1EA 1OB5A 1XA4A 4X6YA 5BR4A 1SXGA 3L1UA 2IUYA 3T0FA 3V8BA 1PJ4A 2J7PA 3MTBA 4N5IX 4EECA 5DP2A 4L08A 4DKXA 2FP4B 3SYTA 1YS4A 2HK6A 4IR7A 4RGVA 1CPYA 3P3NA 1JALA 1WIWA 2OEPA 2YJZA 1XL1A 3COSA 1SA0B 4MKRA 3BKXA 2IPMA 3L41A 3JQ8B 2NU7A 3RS2A 2HWYA 5LN1A 1XHOA 2WAYA 1J42A 2AD1A 1KVRA 1HSZA 4OHRA 3ICQB 3UG7A 2OBLA 5FOTA 3U9SA 1MGOA 1IJFA 2RKOA 2CNDA 2IYQA 1HNWB 2J07A 1XGKA 2IEZA 3B8EA 2X0EA 4TS4A 3F2IA 1J0CA 3OUSA 1T6YA 2B21A 2Q8VA 1DOAA 1UK7A 4GT1A 2HM7A 3NRBA 3JZAA 4JT9A 4N3CA 1N34O 2QTPA 1KARA 1MO6A 4JKIA 4D9JA 1ZSYA 4G4VA 1WRBA 2C8VA 2GPWA 2QP4A 4YJGB 5C52B 4LJYA 4FFBB 3EXFB 1ATZA 2R5FA 1QZ3A 3DLBA 1URFA 2FR0A 4KIGA 4OGWA 3L43A 1Z75A 4QREA 3OCZA 5FNVF 2M1XA 2AX3A 3CH5A 1RQNA 3H1LH 2JDIA 4KPGA 1R64A 4ZT4A 4CLRA 1VQ5F 1WBBA 4M0LA 4AY2A 4R7CA 5IYZA 3MMPA 5BPHA 4BQQA 1B16A 3I9MA 4FKMA 4O8ZA 2AHYA 3CYFA 1VXOA 3D3WB 4I4TB 4H08A 5G3YA 4CZZA 2EFHB 3TYXA 1DG9A 3ZIAD 2DFKB 3F5TA 4E12A 1XT6A 2YZMA 4UXIA 1JSZA 1R6VA 1HP8A 4TRJA 1DZIA 3SLRA 1KFBB 1N2EA 1MOFA 2FX5A 1CQIB 2C83A 1XDBA 2BMEA 4O33A 3OJOA 5DWDA 4NB5A 5J4HA 4P7FA 3NW9A 3WNCA 4QT4A 1Z82A 5LMUO 2IU3A 3FCYA 3JPYA 4IXMA 4W8HA 2F90A 5B66Z 1JOYA 4B83A 3CPWU 1ZSPA 3AR8A 1TA0A 2RARA 1XN1A 5CEEA 2FFRA 2AQKA 2O8BA 4V0QA 4ALJA 4S05A 2HDHA 4C06A 1IVSA 5EG5A 2J48A 5E4TA 4BAYA 4WV3A 1WWKA 2P6RA 4FEEA 1JDNA 1B8VA 1N7IA 3JQ6A 1SQGA 2TS1A 1D6MA 3H9GA 4E5KA 4LE2A 4KMSA 4N18A 2NU6A 1AHPA 1F4LA 4OAOA 5KCZA 2KG4A 2OY0A 2UVDA 3OAAG 2IELA 4OI2A 4QPCA 5ANRB 3ZE8A 3CCMV 1G20E 3IEIA 1Q1AA 3LPLA 4GC5A 2GNPA 4G81A 4R3NA 1CF2O 5LWQA 1OQAA 2ILVA 4V3BA 3AXTA 3H5TA 3KSDO 5ALIA 1IULA 1IY8A 2CK3A 2FU5C 2HC9A 2JAQA 2JH8A 1PG5A 3W7SA 1FAFA 1ODEA 2ZB4A 4G65A 3L9WA 5PGMA 2GYUA 1NQWA 2GHIA 1EDDA 3TLBA 3MCVA 1L8DA 4L15A 4A2QA 4F4DA 5FXMA 2JLVA 3FHCB 2HRQA 2AWOA 3LMEA 5KYUB 3CLRC 5HQTA 4UDYX 5E9QA 3O21A 3B1KA 2CFSA 1IY0A 2GH1A 4BMSA 3IC9A 2HX1A 1DC7A 3HNPA 3SHVA 4KXVA 5DYYA 4B3SO 3KE1A 3SLGA 1IY1A 4QYIB 2QWNB 1R00A 1SKMA 1GQYA 4BO1A 4DR2B 2ZT7A 1QLJA 2ZXFA 1ZCAA 2FMTA 2I62A 2YXNA 5D5QA 2WILA 1T2EA 3BA9A 3WDMA 3U4IA 2PA3A 3NVMB 2XKKA 3M5WA 3GLFE 3MA0A 3I61A 2WMNB 3DD1A 3FOFC 2Q99A 3EIXA 4R98A 4LH7A 3NZEA 4DA8A 1BCSB 2CMHA 1B42A 4DT1A 3SVLA 3KIZA 3GMSA 2JIZA 3VTZA 1DXHA 4MIYA 4BNTA 4LV6A 4PFQA 1LY1A 1S5LZ 4V0SA 2O20A 3SDBA 4MUFA 1NDUA 2R25B 3CNQS 3FFTA 2FW6A 4GX1A 4PPGA 1N3LA 1IV2A 1Y5LA 3IDSA 3JZDA 2IOHA 2ZAUA 4JASB 1XTQA 1X1CA 4LJSA 2HA6A 5EMHA 3TPZA 4N21A 4ZYUA 4AZ3B 5K0GA 2ITDC 2W4MA 2CN1A 2NNWB 1SCBA 3ZCTA 3RBAA 1AURA 4RJIA 3DDHA 4NUTA 5KAPA 4QU0A 3GUYA 1EJBA 1FFGA 1N4AA 1TUGA 1MEJA 4P7JA 4IXDA 1YZKA 1OLXB 4MKFA 421PA 3VYUC 4RUEA 2XBUA 1P17A 3ET4A 3I9NA 1M57B 3AESB 3H5WA 1WY7A 3GA5A 4IXTA 4MSWC 5IAOA 5A0TA 4ZC8A 3EUFA 4N39A 3RTBA 3ESQA 4TLAA 2FQQA 1A95A 4QLOA 4DXAA 3THYB 4GZRB 4D3ZA 2ORYA 1K08A 3HJFA 1AMUA 4FGJA 3S3XA 1JLLA 3F5SA 4EJSC 4RIEA 3ZY4A 1OZGA 4UEQA 1YF2A 3LXXA 2VKTA 3TXAA 3DMFA 4W7SA 4F11A 1Q1QA 4E4TA 3FPIA 3SYCA 1AB5A 2XDAA 1E0SA 2WSSA 4J1SA 4Y0AA 3VH1A 5JHGB 3LC7O 5DBOA 3JALB 4J4TA 5JJ5A 1CRPA 1SKYE 3HRHA 1M4UA 5CNIA 4EYGA 1CQJB 3E48A 1Q0PA 4LUCA 1NXPA 4BVEA 2MYUA 2B3DA 3GCXA 4YRCA 4IIEA 5KOYA 1M6NA 4CR8A 1SM4A 3TZEA 2AC2A 3M84A 4JYMA 1IV3A 2C2WA 4Q9LA 2ZQ5A 3TM4A 1DBRA 2ZEJA 3WQSB 2BHTA 4XWOA 3QEAZ 3BMCA 3I83A 3ZZNA 3QEJA 5BRAA 3LFOA 4QE3A 2VBFA 2OHIA 1AE1A 1BYUA 4GXRA 2WWFA 3O4VA 1RKQA 1T3ZA 4IOLA 1PF5A 1RZUA 1TEVA 4IIGA 3NDIA 3A28A 4ER6A 2Z1TA 3V9PA 2NT4A 1BH6A 1DBSA 1ULSA 1YJBA 4KFMA 3I0ZA 3M4JA 4MEAA 4AY5A 3ZXYA 3E1GA 5BN3B 1FPMA 4UHDA 1R8JA 1LCIA 2DUWA 2XUMA 3GLHB 1J1UA 1JNXX 4A15A 5LWHA 4Q16A 3BIFA 1W2HA 4BEJA 1PUIA 1RHQA 2O7RA 2HK9A 3A9UA 4NNOA 5E95A 5I4BA 3ZU2A 4MV8A 4QQNA 3ZI4A 1SKQA 3MT8A 3UBTA 1MR3F 2ZRBA 2NACA 3QYPA 3VR5A 3ANTA 