5BMVB

Crystal structure of tubulin-stathmin-ttl-vinblastine complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
427
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
molecule tags Structural protein
source organism Rattus norvegicus
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules.
pubmed doi rcsb
total genus 171
structure length 427
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5bmvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5bmvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5bmvB01
5MN6A 2Q1YA 4LNUB 3VO9A 3VO8A 5M7EA 5IYZA 4TUYB 5GONB 1SA0A 1SA0B 3JAWB 4I4TA 4ZHQA 4YJ2B 5JCOA 3WGJA 4YJ2A 5LXTA 4F6RB 1W59A 5EIBD 3RYHA 4HNAB 4FFBB 3JARA 4X1IB 1FFXB 1TUBB 3JASA 4I55A 2BTQA 1Z5VA 4IIJB 1OFUA 5MN5A 3RYCA 4EI9A 2XKAA 4U3JA 2RHHA 5ITZA 1JFFA 5EYPB 1RQ7A 4X1YB 3ZBPA 5LP6C 4X20B 3HKBB 4EB6B 5CB4A 1FFXA 1W5FA 4IHJA 2BTQB 4IIJA 3ZIDA 3E22A 4EI8A 2RHOA 3HKCA 3HKCB 3JASB 4TUYA 4I4TB 1W5AA 4ZOLA 3HKDB 5CA1A 4FFBA 4EB6A 3RYHB 4U39A 1Z5WA 5EIBC 2BTOA 3VPAA 4XCQA 3RYIA 4TV9B 5C8YA 3JALB 3N2GB 3N2KB 4LNUA 5JQGA 4YJ3B 5IJ9A 5KX5B 3C8LA 5GONA 2XKBA 5KMGA 5IYZB 2RHLA 3RYFB 5LYJA 5IJ0B 1TVKA 3VOAA 5FNVB 1RQ2A 5JH7A 5FNVA 3JARB 4X1IA 3WGKA 4HNAA 5JCOC 5EZYB 4O4JA 5CA0A 5BMVB 4O4JB 5BMVA 5CA0B 4DRXA 4O2AA 1W581 4O4HB 4O4HA 1W5BA 3RYCB 5JQGB 2R6R1 4U3JB 2Q1XA 4E6EA 4O4IB 3WGLA 5KMGB 5J2UB 4WBNA 3RB8A 4ZOLB 5JVDB 5LA6A 5LOVA 5IJ0A 4F6RA 4X20A 3ZBQA 5CA1B 4ZI7B 4IHJB 3JALA 3HKEA 4X1KA 1RLUA 3JAKA 2VAMA 3WGMA 4I50A 4I50B 4O2BB 3VOBA 5J2UA 1JFFB 5EYPA 1TVKB 4O4LA 3HKBA 5LXTB 2VAPA 4DXDA 5J2TB 3M89A 4TV9A 4O2AB 2GVIA 1FSZA 3N2KA 2RHJA 3R4VA 3N2GA 3JAKB 3HKEB 3JATB 4X1KB 4O4IA 4YJ3A 4O2BA 5IJ9B 5ITZB 5KX5A 4B46A 5LA6B 3RYFA 3CB2A 4WBNB 5JVDA 3JAWA 3HKDA 4ZHQB 3UT5B 5LOVB 2R751 3UT5A 4B45A 4ZI7A 5MN4A 5J2TA 1TUBA 4KWEA 3RYIB 2VAWA 4DRXB 4M8IA 1W5EA 3V3TA 3E22B 2VXYA 3M8KA 3JATA 4TV8B 5LYJB 4TV8A 3WGNA 4O4LB 4X1YA 5JH7B 5CB4B 5LP6A 5EZYA 5LP6B 4I55B 5C8YB 4EI7A
chains in the Genus database with same CATH superfamily
2SKCA 3N2EA 2FRXA 5KA6A 1GNTA 3EDRA 3LXXA 1S8NA 2C57A 3VO8A 1WVMA 2PANA 3L40A 4M1ZA 3OT4A 4YJFA 1XLTC 4QE7A 4JT8A 4JP8A 4ID3A 4MYSA 4BLVA 4RV9A 2FGKA 3BILA 4DQXA 2OCAA 1JDBB 1M6VA 2Q7XA 2ZBFA 3O8DA 4PC6A 4PQFA 5EAIA 3ILYA 3TL6A 2Z2XA 2F3UA 4W5OA 5ALKA 5JC1A 4BN5A 1D4OA 3T3IA 4B3XA 3N8DA 4CMKA 5L7TA 1I0LA 3KQYA 1NTMH 3C74A 4RL6A 3TVTA 3UUWA 2AW3A 3C5VA 3QTLA 4ZC8A 4Z6KA 3OFND 2WJIA 4BQEA 3GARA 3COZA 3L8DA 4Q01A 2QUZA 1ZU4A 4OUKX 5EIXA 4QAQA 1EE1A 4YI5A 2P67A 3P0IA 3MRXA 3VH3A 2YN2A 3P7MA 4E31A 2OM2A 4D4JA 3LCJA 3NEYA 4AZ3B 4FWBA 1PEKE 4FFOA 3RSQA 5DEIA 1CX9B 4NMMA 4HFJA 1RPNA 3MJCA 4G9EA 5FTMA 3WBBA 1UFOA 2QTWB 4G81A 3OBIA 1KUQA 2X19A 2RJOA 1YL6A 4I6EA 4RVNA 1GVNB 3OTWA 2V7EA 4QOJA 2JIDA 2WJAA 3P9ZA 5H9VA 4C7MA 2P5OA 3NKVA 2XUOA 4FJCC 4FSXA 1XEFA 3F46A 3TZQA 1WV1A 5I9SA 2JEOA 3IAS1 3V4DA 1RPRA 3K73O 4IXTA 4MQ4A 5J4VA 5L40A 3ER9A 2D7DA 1M2VB 2RHDA 2Q2NA 4QGSA 4FOSA 1E9VA 3DEZA 4JA2A 2NXEA 2ZR9A 5A04A 1W5SA 2V9YA 2ZBQA 4PPNA 1E2NA 4K6KA 3SY8A 1JB9A 2PSHA 4QYWA 5HNKA 1OWNA 2OV3A 1YCDA 3R2JA 3WGLA 4O02B 5B55A 1IUKA 3H11B 1G9SA 1I2ZA 1PGOA 1N6IA 3RK1A 3N2NA 3HWX1 3PGVA 1X19A 4MUNA 2DWPA 1VMAA 2H1FA 4C7OA 1VG1A 4CM4B 3JY6A 1LLDA 2MHCA 5LHIA 2JD2A 4RIHA 4PQEA 4EHLA 3JVDA 4P93A 5THXA 1W0JG 1TA9A 2N0SA 1T5IA 3PUYA 2PPVA 3BDAA 1ZAYA 1BL8A 2OHGA 3KKLA 3KOYA 4M0UA 2JK0A 4JUDX 1OLUB 3Q5DA 1IZ3A 3FB6C 1UJ5A 5IVPA 1TW2A 1W25A 3IKEA 2ZI9A 3GYGA 2IH1C 3V1KA 3THWB 1VQPF 1Z37A 3PXDA 1E2DA 3QPUA 2RGXA 5J2TB 4GF5A 5FAXA 1EM8B 3WFIA 2YFQA 1ADBA 5IH7A 1B8UA 3FGNA 4BNMA 3J7AC 4F60A 2B9ZA 4PLHA 2J4FA 3IULA 3OFVA 2Z1UA 3QU2A 2PUJA 2PH3A 4O4IA 5KX5A 1P1CA 2YMPA 2C9OA 5ESWA 1SQ6A 2G1PA 3IRUA 4LRTB 4QOSA 4QWWA 3ROFA 3ZC3A 1XA0A 5G53C 4EJ0A 4XLLA 2Q99A 3TYXA 4F92B 5MN4A 4PLFA 4X97A 2OYRA 4PC7A 2JJ1D 2FYTA 2YYYA 1DJQA 3KVOA 2OVFA 3RYIB 3K6JA 1HYGA 3ZXIA 2QN9A 1VJRA 2CVOA 2AWOA 3K5IA 5IASA 4Z9FA 3HWRA 1Q8IA 2ZJYA 2CLDX 1UM9A 1N6HA 3W90A 2I2XB 3U7GA 2JIOA 3EGIA 4BT6A 4CL2A 4XIGS 2Q6VA 3GLTA 3PUVA 2VWHA 4FNMA 1E98A 2H07A 1IM8A 1A32A 1B74A 2KJQA 2WFMA 3AP1A 1MB9A 3C3CA 3EG5A 1J25A 1OI7A 2LRHA 4MJLA 4WERA 4MVJF 2JVDA 4DQVA 2HK9A 3ZCUA 4ZPXA 1Z7GA 1LW7A 2VHQA 2Q5OA 3AFOA 1IJKA 2Q27A 2DF8A 2Y6UA 4JA0A 1NTKH 1VQ8V 1K4CC 1BE1A 2HUPA 3SHQA 2RDCA 1X70A 3M33A 3RS9A 1GILA 2OE2A 5BT8A 3RGGA 2WJ3A 3LLCA 2Q1TA 4R2KA 4G1BA 5DM2A 3MGCA 4PF1A 3F7YC 1BEZA 1C30B 1SMKA 4TQFA 1YIAA 3MT9A 3OX4A 2AWNA 3O4IA 4DV7O 2QZJA 3E86A 2IPAB 4HYEA 4RDCA 3LNTA 3UW1A 2JZNA 2QB5A 5TT1A 1J99A 5HKAA 1PPJH 3FTEA 4D98A 1B42A 4CJXA 3LZCA 1JVBA 2W8BA 3JQ7B 4CLOB 5IKMA 2P3QA 3NX4A 1P33A 3KKZA 5BUQA 5JNWA 2DOSA 3F0DA 3ND8A 1FFHA 3M6WA 1DEAA 1SELA 3ZDAA 2JIRA 1W5FA 3AESB 1U2DA 2V6IA 3U80A 1H8ED 3AI1A 1M6EX 2C83A 2TRSB 3O38A 4WZ6A 4WN9B 4FW9A 2DB3A 2R1TB 2UAGA 2SICE 2P2NA 4KI0A 1AVMA 