3MLEA 1GN2A 1NOKA 4C7MA 4BLRA 4ZJUA 3ENWA 1JE1A 3RSOA 2ZZNA 4ER3A 1N6KA 3UH0A 2ZYRA 4PAGA 4PZUA 3TINA 1HEUA 5ER9A 3V4RA 2X9GA 4LFAO 1GPNA 3DHNA 3HZHA 4G8CA 4PONA 2PSFA 5LDDC 3PXBA 3K0SA 2HJGA 4IJ6A 4MWTA 2P8SA 1ML3A 2OUKA 3JQ7A 3VZRA 2F3RA 4RHXA 3ZJZA 5F1YA 5FLKA 3AKDA 1WDLA 2FC3A 3A14A 3ADOA 4ER5A 4QDZA 5HEKA 1R0RE 2WHPA 4NV0A 2AYXA 3Q40A 4BFVA 1UXGA 1M93A 3Q2KA 3HFJA 1XBTA 3W8RA 4DV1B 1TZ2A 4F1KA 2A4KA 2BEVB 2FRDA 2QLBA 3ABRB 3KP1A 1YJCA 4GO1A 2X6AA 3R7WB 3QG5A 1PF7E 2X6TA 1A96A 3I52A 4KQCA 3B4SA 4TZKA 1EE9A 3CISA 4XGRA 1MO5A 4HXGA 5AK6A 3BICA 5T8KA 4F5DA 3KKYA 3DF7A 2BOCC 1OMOA 2PH7A 5FL7G 1HNZB 1RJ9A 3MUOA 4PGFA 3AG4B 3WLRA 3STUA 3TIIA 4WNYA 4EY8A 1OROA 4U2DA 2ZR7A 1IB0A 4TTJA 4E21A 4MGIR 1O57A 2FOIA 2FP4A 3O8LA 5E3IA 3KEQA 2A9VA 4YMHA 2LR0A 4MQ4A 4NEGA 3G9TA 1XMPA 1DE0A 2W71A 4X1KA 1RHUA 4OM7A 3SBDA 1OH6A 4Q66C 4QJ4A 5ERGB 4OB7A 4AZSA 4J10A 3IBTA 2JVDA 3Q5GA 4MMXB 3FIJA 3G13A 4LXGA 3KBOA 5I9IA 3FTEA 1EHIA 3UCFA 1UBFA 2VH5R 1M8KA 4UDOA 1RJFA 2FKXA 3H6HA 1JG1A 3CLUC 4NYMQ 4KP4A 2GEBA 1RKVA 2VPZA 4QPJC 4RHCA 5CH3A 2MSLA 4PO3X 5JRJA 3FCOA 2RCNA 5TQ2B 4Q4AB 3V4LA 5IF9A 4EF6A 2R7KA 1ZUIA 2D1YA 2LXNA 4NH4A 4NECA 1G5QA 2ODAA 2VPYA 2QM4A 1TD1A 1Z0UA 1K7XB 1YS6A 2WPNA 3FTPA 1NUPA 4QGHA 1NFFA 1G0NA 2E1RA 2P9HA 3K5WA 3OETA 4OMDA 5JYDA 5KQRA 2AFHE 2RGNA 4ITRC 4KQEA 3BHJA 4KIUA 1Z4QA 5B57C 4MV6A 3GUUA 1Y82A 3THWB 4FZ3A 4TKLA 1PHPA 2PR7A 3NCHA 1W93A 4L4ZA 1RNLA 2HMYB 3K5PA 5GIOE 2R7NA 4AJIA 3FPAA 4RD6A 4DLKA 2NO0A 4HLUC 4ID9A 4WFHA 2C98A 1GTL1 4M7RA 4RLHA 4XEUA 3NR2A 1WV1A 3TKLA 1V2HE 1WX1A 3MS4A 4C89A 3HXKA 4KHPO 2OD7A 3DMTC 3RWMB 3VR2A 2NUTB 3L8MA 4TWAA 4Z4HA 1VH8A 3R5XA 3EUAA 1C7JA 5AESA 3WL4A 1XFAA 2XGOA 5IUKC 4IEIA 3M6IA 3FWZA 2IYWA 4IJMA 4WH0A 3IA7A 3ZGOA 5DYNA 1Q50A 3O4IA 2B2NA 3VQVA 5T4HA 1Y8RB 1UJ4A 4ANFA 3M6AA 5H59A 2UXBB 1ZL8A 2A79B 1I7LA 4BRWA 4D7AA 4H77A 1JYEA 1GL9B 1LJLA 2O2EA 1F06A 3UV7A 1AZWA 1NXSA 5LZ8A 3AKCA 3COVA 2W0FC 5T4FA 1AVTA 1PNLA 4A36A 1XDCA 2C20A 3C3YA 2VQSA 2HJFC 3GBSA 3K0BA 4MHOA 5AW5A 3SYMA 3VC1A 3MJDA 3TIXB 3JQAA 5E2BA 1JKMA 2P2CA 3ZHUA 1I1OA 1LU9A 1N8RW 4WZZA 2BR5A 1P72A 3ROEA 3SC2B 4G0UA 2RHOA 1Y6ZA 2YVAA 2ZJAA 3GQVA 1KQGA 4BQIA 4EW3A 2B7CA 2SCUA 2A9OA 4OBEA 2WD7A 1XDDA 3B7GA 4HATA 4MUHA 4E4YA 1EDEA 5DXJA 5JRDS 1TUIA 1SKAA 1VSUA 3DE2X 4JROA 2PI4A 3FNQA 4YXWG 2JEYA 2QN8A 3P20A 4I9WA 1KP9A 3K0GA 1NNLA 2PKEA 4ENWA 3AF1A 5ITSA 5L6LB 1LDBA 1P4GA 5EGSA 4MS2A 2RH9B 3B1ZA 3T3OA 3QHDA 3HY6A 2E74B 3I3OA 3K0AA 4GVXA 4JBGA 2VJBA 3OQJA 5DNDA 4BCDA 3UGTA 4K9KA 3GGPA 2O59A 5DI9A 2ESRA 1U0LA 3Q15C 5AVZA 4GUNA 1PFQA 2YRFA 4WE3A 3M7MX 1IHYA 3L4KA 4NJEB 1NV9A 5KYNA 1PDVA 3OJWA 5E1AC 1XZMA 5JZBA 1XVAA 3LQYA 2Z3ZA 1MOZA 4QO8A 1VIDA 2YWRA 1OJLA 3UFXB 1L8XA 3ILSA 2XT6A 3SIUA 1ECLA 4F60A 2JIMA 3D8BA 2JLXA 2IZOA 3JARB 3A4NA 4U6SA 2ZRCA 1EGQA 2WAOA 2QNRA 4B87A 2YIAA 4JVLA 3AMVA 1B06A 1F48A 1KYQA 1WOMA 3EFOA 2HV9A 3N6XA 3JQAD 2DXIA 1C3JA 1R3JC 1BNCA 1O5IA 3FCSB 3PQ6A 4LZWA 3K4PA 5H0IA 2PUCA 1DEHA 4WBXC 4PLTA 1VPWA 2DLNA 2YHIB 1GUAA 3WWCA 4WLOA 4PGHA 4F85A 4ON9A 1NR7A 2A1UB 3HL4A 3OEED 4CM1A 1Q7CA 5KEIA 3QFCA 1JG2A 5L3QA 2QQ0A 2NVUA 4O3FA 4I7ZB 4D4JA 4MUIA 3L0PA 3CCLF 1Y34E 1SZCA 2NVWA 2NZVG 3A25A 2JBAA 3HUFA 3PNVA 4KQFA 3RSSA 5BURA 5I8PA 5CB8A 5I9NA 3LNNA 2KQUA 1WLYA 2WIDA 2V9YA 2Z2ZA 2BFDB 4IVQA 3ZTYA 1KQFA 3Q1LA 4RLSA 5KHJA 1VSQA 1XEQA 1EBUA 2BC9A 2CE2X 1MB3A 1ZOSA 1BSMA 2GBLC 2NTVA 5B1BC 2OPBA 3EEBA 3H4TA 1HM5A 5EL0A 4BB0A 2RGXA 5L4NA 5EE0A 1YAHA 4I1SA 2QW8A 3LZDA 2Q27A 4YACA 5JTTA 2C9YA 2SHKA 3T3PB 2OV1A 5DFAA 3OFNG 3WHLA 3EMBA 4FNOA 4ZO6A 5K8UA 3QI2A 1WUYA 2E5FA 1PJTA 2GLTA 4FDUA 3HKCA 3QPDA 4TSFA 4GXNA 4DDKA 4G0WA 1SOMA 3M9XA 4R40B 1VHTA 2QZSA 2VYVA 5LR6A 2P90A 3JD2A 3ZHSA 1BN7A 1FLAA 3AEXA 5A04A 2HG5C 3PE3A 4TTSA 4PPNA 4HWRA 5TV2A 2C99A 3KJEA 2GT1A 2C8JA 2J3DA 3EXEB 5C80A 3UPTA 2FWPA 2EFEB 2OAQ1 1P4RA 4EKDA 4HS9A 2KM1A 1ZESA 1NMXA 8LDHA 2ZXEA 3F4KA 2YV1A 2EG5A 3LKVA 4Z8YA 4PBTA 4M1SA 2GCOA 1XJ0A 1EDOA 5G1NA 3DOUA 2Q7DA 1NBMD 4X90A 2GF9A 2C97A 2XUQA 1AGXA 2ONCA 1XJ5A 3RYCA 1GV0A 2XHZA 1R7RA 4H3HB 4M9SA 4MUGA 4TTVA 1LX6A 1K73W 2WUGA 4NH0A 1M8JA 2ZUDA 3LHFA 1II9A 2J0QA 1Y9ZA 4UPDA 2BTOA 4N6OA 1U6IA 3NANA 4BVKA 5AUOB 1SNYA 2Z08A 3G8YA 3OJ0A 4KAJA 1MHPA 5KKAA 3FRIA 1YDMA 2XCOA 1FDTA 3HCAA 2ROQA 3KZOA 4DR7B 3P7MA 4PI0A 2ARHA 2PD4A 1ZH4A 4NOMA 5KNBH 3E1YA 1IN6A 1GPYA 3AB7A 3AOEC 5BUSA 1FXVA 3NGXA 4HB4A 4KMRA 5LYJF 2HHCA 4Q02A 3AHHA 4D7SA 1GCOA 1QAQA 4W9NC 4RPIA 3ZUGA 4H4EA 5AKJA 3HJHA 1MU0A 1HZJA 3IERA 3QX3A 1SIBE 3H0CA 5JJEB 3RTCA 5F73A 1G8YA 1QBGA 4RPJA 4HBZA 1CDOA 3DE6X 3UENA 1KZ9A 2RCVA 1UPTA 1YR8A 1CVLA 2OXFA 2Q4OA 2VTKA 2XCUA 1VA4A 2XRZA 3GB9A 1H2EA 3LKBA 4A23A 2AK3A 3CZAA 1GGEA 3F3KA 3H9QA 4W6ZA 1K6MA 2ZIZA 4B8YA 4B7ZA 2Y6VA 2ZITA 5KOJB 1X15A 2AXPA 1VL8A 3BSSA 1VQVA 1KEEB 1A2KC 2CLLB 4JC4A 4R0MA 1GFSA 4W82A 3OIUA 1FTNA 1S9HA 2Y05A 2XIQA 1JVMA 4ISCA 4ITUA 3PF9A 3VDMA 4AFNA 4HUQA 3JWEA 3Q7RA 2QTLA 3OZVA 1S2DA 5KQGA 1CS4C 1KMMA 2YJTD 2AG5A 2IF0A 2BHRA 5CRIA 1D4OA 3SY8A 2AKYA 1KDTA 2Q07A 2EYQA 5DRTA 1P31A 2GKSA 1FXKB 3CZQA 3WKEA 3K09C 4ZYWA 4TL6A 3WKBA 1NFRA 4W8GA 3C1TA 3S2ZA 3OTQA 1CLIA 3I2FA 2A5JA 4HOYA 5CH8A 3FZNA 4CIWA 4IILA 3DVAA 2GEDA 1AKUA 4X64B 1NOJA 1RDFA 5FUYA 4IWXA 1PK8A 1KJ8A 4JX9A 4D42A 5EJEA 2AI2A 3HV2A 5BNWA 5CBPB 2O0KA 5JPIA 5SYNA 3UTCA 2XNCA 3NVKE 3NVIB 1U94A 1Q6ZA 1US8B 3CS3A 5B6PA 4L3OA 3U3KA 2BI4A 1V41E 3A0HZ 3AFNA 4R1OA 1OAOA 5JR3A 3A9WA 1P7ZA 4YYEA 1JQBA 1P5ZB 3DD5A 3CUVA 2AXTZ 1F2VA 1Q1NA 4ZVRA 1CQPA 2A7XA 4TQFA 1JD1A 2AQHA 3PPVA 4PX3A 1ZYUA 2BOVA 3K9NA 2I6QA 1OH8A 1H2AS 2BEKA 5FBZA 2YUIA 3ND6A 3QZUA 4GZ3A 2NO4A 3HCCA 4J91A 4L6IA 3SBEA 5LGNA 1DXYA 4NBUA 2QU7A 4QXMA 3G6KA 4YRFA 1YBFA 4NYJQ 3GJYA 3AI2A 4IGEA 4BMXA 3D6FA 3WICA 4UVEA 4JOQA 3WGQA 4EEKA 3S7ZA 3CCQF 2OO3A 4HQFA 2O1XA 2X23A 1A2BA 3D8SA 3E03A 4LXYA 4PHCA 4F4JA 1IOWA 2GEKA 3HCOA 4MUYA 1DLBA 4PQEA 4WA7A 4IGFA 3IQEA 5LC1A 3WY9A 3SE7A 4EUHA 2H1IA 1RCTE 4ZDKA 2H16A 2YWDA 1PWEA 2WW8A 2ZATA 3BQ9A 1HT1E 3A05A 2W4IA 5H83A 3HKCB 1AI4A 4E46A 4PSVA 2P6JA 1G38A 2OQIA 4ARUA 1R6BX 2F3PA 4MULA 4GE3A 3U44A 4DLSA 4TWBA 4INAA 4UHHA 3WHKA 1FQJA 4PO1A 3WC4A 1A82A 2D59A 4A9AA 1L7EA 2R8RA 5IFLA 3TTSA 3RUAA 5B1EA 2C2OA 4Q20A 2BIFA 1P0IA 2F1MA 3ADPA 2CGNA 1E1MA 3F5MA 3FLEA 3ZHCA 1K5SA 2F43A 3HEAA 3HL0A 4FLMA 3KAJA 5ALRA 1GNQA 4BIMA 3DG9A 2I7CA 4RIFA 2JFQA 4Z7QB 4D3SA 5KC9A 4PHFA 1LNZA 4DY4A 3CUUA 2A3RA 1FRZA 4HAVA 4IM7A 1EP1B 1P0QA 4C05A 3C3MA 5CLJA 3U60B 4LFBO 2CVLA 2F9ZC 1UJMA 1JZQA 4CEIA 2PGXA 1OFIA 3OC0A 1MABG 1IMJA 1YL7A 4JAAA 4PFKA 2OSVA 2W6OA 1H4TA 1I2CA 3EHBB 1LW6E 3P9QA 1G6Q1 4OPAA 1OWOA 4NENA 1O9BA 3KHSA 2YMPA 4PRZA 2AXEA 1CN7A 3NIWA 5D7BA 1EPUA 2R7LA 2XEDA 2ZJ6A 5TEVA 4NWIA 2FW8A 3C3KA 5E7MA 4CM9A 1REQA 2AE2A 3AG2C 3UHAA 2HXSA 1SRRA 3DAFA 1EVEA 1GLVA 2OHJA 2RFLA 3DEFA 3QWBA 4OUDA 2AG0A 4LF6O 3A32A 3E05A 2UYPA 2CHEA 3PL1A 4UPEA 3GLIB 3JVEA 1QF7A 4BVJA 2I6SA 1MCZA 4JGGA 4KOEC 2R4UA 1TM4E 5DW3A 1GPH1 2DTDA 3BMNA 4F3TA 4OI1A 4HTFB 1FVOA 3A2LA 1PNMA 5IT5A 3SJ7A 2OLKA 1Q7YW 3PHBE 1Z18A 2JCGA 2W2NA 2ZETA 2ONJA 4CRWB 3MJFA 2WNHA 3MTAA 3K0AB 4IHQA 4JGIA 1AV6A 4C6RA 4HZIA 4N7BA 5HF5A 2HP3A 1OXUA 3DYVA 3HZZA 4X85A 3ZW7A 4B34A 1N5IA 3VSDA 3WGVA 2D1FA 5A6VA 2P2NA 3OE1A 3AB3A 2BP7B 3LYAA 1YK1A 4J6EA 1KJNA 2NTJA 2VCYA 5K0ZA 3OOSA 2P6NA 4LH6A 2X3FA 4U00A 2VNKA 4PX2A 4I5DA 4Y7CA 3ZC3A 3PR2B 2CD9A 2VWGA 3HU2A 3DQQA 2JLBA 4P4NA 1CIVA 2F62A 4BO0A 1VLHA 1VJ1A 3GJQA 3ME5A 1SG6A 