5FTJA 3PJSK 1S9DA 1SXJD 3Q3GE 1DAPA 3HWSA 2B1QA 3RVOA 1J2JA 2ZSEA 4ZEMA 1BCSA 2PGIA 4M3NA 4LC1A 2DPHA 2WU8A 3CW2A 1B73A 1WXFA 4K0RA 2DH6A 3W5JA 3USZA 1OT5A 4BVQA 2HP8A 4YUAA 3KR9A 1DO2A 4C30A 5AW2A 1GSAA 1YMVA 4RPJA 2Q5IA 3G5UA 5GPBA 1NG9A 4KC0A 1BQ4A 3AMVA 3KLOA 1XF9A 3P2MA 4JD5A 1R4AA 4MRAA 5FUWA 3V4LA 4BEVA 4G0MA 1HE3A 2OWDA 3NTVA 4UCSA 4D7SA 1A04A 1QO0D 1ZH8A 1MQSA 3BHIA 3NETA 4NCJA 4DL9A 5IAOA 3D6FA 1L1QA 1SULA 1AUPA 2E4YA 2ZINA 4FR2A 3O82A 2OO5C 2NZWA 3V4VB 4CRWB 4H1WA 2W2KB 4L85A 3NBUA 1YB5A 1N32O 3CCVV 2C54A 2O5RA 4IGKA 4B3JA 2IUUA 3D3NA 5DIZA 1SKMA 1QORA 3KTFA 2DFDA 2J8ZA 4OPMA 3LUPA 4UVAA 1YJQA 3OZEA 3QPAA 4JU8A 3K9SA 1BXGA 4PW0A 1E5TA 1J5PA 1E2GA 4BNTA 1HEIA 5KTMA 3LY8A 4DV1O 2IA5A 3F98A 2RGGA 2XI4A 2KI5A 2C9YA 3AKYA 4BASA 3JCZA 3MCAB 5ADVA 1AN9A 4UVEA 3TOSA 1OF1A 3HRHA 1E1YA 2ZTLA 3BZBA 1ORQC 4UJ3A 3U3ZA 1EK2A 4QUJA 1UFYA 4XJVA 3IMPA 2IHBA 3HA3A 4ALLA 1RZ3A 3THWA 4DKJA 1ANKA 1FKAO 1R0LA 4BO2A 5IC6A 1L5NA 3N74A 3GB9A 2CNDA 1RJDA 1JG4A 3K6KA 3F6MA 4K9NA 3ERNA 1YASA 3RBAA 3Q41A 2RB9A 2QR5A 3HDYA 3G9UA 3SR3A 3WO1A 3JU3A 3OIDA 4N21A 1Y66A 2NUTA 4D0LB 3QTYA 2JIZA 3T1YO 2WMOB 3PDWA 3Q72A 3HKEB 4X1KB 1VQLF 5JCJD 2P2SA 3U37A 4A5UB 3IOYA 3ZY4A 5KSYA 5IT9A 2BKEA 3JD2A 3C3YA 2PD4A 3LBNA 3BC1A 1SIUA 2GPYA 4P08A 5JSQA 3DAOA 1XAIA 2GFQA 3PXEA 1CR2A 3DMRA 2O23A 4NJEA 1T3ZA 3W7XA 2CHFA 4KH0A 4R98A 3L71H 1II9A 1LZKA 4GVPA 1U3PA 2CZGA 4QELA 5DYTA 1BDMA 2LKCA 2X7JA 1V6SA 4RIEA 3VMFB 2O8BB 2QWPB 1CNEA 1MV5A 2Y2UA 1RS0A 4WEOA 3SLGA 3AL2A 3TRDA 1GM5A 1GSHA 2ZUVA 1Z25A 2UYGA 5AHRA 3WG7B 3TK1A 1C0PA 4OQEA 4AJIA 3WLSA 1T5EA 6NULA 5HP4A 4JC4A 2C1ZA 1Z0JA 2WLLB 2OO5A 3ENQA 5AVTA 4ASUA 5KYNA 4BMNA 1EU1A 3HA5A 2R00C 5AJWA 2Y71A 3R75A 3U5TA 2VPYA 5DYNA 4PZZA 4C3VA 4WFHA 4B73A 4YV0A 3SC3A 2DR0A 4PYJA 1L4LA 4WADA 2GPWA 5KOJA 3EDMA 1S5HC 5JWOA 2NPOA 2KPOA 2NYRA 4R2HA 1AS0A 3RAGA 5FUMA 1Q77A 3OKFA 1CT9A 1NSTA 3PFBA 4FFPA 1X74A 3WLNA 3ZWQA 3LQYA 2IYEA 3FAVA 1N2EA 3EVNA 5JHHB 5DNCA 5B5SA 1K9VF 2XCTB 3M49A 5I6DA 5AG2A 3DMNA 4JI3O 4IDOA 2VYQA 5FI5A 4L8VA 2GASA 1C9JA 1MFZA 1M0SA 1XXHA 2I4TA 4K6FA 2VGNA 3FNBA 4YRKA 4Z4FA 5TQVA 1GYQA 5L6LB 3AKZA 4JLUA 2XGJA 1ODKA 3IODA 4WN9A 2FWAA 3VNBA 3TR0A 2AN3A 2HWKA 2GD1O 4A6XA 4QEZA 4RPKA 1DP4A 5HOEA 5HF6A 3WB0A 4JYYA 2DQ4A 2PT6A 4LZJA 1DHRA 2QZ4A 4C0XA 1SXPA 1I7DA 2G0NA 4LWPA 2ZYWX 2VT7A 3G02A 3LP8A 4Z1VA 1MJGM 2JZOA 4HAIA 4W7IA 3OLYA 3V5NA 2X8WA 2AXTZ 1H85A 3S5UA 5AVYA 5KB3A 5L4NA 2DHQA 1J8YF 4X92A 4F3RA 4TS1A 4JI3B 3S2EA 4PEVA 3TI7A 2FEMA 2UVPA 3KZIZ 1HSOA 4Z1MD 5DP1A 2D3WA 4JNCA 3N0WA 5JH7A 1HQKA 2X5JO 1FYXA 3BDIA 1GR1A 5EMLA 4OLBA 2H85A 2ISCA 1VQMV 1LA2A 2F00A 2ORIA 1Z6XA 2R87A 4PLCA 1GL9B 5LL6P 3JTEA 5JROA 3ND5A 5JV5A 1JHMA 2FW6A 3SXJA 3OTOO 3EUFA 2WHPA 3KR2A 5HIIA 1ODSA 5G02A 1OMOA 4JQYA 2XJ4A 3ENVA 2R9IA 1AMUA 5KS2A 1G8JA 1AKNA 1YB7A 5BVGB 2O5EA 3KHTA 2HMSA 3KE1A 4MA4A 4GZRB 1QKKA 3K9BA 3Q2KA 2H31A 3QTBA 4CLRA 4MQFA 2KHZA 1F5NA 4UU7A 2XODA 8OHMA 1OFVA 3SHVA 1E1CB 1DF5A 1FXKA 1TCCA 1FXWA 3IFSA 3SICE 3EARA 1UOPA 3EJWA 1JU9A 3A9SA 3SQLA 2B6HA 3STZC 1NJ5A 3QA9A 2HJVA 4HSEA 3R7WB 4M4SA 1HDEA 4YPVA 5JEDA 3HCEA 1X2BA 4N0MA 4OJNA 2CYCA 2IYRA 3BB4A 5JCJA 4FIPC 3QK7A 1M33A 4OYYA 4UVDA 4QTXA 1UDAA 1QRDA 1PR1A 4PDVA 1B6RA 3U11A 1JQ0A 1U5CA 2NO7A 2YC2C 3IAUA 3O93A 4Z2YA 1RBZA 2UZ1A 3DOFA 1BQ3A 4EW3A 4Z1MA 1NN1A 4KRYA 1YBVA 3M84A 2C8JA 4I7EA 4RF4A 1NOKA 4B79A 1SQVH 1BCSB 2QD3A 4IO0A 4P2BA 1WUKS 3H75A 4QDJA 5IN4A 4XCXA 4ZKEA 1K66A 1P2TA 5H6RA 1Z5ZA 2BCEA 1VCIA 4O0LA 2E49A 3VAZA 4KIJA 2QSJA 1Y9AA 3MLBA 3I23A 1Q5OA 3W79A 2A1IA 1D0VA 1Q20A 2JDIA 3PDUA 4BCCA 4X90A 1ZI9A 4EY4A 4DARA 3NWPA 3QKSB 4GBGA 4Y6QA 1K92A 3DQQA 3M82A 5JJ5A 1A8HA 1M4UA 3IEPA 3R66A 5KQMA 2HWXA 1R4ZA 3OOYA 2JFBA 1N8KA 1V8DA 3FFWA 2I4LA 1FRNA 2XNHA 1JEJA 1ZCFA 2PRKA 2R5WA 5EJFA 1I4DD 5ESDA 2QTFA 5LB4A 3TSZA 1PNLA 3EXG2 4R3NA 3I9FA 2QRNA 3A2NA 3WYGA 1QGUA 1GNRA 3FCSB 1GMGA 3SC4A 1AZWA 2KB1A 3FCOA 4F9TA 4ZZ1A 2CE4A 1WQ4A 4YP6A 4IHQA 1BX1A 5LBQA 4UREA 3RS8A 2EX4A 3SC2B 1BD3A 2WWYA 1GY8A 2JCYA 1RFLA 1DXQA 2BFCB 3OOJA 4M1WA 4NONA 1WLSA 1AV7A 2PZMA 3ZI7A 2HHJA 1BGWA 3F6RA 4M6WB 1JIXA 4D46A 4JMPA 1Q6IA 3X2EA 4AJOA 1R6KA 1L5SA 3E3AA 1FRZA 1JSCA 3KPJA 1UEJA 3PNOA 3GOQA 5CLQA 1QGAA 5EFZA 5EWLA 3CPSA 1EVQA 4F3CA 1QMPA 3DAFA 3L0OA 2OQIA 2R6CA 1KHTA 4WN3A 4YS6A 5E95A 1VXRA 2GSMB 2BHNA 1FYEA 1E2UA 1YGPA 1IBCA 3MW8A 4IDGA 3N2GB 4TWIA 2FMHA 3DBRB 2QVBA 3WK8A 4DC0A 4YT8A 2WYUA 3EX7C 1QU3A 4L51A 1XZMA 3H6HA 4AILC 3IVRA 1P75A 3Q8KA 2HO5A 2YIBA 4BXOA 4OQLA 3SI7A 1EX6A 2FRDC 1M1ZA 1EN6A 4MKXA 1JZTA 3QWHA 1PL7A 3L0ZA 4NU6A 4O4HA 1KKUA 1YQDA 2BMEA 3RYCB 4XFKA 3KJZA 3Q40A 4S24A 5HPYB 4XI9A 4ZQIA 3TIFA 5I45A 1ENOA 2Q6AA 3CXUA 5FI3A 3D5TA 1OASA 1IDN1 3FVTA 4DDHA 3K2QA 3F5FA 1P5ZB 4AVYA 2X8BA 4JUAA 4GG1A 1WXXA 4X6YA 2BOBC 3EG9A 2DHCA 3IHKA 4HC4A 2G8NA 4AY5A 4CUJA 1R3LC 2XTAA 3KG2A 2AZTA 1MVOA 1WPBA 5KHIA 1TTQB 1HT0A 1D1QA 3F5TA 4OU4A 2ZREA 1QIEA 1MB3A 1LWNA 1T0PA 2GFIA 1M56C 4LK3A 5LP1A 2I54A 1WLEA 4LYFA 4NS1A 2PN1A 4E7PA 1XRNA 5KU7A 1XFDA 2Z08A 2EQAA 4OHBA 4QVGA 1EFPB 1RAGA 1M75A 2XMZA 3VKWA 4Y1RA 3VYRB 1O8CA 2BUAA 2NSJA 2AS0A 3Q88A 3Q0IA 2M6LA 4I9WA 4DV6B 1WO8A 2LW7A 4TROA 3REFA 2FDRA 3CR8A 3MWEA 2KMLA 2C0CA 2GNAA 2ICAA 2ZJ7A 1QUFA 4KBGA 1G16A 4X9QA 1H2EA 3E9EA 5I01A 5I5EA 3SOPA 1BU8A 2HU5A 3AF4A 4B6SA 4KWEA 2VPTA 1ARZA 3ZCPA 1BZYA 3DC5A 5JU6A 1WXEA 4MYUA 3G2JA 1HA3A 4ARVA 3R0JA 1G2IA 1F12A 3ELWA 1KDYA 3GDWA 1UC8A 4YWJA 1JHPA 4OYLA 5FP0A 5C1PA 1VP9A 4I4IA 1XSEA 3R0XA 3A9RA 3MSCA 1IWPB 2CWDA 4TWJA 3S27A 4FUQA 3AG4C 1NP7A 2IU4A 1KC3A 1IDSA 1CETA 1DJLA 2AFIA 3JZFA 4LRXA 4URFA 2J67A 4JTDB 3HB0A 1BN7A 4WSOA 5A9RA 1MX1A 1Q22A 4KWCA 2WBLC 4WV3A 4U5QA 4DJFC 3AL3A 4KRGA 3DTYA 4FDTA 1E4YA 1GM8A 1RYNA 1N2BA 4L27A 4MV3A 3RREA 1UXJA 4CLRB 4D9CA 5K1XA 1QOQB 4B6FA 1S8FA 8GPBA 4BX8A 5JMTA 4LNHA 1NQWA 4B32A 1GADO 1E1CA 1ZG3A 2JEZA 3BH6A 5B1DA 3V7WA 3PPWA 1RXUA 1S3SA 2H57A 3R0VA 3K08A 4GMDA 4JROA 3EBOA 2ZP1A 4PFQA 2BSAA 1Q15A 2G7ZA 2E1RA 5AVQA 4FZ0A 5CB0A 3PUIA 1DAMA 3NEAA 5INTA 2GYYA 4LRSB 2JNWA 4P92A 3S7TA 4Q7MB 1RP1A 2W6PA 1PR3A 2WP0A 4NG5A 4NESA 5ALTA 3KV1A 4PAOA 1KXZA 1HLDA 5B1OA 3QVJA 2CHGA 3H1TA 5DTQA 4BB0A 4PRKA 2PMPA 5FOTA 3RUFA 3VZBA 3WIUA 3MJ4A 1RRFA 2HQRA 4ROSA 1Q19A 1M1UA 4WLUA 2O14A 3ZI0A 2CF5A 2REBA 3ELBA 3FD8A 5KSWB 5IF3A 5JT1A 1F9AA 3TLGB 4D7TA 4ITRC 3DM9B 2Q07A 2X6QA 1ORDA 1M74A 1FVHA 3SMVA 1K98A 4ETIA 4PSUA 2MK3A 4G4YA 1HPLA 2XOKA 2PL3A 4ZU6X 2XD4A 4BEBA 4UAJA 1UR5A 2XLCA 2XMPA 4UCXA 4KIWA 4RPHA 1SU7A 3F5DA 1P9NA 4O4HB 1KK3A 1UKVY 1YMUA 5ALEA 4OY3A 4YRAA 1C7JA 2CMDA 5TPWB 4QRDA 3WXMA 4O2BF 1WF3A 4ED9A 4LQLA 3VI6A 3ED1A 1SF9A 3IQEA 1KORA 1P7YA 1CP2A 1OU0A 2WM2A 4FPXA 4KVGA 4LSZA 3JSNA 4IW3B 1M10A 2JJ1A 1NMXA 3DZDA 4H3VA 4PNZA 3FPIA 4MW1A 2HSJA 9MHTA 2YJ3A 2DPYA 4TSFD 3KWMA 4FDUA 5FDFA 4UCOA 3MT0A 4XOUA 2AF4C 2OCPA 2EGGA 4A2PA 1I3OA 1K7CA 4HGRA 2FHSA 2EIKC 5DW3A 2XMSA 1C3JA 1JN0A 2FMKA 3GZTB 3CH5A 4ZHQF 2GNOA 3WMGA 5CA3A 3IESA 3JQ9C 1EFPA 2QN6A 5KHAA 4ZI5A 4M6WA 4ZDWA 4H1TA 1KEEA 3MUOA 1OA0A 1E9AA 1FX0A 4DIDA 2IHUA 2NO0A 4HF7A 4RD3A 3MWDA 2LIVA 1QVWA 5LLDA 1P2GA 3F4KA 1SIWA 2MIIA 4B48A 4QDKA 4Y3UA 3KSBC 4W5NA 2XF8A 4WT7A 1UH5A 5J9PC 2VAVA 2YBDA 4L5CA 5TQJA 4BHTA 4DM3A 2BKLA 4HNTA 3E8MA 1DZ3A 1P1HA 1IOVA 1UMDB 1UIRA 5CH3A 4CTKA 2ATVA 4LGVA 3U7RA 1DLIA 4MPDA 2IBSA 2GN2A 3IDQA 2HXYA 2XNKA 4PA7A 5C0OE 3GB7C 3AZQA 2I4NA 3PJEA 4FMBB 3B53X 1G4HA 4TKZA 1FTYA 4BMCA 1NMYA 3CEPB 1U2ZA 1J5EB 2GK6A 2VATA 2JIMA 5J1SB 2FW8A 2D2XA 2V9ZA 4Q1FA 1JBEA 4TLLB 3GJZA 5G4KA 4NG4A 3R5XA 5FWYB 1R15A 3AEIA 1T8PA 2G0AA 1YHYA 4JUBA 2PCLA 1PJLA 1HYHA 4MWGA 5C53B 4TSFG 3IEXA 3JAMM 3PWKA 4GE3A 4DLUA 1C3LA 3LWPC 3WTBA 3EOZA 4F4UA 2XRFA 4EHKA 1QJCA 2AX3A 2GN8A 2ZJFA 4HXYA 3V55A 3AQIA 5EXXA 5BSUA 3H5VA 4MGIR 3H1JH 3MQFA 4UCQA 2JLZA 5CJPA 5HGJA 3A32A 1A5TA 1Z5GA 1I4EB 5E7JA 2BFMA 3NBQA 1QZUA 5JSYA 4ENTA 3LVRE 1OWOA 1PIWA 1CY8A 2Y05A 5BV1A 2HJSA 1SVOA 3FWYA 2QTVA 3HL0A 4Q7EA 3L7IA 4MH0R 1TJ5A 4FVMA 4PRZA 3FF1A 4KL1A 4HAWA 5EMJA 4MR8B 2YS7A 3K31A 1J1UA 4BO6A 3E5NA 5CG2A 4HRVA 3D6TB 2R60A 3F67A 3OM0A 2H8KA 2LR0A 4WJKB 3PE6A 4LMRA 4UM5A 1A9XA 2DH5A 2ZK7A 1EGAA 4R16A 2IWHA 1XMXA 1U80A 4RH0A 2RHCA 4BAYA 1OB5A 2QQEA 3OX1A 2A3RA 3QWAA 5HY4A 3I37X 4Y6RA 5G0SA 1ISSA 4PA4A 1P0MA 1JQLB 1XTRA 4BMOB 3U6BA 2CTQA 5EP3A 5B37A 3WRXA 1EAMA 4E3ZA 2QVCA 2I6XA 2QENA 2VH2A 3GFSA 4IDQA 1L5GB 4LPKA 3NVKE 4RWEA 1ODJA 3N28A 1T2AA 1QFMA 3VBEA 1OAAA 4NP6A 1NXPA 3SPHA 2PSEA 5GONA 3GEPA 4EPRA 4RMNA 2H2HA 1E6KA 2VHWA 3JWGA 4W5WA 4G9GA 4OUDB 2UZHA 1VDMA 1Q5PA 3DMHA 3QEMA 4MCIA 4MLCA 4H6WA 4BQIA 2ZKLA 1F06A 1RQRA 2O1SA 3RS2A 1DKOA 2IYUA 2A57A 3KYDB 4A1FA 3DO5A 2QAIA 5CDFE 5I3ZA 4NBNA 7YASA 3IKTA 5EE5B 3N4YA 1X15A 4JBNA 5I4KA 2F1MA 1LSSA 3R3SA 4ER6A 1KEPA 2ZRBA 1Z06A 2HF2A 4OKSA 4EFKA 4NDZA 3AG2B 4C8GA 4DBVO 2VTVA 4Q4JA 3E8XA 4BRUA 4FXPA 4U6SA 1MO4A 1KIAA 2EX3A 1JFSA 1TL7C 4IH4A 3V00A 3ZOPA 2EZTA 1JIQA 4NB5A 3A4VA 5A9GA 4LYYA 2LCAA 2XVAA 3QNUA 5KAFZ 2FQXA 1K5DA 1V4BA 4H6VA 2MWMA 4IV0A 2H29A 3OY2A 2R5FA 4J3FA 4N0PA 4PQRA 1GV0A 1UOQA 2DWUA 3FFBA 1H2WA 2HWUA 5GAPK 1DAOA 2I2CA 3C5WP 4FZVA 2AJ8A 4J7XA 4TV9A 4R8RA 5EWMB 2XZOA 4RY0A 3VNUA 2KBEA 3MNFA 4XDZA 2H2AA 1DTEA 2ZT9B 4GLBA 2Q5ZA 4DR6O 1MT3A 2FMUA 2ZRQA 3KKKA 1AR4A 3KT6A 3FLMA 1YI2V 3PUJA 4V1CA 5F7XA 5HKKA 3L7AA 4JX8A 2NT3A 2WTXA 1YRHA 5K51A 2NUAA 3STLC 1DBWA 2V74B 1QYCA 3ZXXA 3I34X 4AC9A 1OIWA 1FSFA 2R97A 2JFHA 2YWXA 5KVAA 3CHYA 3ZHBA 1BXRB 3RC2A 5EMHA 3IC7A 2PY5A 2WMDA 3BKXA 2GM9A 1H4VB 5JNLA 2HPHA 2G1JA 2YJ6A 3B36A 3EUEA 5AXCA 2M6KA 5BUCA 2A1TS 5FNVF 4J41A 4HWSA 5JPIA 4XXHA 5A0TA 3L70H 4GCZA 1KY5A 2HA6A 3OZCA 5CFNA 4A4DA 4MA0A 1U9YA 3MCZA 1QRUA 5G3ZA 2X5KO 2ZE6A 4BFLA 1U3DA 5FWYA 4P33A 3HZRA 4CODB 1U0RA 2AI1A 4R83A 1ZNZA 3W4IA 4ETMA 