4IX9A 3UY4A 1ESEA 5ENVA 3W5BA 4C81A 1D4ZA 3EVEA 4U63A 2HRYA 1CUBA 2IYPA 4A6DA 5K3OA 2XTAA 2GZLA 4DM3A 4BKMA 4PPQA 4BDSA 3OI7A 1WP8A 2R751 1CRQA 1MJ5A 3QFFA 4UUOA 4U2BA 4UTPA 4G0MA 1KO4A 3C6QA 3OE7G 1RXEA 1MQ8B 3T7RA 5KPDA 2H8GA 1W34A 3TZ6A 1RXCA 2B92A 4FGUA 1JG7A 2JBWA 5GGYA 5ADVA 1N5KA 1AJNA 2H1OA 1JJ2F 2AIRA 1RKBA 3DFZA 2XD4A 2BRUC 3MK31 4ZARA 4RK5A 1JDVA 1GKUB 1GT91 1M74A 2GO7A 1EAYA 5HGXA 1E7MA 1Z7YA 4LPSA 3STXA 4UB6Z 4G85A 1ZGGA 4M7WA 3QV1A 2P9GA 4NPCA 2HMVA 5JFOA 2GZMA 4YAGA 5EHNA 4E09A 1C30A 1GLNA 1JIUA 4B6QA 2WYWA 1JA1A 2VQEB 2ZB7A 4ZYTA 4RIIA 2LP7A 3X2QB 2DQ4A 3FPEA 2ZM6B 2OL4A 1ZJWA 1C1XA 1CX9B 1E3TA 1X13A 1Z2NX 3DAGA 3U09A 2GZDA 5FR2A 3JYNA 4UNQA 4KCGA 3C41J 1UBJS 3O03A 1YKGA 2ZVQX 1SK9A 2CLKB 2FW9A 3HBFA 4TKMA 1NN3A 4JFRA 2PSSA 3ZWNA 4A5OA 2XE4A 4C03A 5F1PA 4RO2A 4DXWA 2ZBQA 4OHXA 4AF8A 4G36A 3MUNA 1NF9A 3L1HA 2RQ6A 1NXTA 3OX3A 4CU5A 4QD3A 1VK3A 4GI3A 1NQXA 1JEQA 3G9XA 4FZ5A 2JGRA 2C84A 3KKEA 1G60A 2R6GA 1PJ3A 1E1RG 4F7WA 3ABIA 4A73A 3KLOA 4QUIA 1VJGA 3OEYA 1VF5B 4MP3A 3PC8A 3BTVA 1YZFA 5B1HA 2QTRA 2HX0A 1PLLA 4MZXA 1P1FA 1PJ8A 3IKVA 3BYZA 5F12A 4ZJZA 1BD4A 3HMQA 1KMNA 5K01A 2UAGA 1YR2A 3C5WP 3LFHA 4M99A 1N2OA 2YRWA 2L35A 3DBIA 2QAGA 3HFRA 1JJOA 2VH1A 1RABA 4XOIA 1XLWA 3I9JA 3AZPA 5C81A 2YYSA 3WISA 2H2IA 2IA5A 2WYHA 4XYGA 4TM7A 1C4OA 3IJPA 3FIUA 1H2FA 3FMPB 1QZXA 3H5AA 3A9CA 5L3ZA 2BRUA 4MQMA 4B85A 1H69A 4W9MC 2OHFA 3L8HA 3G9UA 2FRXA 3BORA 3EUEA 2HU8A 3FZQA 4IRMA 4LQLA 2C9DA 1W581 2FZEA 4EKIA 4YXWD 4I9UA 5IN4A 2B1IA 2Y0DA 1Y4SA 4JF3A 2G9UA 2NYVA 1Z63A 1FTGA 2WHRA 4RFSA 4DJFC 1ADGA 3W04A 1T8RA 4X7RA 1JR3A 5E0OA 4JJ4A 3WWEA 1E99A 2JZCA 2VAXA 1X3SA 2G80A 1LBEA 3ESRA 4K6FA 2P4HX 4I55F 4N3NA 4Y2YA 3SIRA 5IXYA 4QDUA 3BE8A 2GR9A 4CQNA 1QDEA 3ICVA 5EUQB 2C3MA 5JAHA 3JZMA 1VLQA 2AMFA 4DV6O 1WUIS 1RWVA 1Q8RA 2X6QA 1FJXA 3MOSA 4AUKA 5CA1F 2C2YA 5IZCC 1SY7A 3KU4A 4BNJA 4C7BA 2HWUA 4B6JA 5DISB 1UEJA 4M1MA 4XWKA 1ECFA 1JHDA 2QRNA 3O0TA 4CCYB 1F0YA 1ODCA 2IHUA 2NPIA 3C3BA 2V7EA 1MX1A 2WUEA 2VPTA 4IQ4A 4BATA 1W29A 5EQFA 3EOBI 2QRMA 4Y2XA 2ZYGA 3LQQA 2Y4NA 3F49S 3QVGA 3RSCA 1WHSA 5A0VA 4G0ZA 3MG9A 1QCDA 3TOXA 3RVOA 1M2KA 2RMKA 4U3JB 2CL5A 3JQQA 3RARA 5EBLC 3VXKA 5M34A 4BNDB 4BUZA 2FUNB 1FK8A 2ZRDA 3AEKA 3NWOA 2AN9A 3ZX6A 2PGOA 1OI3A 3BDVA 2R8ZA 1IK6A 1VRCA 1NJIW 3JV7A 4LHYA 1YA6A 3GMIA 4XPZA 1JEQB 4QUEA 1XPJA 3FYIB 3Q4HB 3VCZA 3DJFA 4FYIA 4YPOA 3ZDEA 5B7GA 1U65A 4HHEA 4Y0VA 1QTQA 1Y1KE 2D2VA 2QX4A 1Z16A 2IEYA 4HDQB 3QX8A 4BC0A 4DCTA 4ZVOA 1HE3A 3O8OA 1OC2A 2WHYA 2HSWA 1AKVA 2Y1GA 5ALXA 3WB9A 3SQOA 3W9UA 4C7KA 1HEYA 1XU7A 5FPOA 2IYYA 2WINI 4Z1MA 4MDFA 1R6KA 4M7PA 4UUMA 4CKWA 4TTPA 5IH3A 1WCWA 3L70H 1V8FA 2C82A 3RS8A 2YTZA 4BRUA 1K9MW 4QNMA 3N87A 1E94E 4BW9A 1KVTA 3AR2A 5JCJA 2DBVO 4XKJA 1JPVA 1HTWA 5DZSA 2CXOA 4H1VA 4Z0PA 5LZ5A 4QRIA 3DBRA 3LSQA 2BZ1A 3AUXA 2VDJA 4PA7A 3H3JA 5F64A 5HP4A 1XVVA 3D6HA 4EP1A 3M1AA 3ZGNA 2YQZA 2OCKA 2ZYTX 3I5AA 4JI1B 3PRKE 2AJBA 4LHXA 1HNWO 4M3NA 4ARZB 1A9PA 2VUTA 4X6UA 1ORDA 2BO1A 4ENSA 3OZAA 1RA4A 2OIEA 4B3RO 5IKPA 4K40A 3EEIA 4G4IA 1SOAA 4I08A 2BLLA 4MP6A 5HJ2A 1ZL2A 2HKIA 2J0UA 4FN4A 1QKKA 3F6CA 2C5HA 3B6NA 1KDYA 4QPZA 1E77A 5JG7A 1VL1A 2M6KA 4JBNA 4B46A 3U13A 1ZVJA 1JFTA 1N0JA 1XEFA 3JW8A 4M9QA 1NTZH 5L40A 2C3PA 13PKA 1XYGA 1OD6A 1FW8A 2FDRA 2R1VB 5HDBB 2BJWA 3OZIA 1AGRA 1VL2A 1D5CA 4IIUA 1GLGA 1UWVA 2QS9A 3N6RA 4QRHA 3JYHA 1HLFA 2I71A 1Z8FA 4QJFB 1WVIA 5FWYB 3WBFA 1B6QA 4C08A 3EY9A 4QAJA 2CUTA 3H97A 2H2AA 1S72F 2W58A 1HOTA 1T4DA 3ZV5A 1OLUA 3GCWA 3X0DA 2Y4TA 4HLDA 1H38A 3DV0B 1P1HA 4UNIA 4KR2A 2HBZA 1XMOB 2OXRA 3RLFA 1U8EA 5JMPA 4WY2A 4J16C 3VTKA 2D1QA 3ZLTA 1AA9A 3LW8A 4JOSA 5HXAA 1KIFA 2CXUA 4TYWA 3PIDA 3CLTC 4WVLA 2DHDA 4U7FA 1MNGA 