2LDBA 1GGMA 3G5AA 4HO1X 5DNAA 4K9SA 2CAZC 2Y1EA 3NYWA 2AG6A 4UTNA 1RJ9A 3THXB 4GI2A 2JD1A 3ASUA 3URMA 2X4DA 5FLKA 3SJCA 4MTLA 3AIOA 3ONEA 4PHHA 2QWOB 4UCWA 1UK6A 2R1VA 5E1BA 1JKFA 2JLRA 2QOEA 1Q82W 1GQOA 4FQ8A 3OZRA 5T4BA 2NMVA 4YJFB 1AA6A 3KU4A 4V38A 1CVRA 1LEHA 1X7DA 3PC4A 3WL8A 1QHHA 2JLBA 3L8ZA 5KKNB 5FLYA 2ILMA 1XEQA 4F9FA 4F1KA 2WTUA 1PNQA 3HBLA 3VGJA 4LA4A 3VISA 4MR9B 1CPYA 4PYRA 3U5ZB 1YF3A 2PUBA 2QMUA 4FS3A 3SBEA 1W44A 3QMVA 2ZT8A 2QT0A 4JYAB 1PNVA 1RHKA 2CEAA 3CA8A 3CPJB 3H99A 4LBVA 5DM4A 3ZNPA 1TAUA 1GYRA 1WA8A 3CMEV 2BFEB 2C9ZA 5B7QA 5H4GA 1W1WA 4M8NE 5DTMA 2GRUA 3UANA 5L6MB 3W3AD 3VNVA 3R5KA 1CRQA 4GPAA 4LHVA 2K2QB 4W1QA 3SJZA 3I04M 3QYJA 1KI6B 4JQCA 1VRCA 3L7NA 1HV8A 2QQ5A 4KFUA 1U3TA 2AIRA 2CMFA 4LXTA 4Z4QA 4RZ2A 3HJAA 3QGMA 4XM2A 4CEIA 4MWEA 3KJJA 1ID1A 1K6XA 2YIBD 1GX1A 1YVWA 4MDEA 1RQ2A 1I9GA 1ZUNA 2R7MA 3QMWA 2MSKA 2BMFA 2QE7D 3NKLA 2AMFA 3OD5A 3A6FA 2G09A 4Y2QA 3H9QA 1HTWA 1JHOA 3IBTA 2VYNA 3K05A 4PAWA 3E53A 3A28A 1KI1A 1VSUA 4KQ2A 2PBFA 1BVHA 1JT2A 2VWPA 5E4TA 2XZLA 1SVKA 2QLLA 1OCRC 1QLWA 2XITA 1PL6A 2VHTA 3QJGA 3GJ7A 4JT2A 5BN3A 2IT1A 1X77A 4L50A 5IJ0A 1NR7A 1DF4A 5F2NA 3EH1A 2W7TA 3RVDA 3BWYA 1CW2B 2W6NA 3A10A 4Q4JB 1MDFA 3UFBA 1UM8A 3DOEA 3H9JA 1T5TA 2J09A 2QTLA 4GKVA 3N58A 3SFTA 3CLRD 4E2FA 2QLFA 4JWTA 3EZFA 4EHDA 3OQ1A 1H6DA 3PQ4A 1FZTA 1CDEA 2NN4A 1TVMA 2YWGA 4EGQA 1ISRA 4UU8A 4XWTA 1JILA 1NW9B 1A8SA 3OQJA 4LWQA 4RXUA 1ZA1A 1JBQA 3MINA 3S03A 1E7QA 4QJFB 1SXHA 10MHA 1SXQA 1V4NA 5EQTA 4BBJA 1H4QA 3M7MX 2IYNA 4LYJA 2Q3JA 1MEEA 1WZNA 3RRXA 1GPAA 3IBFA 3L3BA 3R09A 4H17A 4LWZA 1G3QA 4M0MA 4DA7A 2Q6OA 3AI2A 3NM6B 4ZOAA 5JG7A 1MO2A 2QLMA 1KKCA 4FFMA 3UOWA 1IAQA 3A1FA 5TPZA 4CS2A 2RGDA 2PMBA 4C1BA 1FP7A 5DULA 4UNNA 4BNUA 1P7WA 2FJ0A 3ZGLA 4X85A 4Q4HA 3QJ5A 1C8VB 1SU4A 4GQIA 5K20A 1GUBA 3ICVA 2YYSA 2XVZA 1X3SA 1PG0A 2YY6A 4JJKA 5IU6A 2F1HA 4RUEA 3ZU6A 2AVDA 3HBAA 1RE0A 1P8AA 1NW7A 4MV9A 5IP5A 2IYZA 3ZHYA 2ZT7A 4H9GA 1E99A 3PXXA 5CTAA 2GCEA 1XTPA 2MW2B 2BP7B 2YVQA 3OOEA 2ZUUA 3QFSA 4GMFA 1CEXA 2X9LA 6ABPA 1X39A 4CKBB 2IXGA 1TUGA 3DAYA 2BGIA 1OGYA 4KQXA 4Q1EA 5LNK6 2XB4A 4UVIA 1IMJA 5E6SB 4A0SA 3ASOC 1E3QA 1FU7A 2X6BA 4JF3A 2P3LA 2VTDA 4RQTA 5EZQA 3W7VA 4GT1A 4E5VA 4CIBA 1Z6TA 4L8WB 4ND7A 3UA4A 3H2JA 2QRPA 4RQAA 5ILOA 3EZ6A 4OFXA 2CH7A 1JKXA 3TOZA 3OM8A 4CHTA 3RKRA 1Q0TA 1VKHA 4IIJB 4IM7A 4F9EA 1NF8A 1RQNA 3LRXA 1K63A 2XAQA 1Z2NX 4JJIA 1NLFA 1T2UA 1P19A 3I5UA 1NRXA 1LVHA 2NAFA 5EJ8A 1JR6A 3E2MA 2ATIA 4KODA 2Q7HA 2CLKB 3FKSA 2PL5A 4HNGA 2Q3BA 5BMOA 3IV6A 2QDOA 3GXBA 4ZD6A 1FFXA 5ERXA 5CDUA 3FOFC 1PV1A 1R18A 5F2KA 1QB8A 3EEOA 1QD9A 2O2HA 1Z18A 3K0HA 1VQNV 1CY2A 1L4UA 3BHNA 2ENUA 3G2IA 3H97A 1BGYH 1E1RD 3ITKA 5IVIA 2FOXA 2M9MA 3IQHX 1O6CA 1UFQA 3ZWOA 4WOBA 2YI9A 4CR8A 1JWLA 5DK6A 3DPSA 6GPBA 5HFMA 5CT6A 5DW0A 1OZGA 1YQ9A 1HFKA 2G9IA 2ZBDA 2PX8A 1EFLA 1ILEA 3BEDA 4Y2XA 3AU8A 1S2OA 1HK7A 5IW8A 3PJGA 3JD3A 5JQGA 2J0UA 3X1DA 1B15A 3C8LA 4YP7A 2QVLA 4ZJYA 2O8FB 3H9GA 5T6BA 3Q8XB 1DO8A 3ANXA 5E4FA 2OCCB 3FPSA 4GOOD 4NCXA 2ZDQA 4Q3KA 2AK2A 3L8FA 4NL4H 1ZWIC 1SKQA 3U40A 4EUFA 1DQZA 5HRCA 3UA3A 4CH4A 4JC0A 2Q3LA 3V1NA 3K1AB 1Z4IA 1JAHA 4Q6GA 1V47A 2C2MA 4C07A 1YHZA 4AKIA 5BUZA 3MWFA 1U9IA 4IGFA 2WE8A 4GKJO 3LJKA 2IYSA 4PG4A 3HSYA 4LJKA 1L7EA 1F17A 4I2VA 3U4CA 4Z0PA 3EHBB 4UCVA 1A9SA 1T0AA 2IDKA 2ZI3A 2W42A 4JASA 2YUTA 3SYKA 2J87A 4N5NA 3M4JA 1U1CA 4BY9E 2Q2QA 3RQIA 1E2HA 1SERA 1SD2A 3DBLA 1CUGA 2PWZA 3LF2A 2GN1A 3MCVA 3ZU3A 1E5LA 3DZHA 3K30A 4BAZA 2YH2A 2QRGA 4NV0A 1QKIA 5J2UA 4CM5A 2JVIA 2C94A 5KU1A 2RKBA 4I5GA 2KG4A 3GGPA 2D74A 3HZHA 2R00A 3GC6A 4HAOA 4MW6A 1MC4A 5CVDA 3O2NA 3E0QA 3OZWA 2HEPA 3TCNA 3LFOA 1J00A 2QSYA 1L8QA 1S4MA 3GGCA 5K3SA 1YS6A 2V5UA 5I9BA 4BVKA 3AFMA 1QE3A 1P91A 3DUFB 4NAVA 4UM7A 1KAQA 2PTGA 5ICEA 4OOEA 2TMGA 3R7LA 1NYLA 2ZZNA 2EW1A 4P4UA 1TOAA 2BE3A 2UYHA 3KOZA 3ZUPA 1W6RA 4DA6A 1Z12A 3BA1A 1PJ2A 3A05A 4N82A 4CR7A 1PNOA 2WJWA 1PO7A 4WX2B 5EERA 3VV2A 2YFHA 4M0LA 2PG3A 1S72F 3HFGA 4P4LA 4ZVOA 1E2IA 1SBTA 2PFKA 5IUJC 5JWRA 5EIAA 1YITF 1N34O 4UPDA 2BFBB 3O4FA 4K88A 1ZWLA 3G4SV 2VKQA 3ZWPA 3UHFA 2HDWA 3FOCA 5J5VA 3W7TA 1BRTA 1E3DA 1OZHA 1W2WB 2O20A 3KQVA 4EI7A 2EEPA 1LF0A 3DDNA 3OEHA 4K26A 3D8HA 1A1VA 1ZNYA 2ZBGA 3FRJA 4X64O 1N33B 2XW6A 4WUVA 4BKMA 5IM4F 2AVNA 3A11A 1LY1A 3IKVA 2WT4A 2VHYA 4NULA 2WSYB 4EWLA 1ZH6A 4BUZA 2WTBA 4RLQA 3FFTA 4LHEA 2NSHA 3V1MA 5AOAA 5BWCA 4EA9A 1Y4UA 4M89A 5J4LA 3CONA 5CFZA 1AHIA 1VL6A 3SKYA 5KYYB 4OM8A 1PFYA 3OJLA 3VPCA 4F2DA 3VPGA 4N7RA 3X0DA 2VNHA 4R2WA 3CLRC 4DNPA 1JA0A 1VECA 1ZK3A 3ONFA 3PENA 3SFVA 4PN3A 2RAUA 3TNYA 3NTOA 4J0FA 3JSLA 3PQDA 4RZXA 3RT9A 1D2DA 1GUAA 1E1QA 2QLTA 4BU0A 3PNPA 1NBHA 4MDHA 1T8UA 4IH9A 1BXZA 4KL8S 4ZIRB 5AXBA 1BKDR 2FYUH 5CB4A 2A33A 3BICA 4BP1A 3CUVA 2HRZA 4U7NA 2PYLA 1ONIA 2HKIA 4PBTA 5D1NA 4B6JA 1ADJA 4FN5A 2VRZA 3QELB 4Q3AA 5F23A 5JW6A 2VTBB 1I5RA 