2NO9A 2R66A 2AZ2A 2IZ5A 1L7PA 4CJXA 1WA5A 2V7UA 5ER6A 2W7TA 4H0CA 1TL7C 3G4SV 4PLYA 1LVGA 4RQEA 1CS0B 1G6HA 2C54A 4REMA 3FNGA 4Z9XA 3U7QB 5IVHA 1YS9A 4H33A 1LI4A 4DV7O 2O48X 3MB8A 4TYYA 3UB3A 4BNWA 1XK6A 2JPDA 4O2AA 1GSAA 3H65A 4U2CA 5C1PA 4ZCLA 2QVLA 1ZXXA 5HY2A 2ZPAA 2L0XA 5FV7A 2Q3HA 3FPGA 2EBOA 3N8KA 1YIOA 2PMPA 1ZCFA 1ZM4A 4YIPA 3L7QA 2C5SA 3V1UA 1ZRMA 3G8DA 1IN5A 2ZLBA 2IITA 2TMKA 2AR9A 2PY5A 3ETEA 1TQ6A 3TLGB 2UXDB 1C80A 2X5OA 2WJGA 1XA0A 1ECPA 4HPWA 1QB7A 2FFQA 4UBOA 4LOKA 3VPHA 2DR3A 1K0UA 1ONPA 4FE7A 4ARAA 5JSHA 4NBNA 3EVNA 4WZBA 4EGSA 2NU6B 1JXQA 3HMKA 2KTVA 5L51A 4DJAA 4ALKA 1AY0A 2ADOA 4JTCB 5H68A 3WKAA 5LMCA 5G4UC 1R0LA 2QR5A 1CY1A 1QVFF 5GIPE 1VCHA 1HG1A 3DXFA 3RTAA 5C1IA 1D8TA 4XUEA 3C7KA 5A2QN 1ZDMA 3NHPA 1O6BA 1UZLA 1II8B 4HFNA 1ZCBA 1UPAA 1ZM3A 2I29A 3AHDA 2XKBA 4PQFA 2K7FA 2BMJA 3OIWA 3ZVRA 2Q28A 1KKDA 4I66A 4DDWA 2OO5C 2B5VA 4GOJA 1KE2A 2WY2D 4U7OA 4Y2PA 4DUGA 7MDHA 3LMKA 1KBOA 3G6EV 3CH7A 4Q4JA 4G5SA 1LZLA 5B1YA 3IA2A 3GEPA 3BFVA 3WQQA 3WGMA 4XLLA 2Z8YA 4WOPA 3OHPA 4RZXA 3W7BA 3IKEA 1P2FA 3IOBA 2BHNA 5AXBA 3CCUV 1AX9A 1CV2A 1KY5A 4JJEA 2ZRMA 4UQLA 3EFBA 4H0FA 3ETQA 1IURA 1EMDA 2LBPA 4QC2A 3CLHA 3OM1A 4JB2A 4D43A 2IY7A 2C7BA 3AEUB 2BDUA 4MUKA 4BMPB 2HF2A 4KDEA 3ZOZA 4G89A 2AFHA 2GZ1A 2XB6A 4OQFA 4RQBA 2WF5A 2VR1A 3B8MA 2HVJC 5I5GA 3TNLA 4EW6A 4IY1A 2ZT6A 1OCCC 1H3FA 5BNTA 2Q9BA 4CC5A 4RK1A 1ZD2P 3QBEA 2R6R1 2EAUA 2QMHA 3MMSA 4ZVTA 1CP9A 2GOYA 2OBXA 4RK6A 2HUPA 2W48A 3KHKA 3NWJA 1OX4A 5AXAA 3TUZC 3OGCC 5IWAB 4G4SP 4X92A 5A2QM 1SKBA 3EG5A 4BX2A 4UCSA 4L76A 5IABA 1Y1PA 5DGHA 4V1CA 2HVYD 1JL3A 3Q10A 2IDZA 2XXBA 3WTBA 5JYCA 1YUNA 3K9SA 3DGFC 4FFRA 4L5IA 2B25A 2HJRA 4WESA 1JMKC 1K8ZB 2P65A 2PS3A 1G9SA 3AFGA 4J3FA 4F46A 1H4QA 3MINA 2OHWA 3KKPA 3ICPA 4PS0A 1RIFA 6PFKA 3HSSA 3PDWA 1G2PA 3QW2A 1ISHA 1HTTA 4LYHA 4YDSA 2X5JO 3AUJB 1HDCA 5BNFA 1RRGA 2WHXA 4JYBA 1A27A 1Y9JA 3O4GA 4JCOA 3WV5A 1RAGA 4BVLA 4EBBA 2X9NA 4NICA 4RY2A 5GVSA 1QHTA 2ISSD 2HXGA 3W77A 1RHKA 1RLIA 3OSUA 4HK4A 3ETDA 3AIMA 4RVGA 2VDWA 4N3GA 5IWCA 5T7BA 5LCXA 4NSNA 3VAZA 1CZNA 1QGUA 1QFMA 5FYDA 3TOVA 1EDBA 3D0RA 1UQUA 1VB5A 2Q4BA 1DWPA 3FDIA 3INNA 3NATA 2GN2A 3LE8A 3O0DA 4IOMA 1U43A 4WFIA 5HZGA 3WGIA 3WJPA 4FMBB 1AP5A 4WWHA 3N4YA 3EIHA 3O9ZA 2G0NA 5KWSA 1HUQA 3W2GA 2IJIA 3QU2A 2Q1WA 1V9SA 1OHHD 4ZO9A 1EZJA 3RHZA 2RHCA 1GKFA 2Q7XA 3M89A 4W1QA 2GYVA 5LYJB 3ECSA 1JDBC 4NS1A 4UCQA 2CT8A 1W4RA 2PMCA 2YC4C 1E64A 3UT5B 4KQMA 4PHGA 3A1EA 1CJVC 2HPVA 3KQUA 1F4MA 1SCIA 2CFIA 2AQIA 2H1CA 2V0NA 1FNSA 4OJNA 4QOFA 1NIPA 1CJCA 1YRHA 1ZD4A 1NI8A 2CSUA 2VP0A 4YRGA 5KTPA 2EYUA 3BVPA 1ZRHA 4AAYA 5KDLA 1L4EA 3GDGA 4F84A 2ZQZA 4EEXA 3KC2A 5D8DA 3ZE2B 1IOVA 2LBWA 3C5HA 3N7AA 4YJDA 2CK3D 4MO9A 4P3KA 4U5XA 4TXNA 5JSKA 4I1YA 1QR6A 2IGBA 3OOYA 3D81A 5AJWA 5C7IO 1PEDA 1NVPD 3DLCA 1RE1A 3AT1A 4QDTA 1IHPA 4HNQA 3IHLA 1SB9A 1C3EA 3P0EA 1KNQA 4GBGA 1E1RD 5B1DA 5B3KA 2QA4V 4X9QA 2NQTA 4FFWA 1DP4A 1V0JA 1Z74A 4MP8A 3PICA 4M2LA 5AHWA 3WRXC 1F9AA 4FHFA 1T1RA 3Q3GE 3NTQA 3H8SA 4R05A 4RPLA 5A05A 4BNKA 3R7FA 1KK1A 1LPPA 3FZYA 4ISBA 4E7PA 1K7DA 1ZD9A 3GP3A 5L3EA 5FPQA 1VGQA 3O4FA 3DBOB 4GPIB 3I56F 1PYOA 2NO7A 5H7XA 3UCEA 3LGSA 4EO4A 3LYLA 4TVSA 2Q46A 3OE7D 1JHUA 2XUPA 3P2IA 1PEAA 2PX5A 4RQFA 4EG4A 3WYDA 1CUJA 2R47A 3N74A 1Q1ZA 1FQOA 3E3LA 4RLQA 3WWPA 1U2QA 4C0XA 1YBMA 3ROFA 1N1EA 4JQZA 4J7XA 2VPWA 3AY0A 5KTNA 4X65O 4C1BA 1SQVH 3EE6A 1J09A 1Q6IA 1Q6UA 4B7EA 5ICSA 4D0GA 5DF1A 1VE7A 2O2HA 4GBJA 4R40A 3QIVA 3F2VA 4L50A 3ZMZA 4NCBA 4P38A 2IS4A 3UUFA 5JY6A 4MVWA 4CC6A 1Q7TA 1AUVA 1U8YA 1SQ6A 2FCAA 3LL7A 2WLLB 2HP0A 1FUYB 2WYIA 4Q1VA 2N04A 4WCEV 1KFJB 2Q3EA 2VT2A 3KV1A 2ZGVA 5CK5A 4D9NA 1Z12A 1YK0A 1CZLA 1SCDA 3F4LA 3AHCA 5EGNA 2Y1EA 