1GTL1 5HZMA 1NVKA 1B2LA 2EARA 1PT7A 5DCWA 1ODFA 2EWMA 4FFBA 2X5XA 5E38A 5LM3A 1F60A 1FK8A 3EIOA 3MPUA 5FWAA 1I33A 3LUTB 1I30A 3OJWA 4FR5A 4EG7A 5K8IA 1JEYA 2V7XA 3RRYA 4UTRA 4WFFA 3ZRVA 2UUBO 1MIOA 1RR6A 1CJCA 2EP7A 2X9QA 3GWKC 3VQTA 3TGWA 1YQUA 2ZZMA 3BMXA 2YNMC 2IOFA 1OU4A 3D4BA 1UMKA 1ZLZA 4S12A 4FLWA 4UBKA 4UEWA 2KLHA 3IEWA 1R27A 2CCJA 4KWIA 3OUZA 2NSDA 4MQ6A 4IPTA 1OLSA 2YDXA 1BKYA 1M83A 4RS3A 3UG7A 4UC0A 1PF7E 2VDRB 1AKVA 3E7FA 3KDAA 2FLWA 2EW8A 2R68A 4N7JA 5DLDA 1E1DA 2PH5A 1S01A 1SVIA 2VNIA 3HXOA 3B3AA 4F5DA 4UQPA 5T3UA 1SCDA 1TZJA 2NV0A 3U6KA 2IZ0A 1QS0B 4UCFA 5BNZA 4BKQA 5K99A 1VK3A 2FZCA 2GEVA 2NQ2C 3N59A 2VI5A 4G8JA 4BVHA 2C2WA 5F77A 1KMMA 4M36A 4ZZIA 3TXQA 1JPVA 1ZN8A 3EFHA 5AM5A 5GJBA 5JCXA 1GR0A 4F9GA 5KYGA 1UMCB 3OPYA 4JUIA 1TZCA 3PKZA 4A3SA 3NDBB 1AR1B 2C2GA 2F4NA 1GFWA 3LQ1A 1KPHA 4KWTA 5JJIA 2BM9A 4KGVA 4PG7A 2QRMA 3ZK9A 2PKQP 3CEAA 4AMZA 3K0BA 3KIPA 1G64A 4XM0A 1QZZA 1JYSA 1ZXLA 3GOHA 1EN5A 3Q3HA 3KQLA 4HGYA 3GHZA 1SETA 3QKIA 3SXPA 1EWKA 5KUKA 3C7TA 1EP3B 2DFTA 2QQFA 5EXEA 2I4OA 1YFJA 4DLPA 1HDYA 1E79D 3CX3A 3V80A 1ULZA 3O74A 1X1QA 4UDYX 5GINE 2OTLV 2QF7A 3NBMA 5FO1A 4AW9A 5LMNB 1W5EA 4GI5A 1U3LA 4LF5O 2L6LA 3JCMM 3LCRA 5FL3A 2QP3A 2ZUDA 5CX4A 4DR4O 1M2GA 4LRWA 2FSSA 2ZTMA 1R6AA 1YK0A 3P9QA 3TJZA 4TV8A 2FI1A 3K57A 2BEWB 3IP5A 1Q6UA 3M34A 4MEBA 4YJ3F 1XQVA 5F4ZA 1XNQO 1Y80A 3ZK8A 3RU2A 2QRQA 4DMGA 4ZYLA 4MDFA 1VCNA 2AOWA 1YJBA 1KAMA 1OQAA 2B2CA 2VDWB 3OZSA 3QSGA 5C1DA 3U09A 4HUQB 2HCFA 1EGHA 3AJ9A 5EHXA 1E77A 3ACBA 2H4HA 3IRVA 4EK9A 5HY0A 3CKMA 2F8SA 2UYYA 3W2HA 3FUCA 2P6PA 3O7MA 4ZU3A 3NWJA 1ATZA 5IHXA 1S1MA 1DUIA 3AVVA 4YNBA 4N03A 2HF9A 3W7BA 3N27A 3GYQA 1QCYA 1YACA 1TO2E 1GQQA 3CG0A 2WHPB 2CDAA 4S1OA 5DEDA 2ZIXB 2YI8A 4PYIA 2CWJA 5EZ6B 4CCYA 1QUEA 3S3TA 4C1NA 3L77A 1E2MA 3LUFA 1DVRA 4MKGA 2Q0QA 2N74A 3IJ4A 4XX0B 2GEJA 3N05A 3DF7A 4AJKA 2XKKA 5IRCD 3K2XA 4MVJA 2P2DA 4BVEA 1NV8A 1ZR4A 2HPVA 1NP6A 1PJBA 1TLTA 4IOJA 5H7XA 3GLHA 1OA1A 1CUSA 2EINB 2HX1A 5HA5A 3VTFA 5BSWA 1XELA 3B5JA 1RWXA 3K9HA 5IZCC 4I4TB 4JI6B 2VF8A 3IBGA 2QRVB 4DCCA 1IXYA 2H5IA 3GJYA 4KK3A 4BT5A 4RO2A 1HYBA 4L16A 4TYWA 4XM1A 1CUZA 1QG6A 3H1HH 1KYIA 2E1PA 1E6WA 3HP1A 1Y33E 3D1JA 1MZEA 4BZQA 1QYIA 4GLXA 3ZDCA 1GG2A 2HHLA 1SD5A 4LZZA 4EY6A 1ZK2A 3CZRA 3LT0A 5CNJA 4ZV4A 3Q7TA 4R1OA 1TLFA 1L0BA 4Q00A 5DGDA 4YV2A 2IP1A 3LWVC 3LV8A 4E09A 2IKSA 2FEAA 3QVKA 3K12A 1XWIA 1NVXQ 3FBGA 3KAKA 2N42A 4BPRA 3GUHA 3K79A 2BDEA 3F2IA 3GZ4A 1YI2F 1JHDA 2MR5A 1IZ0A 3JSAA 4OEHA 3WYNA 3PUWA 1C5KA 2Q3DA 3NDIA 2Y4UA 1R6DA 4GR4A 2OV1A 4B62A 3A6KA 3OEYA 3G8BA 4RD0A 4TT8A 5FRDA 1N7GA 2QROA 2P4HX 1BO6A 2EU8A 3D7LA 3LG2A 3BMQA 4GQAA 4XR9A 2VYCA 5AOVA 1XPJA 3TTYA 4EEKA 4ENSA 3OMAB 1QHNA 4PO8A 3T2MA 1TUIA 3WHLA 3TW0A 5IT9N 4G1VA 2ZETA 1Q14A 2RFLA 3IUSA 2AOUA 3QVLA 4J0KA 4FBLA 3ROMA 1KO4A 1H8HA 5FBQB 2XLBA 2Z5GA 3VNAA 2JNBA 4W1SA 1XHEA 2PX4A 3ROEA 4WFGA 1Y6JA 4BO9A 2OGZA 3T1TA 1WQ1R 2INGX 3L1KA 1F51E 3CW9A 4BQPA 4MWSA 1ZJWA 3P10A 1I08A 2P9ZA 4J0JA 3TAHA 2JZCA 3MCWA 3M6FA 4RTQA 3T5GA 2VPXA 4CM9D 4JJ8A 4DYDA 4G37A 4DVGA 4DDVA 4JLWA 2IS6A 1Y82A 2W00A 2B83A 1Y3IA 2ZW9A 3BH0A 5ALXA 5FCDA 5T3YA 4URZR 3VHXA 2QWQB 2IEAA 4C0LA 2X6TA 2WA3A 1RNLA 3JWJA 1DCKA 1T3SA 4M0PA 3PYXA 1OI2A 4FYPA 4LTNA 1GPMA 2B6NA 2GO7A 1YUNA 2O1WA 4G4IA 4TXLA 4U6QA 4OF4A 4X8OA 5EG5A 3CUEF 1RPAA 2OCDA 1X7WA 3PGKA 5LCXA 3WSTA 4EJSB 2YWCA 2XT6A 1QH9A 2OMKA 4AQ7A 2I34A 3CG4A 3VDNB 5C8ZA 1L5OA 5CW2A 4TV8B 1ZGAA 1CE8B 2F23A 1N5IA 4O4LB 2RI0A 2OSVA 3P2IA 5FOWA 2MCFA 3U0VA 3UENA 3V8NA 3GUYA 4HAUA 1BXGB 4G8BA 1DWOA 1G8SA 3JASB 2QM7A 1G66A 1KI6A 1X8KA 2HUNA 2QDKA 2XYRA 3DKKA 3JZDA 2CZWA 1E59A 2I2DA 2ERYA 4WF9V 1U6IA 3L6EA 2G76A 3MCAA 2FP4A 2N46A 3ABZA 3FHLA 4WKBA 4XDHA 5AM4A 4AL4A 2HF7A 4EFNA 3NB0A 3ZX5A 1QR9A 2HU2A 3FAZA 5FJJA 5H9WA 3LGAA 2KWIA 1ZJZA 1IV3A 2WF5A 3CN9A 2B1IA 3QKRB 4P2GA 4DCUA 3N86A 5LQKA 1QBGA 3TR5A 3DC7A 3SC6A 3P0ZA 4I9UA 3ID6C 4MMYB 4RVFA 4S2UA 1PNRA 1DC6A 4UHDA 4J75A 4W5JA 1FTWA 3TKAA 1H5UA 2GV9A 5EYPB 2DTEA 3BJRA 4RK0A 4W8OA 4ZQBA 5J40A 3KUXA 2A9FA 4OI1A 3TX2A 1CY4A 5EJMA 4M49A 4L5AA 1U3WA 3OQNA 4BAUA 1W73A 2D1SA 3ZNNA 1AHPA 3ABLC 1YU9A 4GPEA 3GJRA 2VQEB 4E4RA 2GJ9A 4M87A 4ZCTA 3AEZA 1EEXB 3CCMV 3H4IA 4M99A 1R88A 1ICEA 3SWWA 2QYSA 2V6MA 4HTFB 2WIDA 1YC2A 4IMJB 1G4YB 1II8B 4G41A 1NJ2A 4NY1A 2VOEA 1JHUA 5TSDA 2RI1A 4HBNA 1Y34E 3NHSA 3VQWA 1S7CA 2B1JA 1JHAA 4UUOA 4F84A 1Y1RA 3UPTA 1CQPA 2JIZG 1NT2A 2XNDD 3V7QA 3AILA 3ORFA 4BP8A 2WSIA 1T26A 2VYVD 5E7IA 1SHUX 2PX6A 4RPGA 4KFCA 4EUSA 3PUHA 3S1SA 2BFPA 4I8DA 4DUYB 3NM4A 2R6DA 4UW9A 2QM3A 5GJVC 1H23A 4J07A 1DKPA 3M1YA 2XOEA 4L8FA 1IVSA 2ZQZA 4E32A 4D4MA 3PEEA 1V5WA 2PYDA 3L4BC 1V1JA 2GBFA 1AGRA 1KY4A 3SR4A 3TETA 2UU9O 4MUFA 2H7YA 5C4MA 2AQKA 3KSUA 2W70A 5HW0A 1VSBA 3H18A 4JR0A 4QUGA 4BCBA 4BCDA 4DA8A 1W30A 4PELA 2Z3YA 2CCGA 3F3SA 5DASA 4AJ2A 5B4TA 4BIUA 2XDAA 