3V00A 2YNMA 4EDFA 3L07A 1QVGF 3TLCA 2AJTA 4XGKA 5AD1A 2OM2A 4R1QA 4EL0A 4FDMA 4LYAA 2A7QA 1IY9A 3V4OA 1JGTA 4BO6A 3E35A 2HLDA 2XOEA 1OWNA 4JV5O 1R0XA 4L6CA 4RV5A 2ASVA 5E6UA 2CDNA 3AJ9A 2VA8A 3H2SA 3GLSA 3NJ4A 4D45A 3QOYA 4C7VA 2YXEA 3S2EA 3ZXXA 1QZZA 5EMLA 2M6SA 1EVKA 3GOHA 2WPDD 4DV5O 1X3LA 2D5BA 1VJDA 4KLCA 3ZS8C 1KPHA 3GT3A 3OM0A 4WQMA 3KXIA 5DTJA 3DMNA 1FSFA 1Y4DE 4N5NA 4Y1EA 4C2BA 1ACMA 3B09A 2CBZA 1P5HA 4XDJA 5A4DA 1G8JA 1MF7A 1QONA 2EWWA 2QX8A 2ZI4A 1V16A 2YS8A 4LGMA 3UUGA 3OONA 4N41A 1IQ0A 3CZMA 2C96A 4H3SA 4Z4IA 2YN0A 2DHEA 2KG7B 2H4WA 1A2QA 1K5DA 1LZKA 1GM7A 2BFFB 2JAOA 4YLEA 4HEA1 1ZD5A 3ZJ5A 4W5RA 1FRQA 2YH2A 3V34A 2F00A 4J2TA 1R37A 4K28A 1Q22A 4GL2A 4GAEA 2W43A 1MQSA 1SIWA 1KPGA 3K70D 2QGZA 2OTLF 3PJFA 4YFVA 4MVJA 5DXAA 3RVNA 3URMA 4JYZA 2OTMA 2QX7A 3H83A 3FA2A 4MVUA 3UAZA 5ISMA 2NU9A 2CGEA 4DNQA 5G0SA 5AG2A 1YQ9A 1B00A 2CMGA 2AKAB 3KB2A 2WKQA 4HDSA 4RVCA 2J09A 2XUZA 3L1KA 1QGAA 3IKTA 4IH1A 1BQ0A 1HEIA 2Q73A 1YQEA 3BWCA 1IWPB 2GNOA 2ZS8A 5IC6A 1NXVA 1T5HX 4MPTA 3RH0A 4XZ3A 4ARVA 3IGFA 1BZKA 2IBZH 1EGMB 3TFQA 5CVTA 2ST1A 3A3PA 1RMYA 1I7DA 1N9GA 1OAKA 2Y76A 3EMKA 4LCEA 4OXIA 2Y66A 3ZKWB 4BKQA 1EUYA 4GWGA 3NV9A 4M38A 2XYGA 3G0BA 4UUQA 3BBPA 1X42A 3KQKA 4XARA 5AIAA 2EC5A 4D4KA 4R2XA 3RPEA 3VM6A 3JQAB 4OLBA 1K9VF 3R5HA 3PHCA 4JY7A 1GTZA 4JAVC 5HFNA 4ZU3A 2HF8A 3ZHZA 1L4NA 3K72B 4BGEA 2FZVA 5KTSA 1W36D 1UFIA 1DQRA 5HFAA 1XNJA 3FKQA 1KOFA 1N9ZA 5HJ7A 2L26A 3H9CA 1TLTA 1ZIXA 3G5AA 1QIGA 2PMFA 1SHJA 2QTZA 4RS3A 5TS3A 3RV4A 3SXPA 1VE3A 2RI1A 3VDQA 2CVOA 4RH0A 2YJ4A 3HWX1 1RKXA 2HJVA 3L7KA 4BWFB 3ZE6A 4OYHA 4JKYA 4RVHA 5J2UF 4J7JA 3M83A 1ZL8B 1P1CA 1QHHA 3UMVA 4L8VA 4AB1A 2FQWA 1MOQA 1Y8RA 2AH5A 2WWHA 3B60A 3OBIA 4Z5XA 2EZOA 1Y3DE 4G01B 1Y80A 3TW6A 2ZRHA 2C4WA 3PFKA 4PQRA 3NBYC 3T4DA 4JP8A 4MKGA 3EQZA 3L8FA 3W6NA 3DDNA 1NJSA 2EIHA 3KJIA 3UATA 4KQXA 4DXDA 1T6XA 2OT3B 4JBLA 5K6TA 4RTSA 1B23P 3AVTA 2EKZA 4UBMA 1F60A 4K9PA 4L4SA 4YN3A 2HBYA 1XOUA 3UAOA 5FUQA 1ZMBA 2ZRGA 4CQJA 4R6ZA 4JNKA 4RCZA 1WU7A 2LCIA 1B8PA 1KYOF 1T3LA 4C4OA 4R50A 5CA1B 4K3UA 2XNDG 3QEOA 2C1ZA 2RKBA 3QFRA 3FDXA 3TRIA 5ILOA 3GROA 3HJNA 1BE3H 1FF9A 5ALDA 3QSGA 5HPYB 3VYRB 1N8SA 3FNHA 3LCJA 4I2VA 1XAJA 4N1AA 4WFJA 3NALA 5T67A 1QSGA 4BGVA 1QCEA 2IODA 4OSPA 1LI7A 4EKNB 2CLCX 4H3VA 1IEWA 2NUBA 1XLVA 5TQ2A 3FRJA 5ED0A 1QU7A 1BJKA 1U3WA 1VHDA 3WRYC 1XZBA 5C4IA 5AW6A 4X88A 4CDGA 4FYPA 3TI7A 4U3FH 3X1ZA 1EWVA 2D7JA 5KHHA 1IE3A 3LWOC 2P5YA 3H1BA 3LVFO 3PXXA 1NOIA 4XWTA 2O1SA 5TY0A 1NYLA 1ZOPA 3H86A 4FYYA 2F8SA 1GN8A 2IWHA 2QNIA 2KX7A 3FKJA 3SPXA 4Y0NA 3UKMA 4U2KA 4IUCS 2DYSB 4X1KB 1J8DA 1W8IA 2VP3A 3ZCVA 4YP1A 5CYGA 4X1IA 2GPNA 4NE9A 1E6MA 4V02A 1JBQA 3LUPA 4AL4A 1HX7A 3PE6A 2B99A 5GADl 1U7UA 5M2QA 3R0IA 3I6ZA 1FSPA 2F1IA 1UQRA 4G23A 3BM5A 1XG5A 1WMBA 4HMPA 4DG5A 4Q6GA 2Q6IA 3EY4A 1SVIA 2CV0A 2DKNA 3NTXA 3KQTA 4ZHYB 2TMGA 2MWMA 5J4LA 4IPTA 5FLXM 4C4SA 1Z7WA 1Z29A 1DTOA 2YJGA 3PIIA 5ELMA 2FMXA 1XEAA 4PSUA 5ALPA 5FJJA 4YMVA 1S77D 5EHXA 5KYKA 3VBBA 3WQRA 3A27A 3GFVA 1BGWA 2I78A 4P92A 3VVLA 1U9JA 3Q11A 1Z56C 2WU8A 4BQRA 5I01A 2JIDA 1SVOA 2A0WA 3JQ7B 1GIAA 4JFAA 2D1SA 1I3OA 3RG8A 5AVVA 2P9JA 3AHEA 1DUVG 1RYDA 3H3FA 1NRIA 1T13A 3LXUX 2HFJA 4PXSA 4EATA 3ASZA 2XXAA 4C5BA 4DQ0A 2ID7A 2HSEA 2XCSB 4L57A 5EKXA 4E31A 2XZTA 3VR3D 1CUHA 3GG9A 3CUEF 2O23A 3NP7A 4MV7A 1QP7A 4K9RA 2D3WA 4NRDA 3H2KA 1GTSA 2XQVA 4LNHA 4K6HA 1LPBB 1S1CA 3QKRA 3DWGA 4Q4JB 4RKFA 4ZOAA 3RIHA 2VNIA 3OZCA 4S1TA 1LR1A 1ODJA 3PR3A 3KOXA 3HYNA 1QIJA 1IM2A 2ID4A 3G7SA 4I4NA 1JIJA 1PLKA 2XYQA 3PA6A 1W5TA 3UKDA 1HZZC 3NWEA 4GQAA 5EWRA 1ISPA 1DIRA 1II8A 3L01A 4PPFA 5FOUA 4AU1A 3KVOA 2QT0A 3MAGA 2FN8A 1PN3A 1MVNA 4WCFA 4WOBA 5BXYA 1GU1A 3ZOKA 1B8NA 2BE7A 4DG9A 1KKMA 4LRTB 3N8IA 3GRPA 4PZ0A 3OBYA 4X8MA 4LA4A 1EJ0A 2WMOB 1GO2A 2DYYA 2RKWA 1M54A 1OXXK 3BMCB 5DNWA 3OPYA 5LOVB 4DQUA 8GPBA 5AVOA 4KR3A 1TU3A 4HDRB 2CWDA 1FTWA 3EWIA 3HCDA 4DLYA 1CJBA 1MENA 1QOPB 2C7PA 2ZI6A 1OXSC 2MSDB 4WERA 2JIQA 3BCRA 2BFOA 3PNKA 2AHZA 1T6NA 1ZHFA 1A3CA 1P61B 5L3VA 2QJ1A 2VXYA 4AZ0B 2C5GA 3WIVA 2IOYA 3RVRA 2P35A 3GRRA 5EP4A 4IVRA 3P2KA 1J5PA 2EV9A 3LGAA 2QWXA 5CURA 3DKPA 4AMGA 1EUCB 3VNUA 4W9NA 2YZNA 5BW4A 1R5JA 5EPOA 3V48A 4A8HA 3WGKA 5KB3A 4D5EA 3FBWA 1EXDA 2WLJA 3AK4A 1I36A 3HM2A 4R54A 1QVZA 3OJCA 3R5TA 3FI0A 3OEHD 1KERA 1SULA 4ZOCA 3FD5A 3VDNB 3AIOA 4CTKA 5KSZA 4EHHA 2B4AA 4MRNA 3K57A 1DBVO 1OREA 1R4ZA 1HW7A 1UM9B 2OXCA 3AESA 2INGX 3SR0A 3C5CA 3ZH2A 1BDBA 3P2OA 4BX3A 1XOIA 2H1RA 4QGFA 4YREA 3BMOB 3TXQA 4FZ1A 1Q0HA 2VQ6A 3IE0A 1XO1A 3QX9A 1YE8A 4R4JA 2HKOA 3A4IA 5A7HA 3Q8LA 2P3LA 1E1YA 1USKA 2DHQA 3DYBA 3CHYA 2WG1A 5ALYA 1H8HA 2ECPA 3FMFA 4RCYA 4ZKDA 4OYLA 4JASA 4L2IB 2FEKA 4OP3A 3UA3A 1YJ8A 3IMPA 3GN1A 1OW3B 5EK0A 2X3YA 2ZIUB 3DXRB 1SQBH 1UJ5A 2X9LA 4RDHA 2C7QA 1ZOOA 3M6WA 4HFRA 5AW3A 5F9HA 1APBA 5K7SA 1KH3A 2IJGX 1ZK2A 3FFMA 1ZS9A 5DCWA 3OUTA 1K88A 2YXBA 4HAZA 2C5FA 3HB9A 3BE6A 1YIJF 3JQDA 1GPJA 3CEPB 3CWZA 4O4JA 3D6JA 1EZ4A 1P8AA 2AI3A 4JWTA 3QVKA 1IDOA 3DE4X 3LAWA 3Q98A 3OKCA 1XV5A 5DW0A 4NDNE 5KNBD 2ID8A 3K94A 4G25A 4MT8A 4RKRA 4C20A 3OZRA 4KDRA 4UBLA 3OF2A 2K87A 4U7JA 3C24A 2AFIE 3LK6A 3QSYA 4E5YA 3EVKA 1JQLB 5LBTA 3WLEA 2JGDA 1ECCA 2QT9A 3T35A 4DR4O 2DULA 3V46A 3CGWA 1Z6GA 2BZGA 2DUMA 2QKYA 2ADQB 3WB2A 3B53X 3D0KA 4OIMA 4UUPA 1E9BA 3B2NA 5G53C 4UZEA 1FKAO 1IL0A 4L9SA 5GTIZ 3H1AA 1NJGA 3JATA 1CBUA 3MJCA 3R1IA 4LMPA 2P06A 3OLVA 2YHBA 2AZ4A 3TIFA 1A71A 3P4YA 3SJCA 3MVEA 3V2UA 2KI5A 1RP1A 3QENA 3NLLA 4DO2A 2D00A 1M0WA 3PGVA 1DPFA 4G27B 1W73A 4B1FA 3KD3A 2QXYA 3IULA 4OKSA 4UM5A 4XRRA 1Y3AA 5EJMA 4B6PA 5EY5B 1L5FA 1EHCA 2ZUUA 1U0RA 4HNGA 4JR2A 1PNQA 4WGFA 1Y3IA 3NBXX 4BECA 4RO0A 4O3MA 1FBTA 1T5EA 4O4IB 1VQMV 1ECBA 1OGYA 3NYQA 3RUCA 4C2AA 3ABTA 2I55A 1QLWA 2IYEA 1KORA 3SC4A 3T7SA 4ARIA 4IDAA 5DN9A 5K3CA 5GMOA 4ZYLA 3R6GA 2R1TB 4WLEA 2HDWA 3QU4A 2V74B 2HV8A 2JATA 3CMEV 2HR3A 2XKAA 2Y68A 1CQIA 2V7QD 2DETA 2BTQB 1XL4A 1JBEA 2PIDA 3WDLA 3ZTTA 5BWLA 3AGQA 2YS6A 1M33A 4JI4B 4X62O 1U1GA 4O59O 2DE0X 2PJDA 3R4CA 1MRNA 1XZQA 2FF5A 3S55A 2H92A 2UUPA 2WWVD 4IGIA 1GD1O 4B40A 1PT6A 1QO9A 4MVJP 3VIUA 1GFWA 2BBOA 2H4XA 3AR5A 3D7KA 5JXHA 2DB3A 3KFXA 4PD4F 4OXXA 1RACA 4FFDA 2WE7A 1E3DA 4Q4CA 1TK9A 2ERYA 3GI1A 2ECOA 3WFIA 1Y76B 3GDOA 3HDYA 1CLUA 3SDZA 4KI0A 3U3OA 4E14A 3BAAA 2QA5A 4K9LA 4D9EA 2Z6AA 4G67A 2RIPA 1NHGA 2X7XA 3O95A 4PNZA 1WUHS 2RJOA 4W5WA 4Y18A 5EQJB 4ROSA 4YRPA 1ZU5A 3RK4A 1XQXA 4DA7A 3WOHA 2YXHA 2O2GA 2YZ7A 3ZWCA 1NBHA 5KJCA 4WXRA 4IF4A 2OQRA 4BNHA 2MJLA 4FM2A 1QYDA 2VRWA 1B8UA 1L5HB 3QOFA 1CQWA 221PA 3P27A 3DMGA 3OBWA 3KDAA 3AEYA 4YP6A 1KU9A 1Q7BA 1RPNA 5MN4A 2H63A 3VUEA 1V9LA 3GCDA 2D2EA 4O1HA 1J0BA 1PR5A 5KHOC 1N7JA 1RBYA 3SJAC 3RVYA 2V45A 3FKSD 1SVMA 5GW7A 1GGKA 2J9GA 4F93B 5G0TA 1ISFA 1QOZA 3CUSA 1R9NA 1Z7GA 1Z62A 4K8RB 2AR0A 3TGUH 1Q1EA 1J39A 1C9DB 5CR9A 1N5RA 3G80A 3UG6A 2GCGA 3CCBA 5AJYA 2WZCA 4MLPA 2XWPA 3A2NA 3M5PA 3S1LA 3S29A 3U0BA 2WZBA 4D9GA 1R9GA 5CB4B 3GA0A 2HLDG 4D8XA 4PDLA 5ITWA 5IT9N 2UYKA 1C29B 4O02B 5FO1A 1PJQA 1QGOA 2EQBA 2QR3A 3EVZA 3WIDA 4GH5A 4GMGA 1ZMTA 2EOAA 4Q0MA 4NTYA 4ND6A 3MPOA 4V0NA 5E7JA 4RUFA 5EBMC 4B3TO 5AJXA 5GJVC 2O4UX 3D3JA 5D6NA 5BV1A 1OV4A 3I64A 2JZOA 3OMLA 4RJKA 1XRSB 4FGSA 3TLZA 1WPQA 3B8NA 3ZK7A 3C3CA 4KUGA 2BFMA 4MS4B 1PTJC 5SYMA 1OVGA 3MRTA 3ZWDA 4TWIA 4ZJYA 1I4OA 1IOZA 3I6MA 5A02A 4REQB 4LVOA 5LDGA 5EWMB 2PV7A 3VC7A 3BGSA 1UBMS 4TTQA 5J2TF 2E5WA 4GM4A 4A0SA 4GYCB 3GVPA 4G2TA 4DMCA 4IFBA 1EUQA 