4MRSA 1WB9A 1VHDA 1PQ4A 4JGBA 1ZGHA 5I7VA 4NF2A 3HCAA 2N05A 3BD9A 2AFIB 1AKMA 3K4PA 1HXHA 3EA5A 2I3GA 4J4TA 4DMKA 4O2BB 3VOBA 3DHYA 2PKCA 3F7VC 4JAVA 4BKUA 5KSOA 4RSGA 1CP9A 3F0FA 2ECKA 1M57B 2HK8A 2ZSKA 2FUG6 2QTNA 2L0XA 4IJKA 3NPMA 1T9KA 3EASA 3G88A 4LF4B 4RDHA 4ARIA 4NBLA 4WRRA 1JZSA 4LXUA 3OCYA 5JNRA 3DL2A 2LP7A 2HXGA 1XALA 1IK4A 2WJ6A 4FFNA 2QV0A 4YCJA 2VKTA 4QA9A 4WBNB 3DUWA 2Q62A 5FWNA 1OYVA 1XEWX 2G72A 1BE0A 2E6UX 4PX2A 2F90A 1K6EA 2AN4A 3E1KA 3U62A 3FCUB 4CKEA 1JGTA 1EP1B 4FYWA 4FMCF 2FPIB 2FEOA 2OCGA 1T4GA 3DE3X 4GRIA 4QOIA 2J59A 1C0EA 2GN0A 3FPCA 3R24A 5LBUA 1P7CA 3TG8A 2XCLA 4YCNA 4TLAA 1CE8A 4QYXA 1VIYA 5AHKA 3HCCA 2IYTA 2O5CA 3SHOA 1T0BA 3L92A 4QODA 1LFAA 5EZ5A 1GZUA 4I1RA 4LHWA 3SZOA 5TISZ 2AXNA 2MJLA 3T1VA 1J6UA 1E9DA 2A7QA 2W8ZA 4LDQA 3TLGA 2GHIA 4J0DA 3O1HB 3PTLA 3R44A 1QVZA 4FZRA 2GH1A 1Y8QA 4KPGA 4ALKA 2Y93A 3CX8A 3ZCQA 2J0QA 3AEQB 1JA1A 1G5IA 1SBHA 1UBJS 4JEMA 4X8MA 1W0KA 4ZT5A 3RS0A 3HYLA 1PBNA 3L2OB 4R1MA 4EF5A 2PX3A 4P9PA 3PNVA 4KXLA 3K6SB 3K09C 3B89A 5F9HA 3KD2A 3A6HA 1ECJA 2FXVA 3KCXA 1XGKA 5EPUA 4JQZA 5P8WA 2REQA 4J9VA 3RRNA 3ASNB 4W5RA 3I52A 4MJ7A 1HDGO 1QHTA 1GD1O 2OAQ1 2P2YA 4WCDA 2OR3A 1QIGA 1ONNA 4WD3A 2W4IA 2Y4OA 5F1KA 1PRYA 5FPPA 1DIAA 1T15A 3S2FA 1FIUA 4ZVMA 4QJIA 2ZXUA 3C9UA 2OKGA 4HTFA 1YSCA 1T6YA 3TD3A 2HA2A 2ODTX 3C8MA 2VR1A 3HB5X 5JLAA 5DNYB 3VR5A 1RYZA 4B3SB 2KG7A 2YW2A 2XRMA 1IN4A 3CNOA 4HLQB 3DDUA 2AW5A 1FPOA 4YMLA 3QQPA 4MVZA 4YRBA 3IE1A 1XHOA 3K1YA 4J3JA 1NUQA 2IPLA 3ZD9A 2QKAA 3P19A 2JGJA 3SE0A 3KT3A 5KTYA 4KKVA 3CE6A 2GN9A 2ZRNA 2XYVA 5FKJA 5JMWA 5C8XA 1TM1E 4K5QA 4V0RA 1IPAA 4BQSA 4BGEA 1OYWA 4BVJA 1LDGA 1RKXA 4HNHA 1CJUC 4Q3CA 5ALHA 1JLLB 2QIPA 1KJIA 5KCZA 3BVOA 3CXHF 5HFJA 4I99A 2ODQA 1ONSA 1ZA2A 1UJ4A 1RPOA 2RHRA 2JJQA 4QDTA 2P91A 3TWOA 3WG9A 3RFUA 1I7PA 4MUYA 2WJYA 3ZMUA 5GZ3A 4AUMA 2BFCA 2P9EA 2E6KA 1RAHA 4J49A 1SZDA 4JTAB 4C2BA 1XRRA 2QZPA 3KJKA 3NIGB 4RHCA 3I05A 1H0SA 3PLRA 1H2XA 2YOGA 2W0SA 3HA7A 3W8DA 1YHQF 1L5HB 3CLSC 1MAUA 2YEVB 2WALA 1BU5A 1V16B 2Q67A 1V7PC 2XMGA 4J1QA 4JLVA 5C3UA 3U39A 1J70A 1ULSA 2CK3D 1C3EA 3IAM1 4L74A 4E08A 5AVMA 1MMMA 2J3HA 4J7CA 1RJGA 4YIPA 3L75H 1WPQA 4MYRA 3N2YA 2A78A 3PD1A 3O5AA 4C20A 5IM5A 1PG5A 1V54C 3N2GA 1XCLA 1U3CA 1ZFNA 2LCIA 3CE2A 4S2EA 2VZLA 1GPWB 4FD2A 5ANRB 4PYOA 3UH1A 1OC2A 2WKRA 3BWVA 4DY6A 5A3QA 1ETHA 4MR8A 3VPDA 4MRNA 2QGNA 1DAKA 1EK0A 3PWTA 4AYTA 1N8NA 2IAFA 1P29A 3G2HA 5DLYA 4WLVA 2K7FA 2VHCA 1UQTA 1G291 1K73W 2R5NA 4YGYA 2HM7A 3AFGA 1RXIA 2VJBA 3EULA 2JFWA 4N8DA 4LEIA 4HGNA 5DHAA 3C45A 4PI0A 1U40A 1ODCA 1Z88A 4XYBA 5ALSA 4B8YA 2BMAA 3N9IA 2QK4A 3J80N 3GUVA 3LC7O 1BC5A 3QKWA 1JR3A 3T7IA 3REOA 3EZLA 3HSKA 5CU7A 1Z17A 3ZWAA 5NULA 4IQ4A 1I7FA 3UNXA 1HF3A 3HYRA 4L8YA 1WB8A 4FM1A 4KQEA 4C2TA 1P81A 4H0CA 5CG1A 2J33A 3KQWA 4PDRA 1X86B 1XRSB 3MAAC 3RSGA 4Y9TA 3L74H 1QV6A 1NRWA 3W7WA 1ADYA 1TF2A 1W46A 1YRQA 4LWSA 2D5LA 4LXIA 1TO1E 4HDRA 3DZKA 3ESXA 1OXUA 3BTUA 3R5JA 3UK7A 1DTOA 2FZVA 1CUEA 2OYSA 3H2KA 3V2HA 1H6BA 3S1AB 5HKBA 1DRWA 3HN7A 1XZQA 1CUJA 1U8AA 1QYRA 3TTUA 2DYRB 1D2NA 2WSSG 2EBWA 1KS2A 4UXIA 3BERA 2CJPA 1LDMA 3MB8A 5CJ2A 5ICMA 4L72A 3NXSA 2WKQA 4FNGA 2W2QA 2Q73A 4Q4LA 4RA9B 4ZAZA 4GLJA 1IURA 1YS4A 1KZYC 4JS0A 4OQDA 4IILA 4WDRA 4BB9A 4C29A 3WL3A 5HZGA 4MTFA 3H2HA 4R84A 3CCUV 1DGSA 1SQFA 3MBMA 5KJ6A 2BEUB 1FNKA 4YECA 4L28A 1RQXA 5KNCD 4QUKA 2WKSA 2RBGA 4Y6LA 4LVCA 1DCTA 3NV7A 4CZZA 1U0SY 1V8FA 4FLFA 4A2WA 1YVPA 2FSVC 3P45A 1T9HA 2BFDB 5FB3A 3IJEB 1X80B 4ZN6A 2Y68A 4WGFA 2B98A 3ZN1A 1OSNA 1U9CA 2H2IA 4I2NA 2MMGA 1CD5A 3A1EA 2FW0A 1XB2A 2RCNA 2XV1A 2ZSAA 3C6ZA 3WGKA 3STXA 4JXKA 4H4EA 5FEMA 1CWUA 4N0DA 3ZWXA 1ZRSA 2NX2A 1ONPA 3LHKA 3ZDRA 2XBLA 2PGJA 3K06A 4RL4A 3V1TC 3UWOA 3X1ZA 1OXMA 3DLTA 2H5JA 3WNQA 1GTVA 4G5QA 4MTCA 4R8KA 5LOVA 3ASZA 1IUPA 1R3JC 4X3PA 1R10A 2XHEA 5AVJA 2YNMA 4KKXB 2ZJ3A 4L15A 2FKAA 1PZMA 1YR7A 2WSSD 5LNK1 3DC2A 3FNGA 3IUEA 4AIIA 1X1CA 1C7ZA 5KTKA 3RBZA 3ZVKA 2YDYA 1TQ2A 4Y67A 2I3AA 4CG3A 3IEMA 1RZRD 3W0LB 5BQ3A 2HQ1A 3FPEA 4MQ5A 3VGPA 1ZS9A 1TVKB 2BSKB 1CRWG 3HKBA 3P4YA 4GLLA 5K8LA 4MQMA 4NJOA 3K4QA 4RY9A 5ECWA 1YDHA 1BJTA 2W6IG 1FFWA 1GQFA 1GPH1 2L69A 2MMCA 4K6MA 1ZUWA 3NG1A 4YRLA 4ZRNA 4CDRA 4QQNA 3K72B 1FP2A 2ZRMA 3ZWKA 1V3QE 1E3LA 1W4LA 2V8BA 3WG7C 5JHGB 1C0LA 4IDDA 2WOOA 1SQ0A 1QK3A 3GBSA 3ZY5A 2W2OA 2HLPA 8ABPA 2P9JA 3V8PA 1OV9A 2FMIA 3TD6A 4ILKA 3T4DA 1K7FB 1WXIA 1PTJA 3FCXA 2KB0A 3FNQA 1GKKA 2YHUA 3HP4A 4N0QA 4UUAA 1XKLA 2Z6AA 4PLWA 1I6LA 3CS5A 2I6UA 1J42A 4CIWA 4OYRA 4R8CA 4WK6A 3SQMA 2DLCX 5A06A 3A1UA 4XCVA 4W5TA 3OTFA 4F3KA 2GCPA 5BQPA 2WTMA 3QVMA 4IIEA 1NBME 1IJBA 5CB6A 2K5UA 1N3LA 3WI7A 2IPMA 3EXAA 2O3SA 1ECFA 4CV0A 5IBPA 2HAEA 3VOUA 4I5SA 2H3HA 5E2IA 1PZNA 2HZBA 2KKWA 2XA2A 2BHTA 2UDPA 4B3MB 2QNIA 3GMIA 3OEED 4N1AA 1OCCC 4WOJA 4ZCLA 4YXWG 4Q20A 2PNJA 3OO1A 1MF7A 1W4AA 4NYJR 1H6CA 1SG0A 1IJFA 1JH9A 4B6GA 1JIIA 4X0EA 2I5PO 4DEVA 1MQ8B 3RF6A 4Q1AA 4ZWNA 3NR2A 4KIFA 1AKWA 3RHSA 1TUBB 4JI7B 3AG1B 1KRHA 4DLVA 4EJFA 3WDSA 3EXEB 4R68A 4H7HA 1TZMA 3NC0C 2D62A 2YFYA 4QQ8A 4UBLA 5ICFA 5JO9A 4EQZA 2VJCA 2B8WA 3GT0A 3OR7C 1REQA 3B5EA 2FPPB 2O8BA 3N8GA 2A3NA 5H83A 1P3Y1 4NK4A 1IEVA 1YA4A 3V8VA 4RH1A 3FTNA 3T61A 2WIGA 2DYSC 2LFRA 1KFBB 2XA9A 3NDJA 4GMXA 2VA9A 4PZEA 4NQRA 5FBZA 3J7AU 4H6XA 4JGSA 1V39A 4QUAA 1OB2A 3PNYA 5EY5B 3OLWA 1XDCA 1GHTA 3QP9A 1EVEA 3E20B 3SJAC 4RHXA 4WUTA 5IF9A 1X9IA 2BHRA 2GARA 3BWXA 4G97A 4MP3A 2E4ZA 3JQ6A 2FX2A 3RC3A 1G9XA 2W2LD 1XX6A 5BSGA 2H1WA 3PK0A 4LF9O 1OW3B 1RQGA 3JALB 3PX2A 5AKKA 1XC7A 1X7ZA 2CE2X 4OL0A 3ZIAA 4UTXA 3F8TA 1AVTA 1GGHA 4E70A 3LUJA 2P0AA 3I12A 2IJHA 1VMEA 5H1YA 4WWHA 1VE9A 4IBOA 3O2QB 2JS5A 1PW7A 1M1KH 1L1RA 2FU5C 3L0SA 3F97A 1TZ2A 4MLPA 5JCOC 4OATA 4EX6A 1XPRA 2P9GA 3OOHA 2AX4A 1SKYB 3WL4A 1QHEA 2UXXA 1LSOA 2ZRPA 3GVPA 5JQGB 1FOEB 1PWEA 3CCCA 2CEKA 5U4QA 2OXCA 1S4QA 1VIBA 2ADOA 2AD5A 3I83A 4INOA 4A7PA 5JJBA 3EY4A 1UXHA 1Z0ZA 1ZZEA 3SXUA 4F3YA 5IM4A 3B85A 4I81A 1SZJG 3DNMA 1IXMA 4HDRB 1R4NB 5DN6D 2ZM5A 4NC9A 4KBFA 3AINA 3DULA 4K05A 5F2OA 3HDJA 3PXBA 4P0TA 1DRVA 2AHZA 1HR0O 1HW7A 1MRNA 2P5UA 5E6SA 4RK6A 2ZUTA 3U3KA 4QT4A 3NU1A 1T43A 4CT5A 2P1RA 1P6UA 1QK5A 3NVDA 2B4QA 3CRAA 3DDWA 3PWSA 1SQ5A 1MOZA 3I4CA 2E89A 4WK4B 4XQ9A 1EESA 1JPUA 1KD1W 3CN7A 4EGAA 3LDTA 2K87A 4C0BA 2ZCVA 5FLXA 1UFRA 3MELA 1NI4B 5ABPA 1I1OA 2LBPA 5CMUA 1J8FA 3WMWA 2BN4A 1Q3TA 3HJGA 2QTZA 2CNNA 2ECQA 1HZZA 2J6IA 3RVPA 4JCCA 1UF9A 1A72A 3UUEA 1XZKA 3M2PA 4OJYA 3N3AC 1IVYA 5K6AA 4RKRA 1XV5A 3K70C 4TMFA 3F71A 4IUYA 4DJJA 1C4WA 1JX9A 1GZ5A 2DG2A 2J31A 5HE9A 5TMDA 3RTCA 4O3MA 1XQ1A 3IH5A 2BJHA 4AICA 1AP5A 1VDZA 2WTEA 5HMLA 1NUHA 2V3WA 5EE9A 2Y67A 5TLSA 3EK2A 3PS9A 2H00A 3V2IA 1UANA 2XOXA 4ZQGA 3UWPA 3TMYA 4JI4O 4GDMA 4R6XA 2WF6A 2GF0A 2WYIA 2J0UB 1IPHA 2QTHA 3KR0A 5T4FA 5K1ZA 1G20E 3O4JA 3L18A 2C98A 2ZRCA 3W8NA 4F86A 1JJ7A 1JP7A 1ZC3A 2BFBA 4J7KA 1APBA 2J3QA 3CCLV 4C7OB 2VHXA 2CYAA 4AWXA 1VLZA 3DWGA 1B3QA 1R8YA 2C04A 1A9OA 2GSDA 1QDUA 3FX2A 2B20A 2WWGA 1E8MA 3KQQA 4JB3A 4NYIQ 4EJ6A 2W8BB 3A9CA 5IWAO 4QXMA 3EORA 4NX2A 4BL5A 1X7HA 2EFDB 1TUEA 3UHAA 3HKBB 3HRKA 4O33A 3RG2A 3KFLA 3KVNA 1MZVA 1PGPA 3IGAC 2CHSA 3ZOZA 4V0QA 5JY1A 1YJCA 3VHQA 4PZLA 4DR3O 2ZNIA 4CLEA 5FJIA 3GLSA 4UDXX 5BQOA 1UZNA 3MS4A 3VR1A 4GPTA 2C61A 1N5KA 3KQNA 1IE3A 1XEXA 1MC5A 5CBGA 2V6GA 1EGMB 2DUWA 2X14A 1PP9H 3L49A 3QVTA 5HS6A 5JI2E 5LLTA 1ZR2A 2I33A 5IZCA 4A0QA 1O9HA 3DDHA 4HDMA 2YZNA 1G3RA 2H9IA 1G41A 1QIDA 3VTZA 2XAAA 2YYZA 5JAPA 2GLXA 4OLAA 2NW6A 3GEDA 4ZP1A 5CBHA 1DWQA 4UDNA 2W0XA 3E8FA 1BZKA 1R50A 3ON1A 2VDQB 5HUQA 1IXKA 2BBWA 3AXTA 3SCZA 2CB0A 4EZBA 1DTWB 2PBRA 3QO8A 2P35A 4G5XA 5EHZA 4CN9A 3EFOA 1NUSA 1VQKF 2ZOSA 4G0XA 1KSGA 3H86A 1KC8W 3S44A 2RD2A 2H6EA 1WMDA 3ESCA 4NATA 2FUNB 1PGNA 2GZ3A 2UUAB 1FXVA 2CGEA 3SXUB 3QSYA 3P3NA 3OOWA 1YJ9V 4ABMA 2ZVPX 3GBVA 5B6PA 4JP1A 1YZLA 4MPPA 4AS2A 2CC2A 4LJYA 4JB0A 5EHIA 2ISSD 2BM0A 2GPAA 2BEVA 1U28A 4JGIA 1O95C 5GQSA 4AF7A 5FTLA 4X89A 1Z6QA 1XNRO 1TYEB 1G5HA 4PA3A 3SIVA 1J20A 1TIKA 3MCQA 1IG0A 2CXOA 2JLSA 3K8OE 4UHEA 5IKOA 1I7QB 1QFZA 1Y1TA 4EDFA 1C0IA 4Q3OA 3PIDA 2Z56A 4V0OA 3F0EA 2G1KA 1BQEA 2ROQA 2EKBA 2VEOA 3AHJA 1ZL8B 3EB9A 3W6OA 4C21A 2VYND 2LUOA 1K5PA 3TRFA 4PDLA 5HWEA 3GQBA 3T5MA 5BYJA 4YT4A 4BIIA 1RZRA 3PUXA 3IA2A 4NZZA 4EELA 3CX5F 3NTLA 1PJSA 1GTZA 4I1SA 4X00A 4ESEA 4QDOA 5BNFA 3OZ7A 3PR3A 1JEDA 3NP7A 4ML3A 3WYBA 4EKYA 1L5RA 2ADFA 5JFTA 5M34A 3AG3C 2ZDIA 2GTPA 4UBIA 1XBIA 1FDTA 2IX3A 1TJNA 2L82A 1JQJC 1ZM4A 3KSRA 1OPXA 1WWKA 4L3OA 5CFOA 3ZV6A 2VUIB 1YE5A 2RGEA 3E3NA 4HXFB 4XQGA 2P79A 3BQNB 2WUGA 1VQ1A 3RRMA 1CR4A 3KPUA 4JJEA 1M8FA 2DBVO 3PGLA 1DQPA 1UT6A 2C07A 3Q7QA 3AIKA 1X1RA 1BAPA 1Q7CA 1MG5A 2IPXA 2NZUG 3QMMA 4ND8A 4N47A 3VC3A 3LTNC 1DB3A 1FFGA 1P2FA 4IYHA 4K81B 1UPXA 2VDUE 3DBIA 4FLMA 1KJ9A 4TQUS 5T8KA 1F38A 4DMRA 4D0SA 1XTVA 2Q4RA 3JQ9A 1CJSA 1TMOA 2R62A 2Q0HA 1YR8A 2QYOA 3GRYA 3Q6MA 4KDCA 4NTYA 1Z0SA 3M6UA 1HLGA 2AMJA 1GU1A 1GZSA 5K2MA 3USCS 1VF5B 3D36A 2W90A 4JFRA 5FX2A 2AT1A 5A71A 4BC0A 6LDHA 6Q21A 4R6WA 3C3PA 3DZCA 2QVZX 3GMDA 4D56A 1JDNA 3BM5A 1USKA 4B3BA 5KC9A 1JVMA 3OSZA 4KR2A 5HOQA 1N5MA 4TWBA 3MHSC 3V4RA 1WVGA 1N7JA 1U2DC 3ODGA 5CDYA 3PNMA 4KSYA 2D3TA 1VBMA 1PGQA 3SJBC 1T36B 3RVYA 3KFVA 2NUTB 5HJ2A 2FR8A 3BK7A 1XR3A 3BMOA 3GEMA 1PZGA 1G3MA 5T4EA 4DXAA 2CZQA 1E9SA 3RA6A 2QU7A 1BWQA 4L4UA 4MYTA 4F7DA 1QP0A 2P1DA 3TAXA 2IH2A 5EZYF 2QW1A 5TVGA 3NCHA 4NTWA 4XWOA 1E1MA 2AD1A 2W93A 1I4LD 2ZF8A 3CSDA 4X60A 2ZIUB 2IHZA 1QGDA 4TRJA 5B3JA 5DVZA 3LOQA 4AO8A 4C4TA 5FLXN 4FC7A 2VWKA 3PZBA 3F9CA 4F72A 3QFHA 1JR4A 2I2FA 4MTXA 1ZAUA 3CZMA 1UK9A 4L5BA 1Y3FE 1R0YA 1THMA 3CBQA 1MGPA 5A0FA 1FRVA 2WHRA 5FL7G 2WJVA 2PHNA 1QE5A 4FZ3A 2QA4V 4GBJA 3EUAA 3OCZA 3W5AA 2Q3CA 4U2GA 3RH0A 4QU8A 4CV3A 1U3VA 4PBSA 3PRKE 3HJWC 2AFHE 