1WZEA 3CIFA 3K8ZA 1YITV 2NTEA 4P2BA 4QEKA 3LX6A 5AKZA 2DJVA 2GDZA 5CYOA 3RFXA 3UO2A 1CE8B 2RE8A 3AYXB 4DJTA 2WSBA 3TETA 1AA6A 4PNHA 2EW1A 2GUGA 1STOA 1KZYC 1U31A 1LK7A 3HNRA 3DONA 1DX4A 3KPVA 1UFOA 2HOQA 4J90A 3SYRA 4DBLE 4PA3A 3QO5A 2OGSA 3HI6A 3QVWA 3LRPA 3FX2A 1AXEA 1ZZGA 1P33A 1X7OA 4QGGA 5IARA 2FWJA 5FUVA 5T5QA 1KOLA 4MA5A 5H4GA 3L1VA 1IAVA 2F8MA 2JI7A 3MZ0A 1CY4A 1XBLA 3NWPA 4MYRA 1IPEA 1ADBA 3DTNA 3DR5A 5A06A 2D3OW 4B4DA 1XX6A 3L6EA 3ZU3A 5DEIA 4C4WC 3IPCA 2GX6A 2XTJA 3QM1A 4JEIA 4Y1RB 1GR0A 1RQ7A 1GRCA 3G6WA 4OMCA 1RRCA 1M1YE 2HHJA 3GFOA 4FT4A 3TL6A 2DHRA 1BU5A 2HIAA 3S0HA 5G2OA 1VSVA 3V1MA 4ZXFA 4UNNA 4MHTA 3LDAA 1EB9A 5FFNA 1F9EA 2CF5A 4YA6A 5DM0A 1ZR4A 1IBMB 2PU7A 4GXQA 2Z3WA 2WALA 4ONEA 4QOHA 4UTOA 3LDGA 2D5CA 2GRUA 4OHFA 1ISRA 4F4LA 1RQXA 1Z6YA 1KF0A 2X1VA 4TXMA 4QYSA 5CLFA 3GBVA 2P5UA 5E3JA 4MIEA 1TUEB 1WTAA 3TBKA 2LV8A 3U37A 4DPLA 3FD9A 3AETB 3CF6R 1W4ZA 3ESJA 5KYXA 1OFGA 3C97A 3KLMX 2W2PA 3UM9A 4JDPA 1PKEA 4MVYA 4X3LA 2QMOA 4II7A 2B1GA 2UZIR 4HTFA 1ZM7A 4PR3A 2WJIA 4F0JA 4G9EA 2DM6A 5LOVA 2NXEA 4B5CA 1PV1A 4GRDA 3RK1A 1X7XA 4C0LA 1U3FA 4E4RA 2WLMA 4G4ZA 2JJYA 2WLIB 1WDWB 3KCQA 4JMPA 4QO7A 4AJEA 4YRRA 1YA4A 2QEXF 1E7QA 1I4EB 4RSRA 2W0XA 2VA9A 3BULA 2WPDA 4HSGA 2EBWA 2XMRA 2DLDA 1S7CA 4O8CA 3NRCA 4KJXA 1R6XA 3MILA 4IXWA 4UVGA 1YFLA 2OKGA 5IEBA 3AY6A 3BMXA 2P4VA 4PN3A 1VTKA 1I5XA 1J7JA 4Q03A 3UAGA 3G2OA 1JLKA 3IBGA 2G09A 1V9PA 4MIKA 3RVSA 4HVTA 2OFOA 3LUBA 3BZWA 4AJ4A 4C4XA 4RIGA 4ECEA 3P2EA 2J0SA 3IYLW 3IJRA 3FUWA 1AP6A 1R1BA 3E3AA 3LCVB 1ZGAA 4U0KA 5FULA 4F8EA 3IVRA 3BERA 1AI6A 2BCJQ 3DZJA 4GMFA 5FJIA 3HVKA 5A9RA 3GWKC 3SYNA 1ROPA 2UXXA 1T15A 3CKYA 2QAIA 3QLJA 2A9FA 2IVZA 3E0QA 2DUNA 4XQEA 4D4MA 2IJHA 4Y98A 4E03A 2WSSG 1K5HA 3ICCA 1Z7BA 1SRYA 2JA1A 4AT1A 2X8AA 5CB6A 2P2LA 3BXXA 2C03A 1GH6A 3HVUA 4OHCA 5LSAA 5IK2D 1RWMA 3CCJF 2EIKC 3QNUA 5D3MA 2BFEB 3NR7A 2NMVA 4R7TA 3WG9A 1UAGA 1X7WA 1HE4A 2G1UA 3DVRX 4DIDA 4EUFA 4OGFA 3CKLA 1NZ6A 2GLZA 3C9SA 1J7KA 3M3PA 3UQ8A 4R68A 1KBZA 3RAPR 4FXOA 3W9YA 4JLDA 5KO2A 1ECGA 2Z5FA 4QWMA 4YT4A 5BVGA 1E9AA 2O50A 1CJUC 1SPXA 5H16A 3GFFA 3G4SF 3C2QA 2LDXA 3FVVA 2F1OA 3ABZA 5D86A 3CNBA 1DHRA 1YWGO 3N3BC 4YB8A 1ZO8A 1N8RH 2FPXA 4MW7A 3UJ6A 3U4AA 2ZANA 1S3SA 1W42A 1YCHA 2Q3DA 4Q3DA 4GX5A 1YRWA 3ECAA 5A0FA 1OIVA 1Z0JA 1P9NA 2PEYA 5EIAA 3TB6A 3LWVC 1GUYA 1MXFA 1O94D 3BKWA 4P5EA 1NKVA 4LWSA 1V5GA 2O2SA 3PFGA 2YXPX 2B37A 4LWQA 5B4VA 4MKZA 3SJBA 4HAUA 4JB8A 3DXZA 5DMHA 1XDWA 3GYQA 4EW1A 1VC2A 2Q0AA 1IC6A 1VLJA 3EC1A 1XF1A 4GKAA 3TOCA 4HAYA 3DVAB 3K0KA 2J33A 3OIGA 5IYZF 1MGPA 2WV7A 2Z8ZA 1I6MA 1FNCA 2OCPA 1Z2OX 5AOVA 3TM5A 5CG1A 3PC4A 3L1IA 4BFWA 1AKYA 1NXQA 2OQVA 1PQYA 3PWZA 2MINB 4YR7A 4UTRA 4MJ3A 5EPUA 3DO6A 3Q7QA 3KOUA 2FPUA 1DBPA 1IHDA 2B5WA 1DBFA 3AQIA 2JLWA 1NQVA 2A84A 2CVFA 4OA8A 2FSUA 1G4UR 2COKA 2C5EA 3AP1A 3DH0A 1US8A 1OBOA 2WHQA 4HUQB 4IHJA 4F72A 3CF4G 4FTWA 3F1LA 4WCVA 5ALTA 2PLRA 2V1DA 2JGFA 3K96A 3S3TA 1HR0O 4ZQFA 4EG1A 1PZFA 4LWOA 1J8MF 3AL3A 5C8YF 2AVNA 4HN2A 1XZCA 2YIMA 3H9BA 1HDXA 1TA8A 2GMWA 4BE7B 5E38A 5EAZA 2O4CA 2ATVA 2YDEA 1V2GA 3CF0A 4MUAA 3TZKA 1QVAA 2EARA 2F9FA 3HM9A 1YDFA 4RVUA 1RPZA 2PXCA 5LLSA 2QD1A 4H1HA 4BY9D 3L4BC 2AW9A 4LVUA 4Q3KA 1NU6A 3ZWAA 2Q7HA 1OR8A 4U2EA 1GKKA 3N1UA 3KZXA 4LCBA 3WR5A 2DSTA 3QUTA 4BE9A 4CUZA 3UZUA 5CTJA 2GAFA 1QCCA 3OAAA 3QXCA 4R1MA 3UMJA 3IKFA 3WYAA 3U0OA 1I7PA 2XA9A 4NV1A 4TL7A 1GNRA 1YA8A 1DG1G 2JJQA 4S24A 1TJPB 5KBYA 1ZFNA 1AH2A 3ERNA 3GRYA 2ZCJA 2R44A 1A2OA 5TE9A 1RRMA 4ESHA 3VQWA 2BM0A 5LGTA 1OIXA 4FR0A 5HIAA 4PY2A 4MRPA 5FUMA 2ZTVA 4FFMA 1XZJA 2RI0A 3LOQA 4N7MA 4B0PA 1QKIA 3IQGX 5K20A 2BFBB 5KYWB 4Z3OA 3IDQA 2QE7D 1L5NA 2CHTA 5TX7A 3FYUB 1FFDA 5B36A 4I7EA 1DBQA 1VHJA