3TKYA 1EUYA 4R7CA 1TJ3A 1ZWKA 5AO9A 5KNBD 4OXKA 4YMWA 3JYNA 4MUHA 3UMBA 1G6OA 3GWOA 4ZXPA 4RTMA 1TDJA 2I6SA 2PS0A 2DBYA 1QAHA 3O8BA 3RIHA 2ZSIA 3MN1A 3RBXA 1U8XX 3M2TA 2NYVA 4UNIA 3GPDG 3RHZA 3RTGA 5I9IA 1O4WA 4OB8A 1AROP 5TXGA 1VQ5V 3KB2A 3E27A 3LA6A 1FMCA 2P78A 4EFMA 4G0YA 2L17A 1KVRA 2QN1A 3WIBA 2G04A 4IOLA 1O89A 2QUJA 2ZI5A 3MS2A 4FINA 1YI1A 1Y4DE 3OQHA 3N2KA 2ZAUA 1YNOA 2ZIWB 1DEXA 2CLFB 2VC2B 5IYZF 3I9MA 1H3EA 4J0QA 3HU5A 5JR3A 2YN0A 1QX3A 4AYXA 4S0XA 4WCVA 3I6ZA 2XCOA 1G8PA 3R3UA 1US8A 2WE7A 1JHRA 1HLFA 1XI1A 3KBBA 3F6PA 4OJKA 4QUEA 2OIEA 1IX9A 1F6WA 1MW9X 1Q12A 4HGPA 4ACBA 2OZPA 3QWIA 2DYYA 2D5BA 4RQBA 1DC8A 4BNJA 1YGYA 3K1AA 4RA9A 3UVEA 1LSJA 1XIVA 3LW7A 4HRYA 4U2FA 1W76A 3IOEA 1QFYA 1LI4A 1M8JA 2OHJA 3ML1A 1WMEA 5CRIA 3G7SA 4TUYF 3BWMA 2NLJC 1JALA 3T3GA 3WNBA 5JH7B 1ADCA 1Y9DA 2JFOA 1SH7A 5KAPA 4C7BA 2RHLA 3I39X 1Y81A 3P5BA 4TRRA 4RHTA 5JJCA 1YJNF 4K9PA 1H2AS 2KTUA 4V2UA 5TS2A 4CGYA 2VQEO 3SZ3A 4JOCA 5C5IA 5M7EA 3DZFA 4OA5A 4U1RA 3SSNA 5CCXA 1H48A 2G1UA 1JQDA 4TTVA 3DYVA 4J1TA 1WDKA 1P4AA 1AG9A 3EF3A 1IATA 3LS2A 3QLVA 3I62A 1PX0A 1RWMA 2H1VA 2EYQA 2WG2A 1NNEA 1UJWB 2ZVDA 2VZ8A 1U2PA 3ZE6A 4PONA 4DBZA 1FUKA 2B7BA 3FDFA 3T9CA 4NZNA 4Q9IA 4FMTA 2O8DB 2G6TA 5CVEA 1H5NA 5K3EA 1PWHA 5JWHA 4V1CI 2QORA 4FFLA 4CNBA 5KC8A 2G1AA 4B7XA 2V9CA 1DUVG 1D2CA 2MYUA 2DFKB 5BW6B 4Q34A 4G2KA 4N76A 3EQ2A 3ABTA 3S02A 1YS2X 4LR3A 1TT5A 2YHBA 4GGMX 4DQDA 1HDIA 3HJBA 3PICA 3C5CA 1JSRA 3C6MA 5HFNA 4NKRA 2QM8A 1UJMA 3BGDA 3HY4A 4X62O 3I58A 4GUAA 4KGZA 3AJ8A 3L72H 3G6EV 4RSHA 3JPWA 1BE6A 3G8DA 3H16A 1R16A 3ROZA 4AN1A 1LBQA 2XAUA 3TB4A 2X7RB 4JYCA 4S35A 2Y9PB 2FG7C 5DBGA 1R1BA 3G0OA 3KB6A 1VQ6V 2BH9A 3AUJB 3KSMA 3QW4B 1R3DA 4ZVRA 1DOHA 4FZ1A 4N48A 4CM6A 1ZVKA 2QTVB 3MTAA 2CTWA 3H9VA 2KS6A 3HA2A 4DVJA 3RYFB 2ZXFA 4HT3B 1UBOS 4O4IF 5J43A 3OOSA 4CL0A 4Y9RA 1E1QD 3FPJA 4OGFA 2FQYA 4Y0VA 3ROKA 2CBXA 1EZZA 4AJHA 3BULA 4XD7A 4ESHA 1LI7A 3WVNA 3FI9A 3HJUA 2BOCC 2V65A 3L8EA 4YAKA 5ISMA 521PA 1OXXK 1BHAA 3ROXA 1EZJA 4EJSA 2DWDC 1L3IA 2X3UA 1PWZA 2J5QA 5HR5A 4BIOA 1S2MA 1NDHA 4BR6A 3B6EA 3FZYA 3QU7A 3SU8A 2QR3A 2QTBA 1LK7A 4IQGA 1S89A 1P3DA 4X20A 2C3YA 2ODWA 4ZO4A 5C34B 2A9HA 5HFAA 3K0DA 1HMPA 1ML3A 1W9HA 3ZCTA 4H35A 1EQAA 3WYCA 4CMIB 1JHYA 3A2KA 4DZZA 1MAVA 4BE9A 4IX9A 2BV3A 1JDZA 4IHAA 4J76A 4DPMA 1QG2A 2J6HA 4HQNA 4KAAA 1Z83A 3G6WA 3AXSA 4DV7B 4TS9A 3IHTA 3RGBA 3VYTB 4JR1A 1WVIA 4N40A 5DISB 1YFKA 3UJDA 4H18A 3WKEA 4UM9B 5JDIA 5I48A 1VZ3A 3CO5A 5FTWA 1JEYB 1T36A 4I55F 1NXWA 2PBZA 1W35A 1DXOA 1LB1B 3UH0A 4K1LA 5KZMB 2GZLA 5IYDO 1FDWA 3IMCA 4O2BA 3IPXA 3NHFA 4TZKA 2YWFA 1ZX3A 3WKAA 4EMTA 1PZFA 8ADHA 3LX4A 4L02A 3VKHA 2D1FA 4RCYA 2O0HA 3KKEA 3LU1A 2ESRA 2X8JB 4JELA 5FHRA 1SC5B 3U7HB 2O50A 3ZGOA 1XWFA 4IINA 2H2DA 2VCYA 4JTCB 2PUDA 2J0VA 3ME5A 4ANFA 1Z9BA 5A3RA 1KYZA 4OHFA 1SJ9A 1XNHA 4GX0A 5LUAA 1DMRA 1XEAA 4OMFG 1Q86W 4A8JC 5CNKA 4ERXA 3NVKI 4OKNA 3RVKA 3V1UA 4N5HX 1T25A 2PLRA 5CBKA 4D8UA 1BHSA 2FR1A 4JGGA 3PN1A 4X95A 4MW2A 3RVBA 1T34A 2DN9A 4FJ1A 4QPZA 3IELA 4Z0HO 1PCXA 4YAGA 1NQTA 1GO0A 1Y5MA 2IIQA 4HWRA 2FPXA 5E8RA 3FWHA 2GN6A 3BQMB 2OYCA 4ZVVA 5FI1B 3BFKA 2V54A 1QU9A 2OLJA 3L84A 4H44B 5LZ5A 4BLPA 3WADA 1VKRA 4HN2A 3OG9A 3DT9A 2HQOA 2CUNA 1A76A 4A0FA 1VHJA 4GXRA 1YRYE 4GKJB 1AO3A 1VL2A 1R8XA 3EMBA 1P4RA 2P65A 1NXQA 3ODPA 4ZYVA 2DQYA 3IR7A 4YRMA 3MHTA 1W1IA 1Y8RA 3CLUD 2RE8A 4G36A 3Q4HB 1F4NA 1N6KA 2ZCUA 4TTAA 1IEWA 2LFSA 1YRWA 1IBMB 1S0UA 3QKUA 2COKA 2FZGA 3HQ4O 3BAZA 3NHYA 3UIEA 4MPRA 3W34A 2BKXA 3ZWVA 3ICXA 4DXHA 3U16A 5D86A 1D5WA 2WYVA 1CB7A 3NBYC 3U4DA 1X42A 3EPJA 4GI3A 1BDHA 1CRPA 4XWAA 3HKCB 4UPVA 4NPHA 1SQXH 1BEEA 3IP7A 3SQNA 4EPTA 5J47A 4CS4A 3N4ZA 3W2FA 1Y6RA 3KXKA 3LXMA 5IKXA 3TDNA 4C0WA 3OAAD 4C08A 1ISGA 2F3PA 4NNOA 1IHOA 3MBIA 1NLMA 1XN1A 2OCYC 3I1JA 3N6VA 5ALIA 4ZI7F 3SYPA 2UUCB 2IIVA 5CYFA 5FA6A 4FM9A 4W6ZA 4WW0A 4QE9A 4KZPA 2G82A 1OXKB 4TT3D 5E3HA 1C0KA 3ORYA 1AK2A 1JR3D 1K68A 4LGCA 1LCIA 3TBHA 1AE1A 2YNMD 1BJRE 2EJTA 4K7JA 4E6PA 3HFRA 2C3OA 2WF7A 4G5YA 4PINA 3LTEA 5GAJA 1RYFA 2WJZB 5GJWC 1U5BB 1COWG 5BVHA 5JVDB 3OWHA 2A0LA 3ABMC 3CIOA 4G1UC 5L3DA 4FCCA 4H4DA 2JGRA 3GGOA 3FYUB 4ZJPA 5CXXA 1N8TA 4FEYA 1BGXT 1GRNA 3UHOA 3GCWA 1UWKA 3HN6A 2X13A 5AR1A 3TH5A 2OGTA 1Z2DA 2F93B 3QTCA 3DNFA 2WWVD 3UUFA 4ZDJA 4BY9D 1SZCA 1RMQA 2F48A 4ALMA 3QNMA 3B9BA 2JJ2D 2XVYA 4UHJA 4CF4A 1L9XA 5COAA 2QRVA 3HXKA 4PSVA 4ZFNA 3DTUB 1DFIA 3LW8A 3PPXA 3ZKWA 2CYBA 5FOSA 2DT5A 3DW1X 4IV8A 3UK0A 1R64A 2XGGA 1YHQV 1CUVA 1L7MA 1MA1A 2FWJA 4TLBA 5A6VA 5BSEA 5JXIA 1ZOLA 3O4HA 5L3ZA 1VIDA 2EIMC 3SYAA 2AG8A 4H0LB 1ZIPA 2WG1A 4O8CA 4RZHA 4JR2A 2A5DA 2D06A 3H6GA 2PUFA 1WZ2A 4MS1A 4IJMA 1C1YA 5E6UA 4AJLA 4EKGA 2BTUA 4J0GA 3OSUA 1H2YA 1CJBA 5HYVA 1LTKA 1E2PA 4WPGA 1KJ8A 1XVVA 3K4HA 1KMQA 1CRLA 1KBQA 1OFGA 3OPYI 4LOIA 2WJPA 3D3QA 1AUVA 1QVVA 3ZHUA 1GU7A 2W6CX 2XMCA 1QCCA 1XDWA 2Y1XA 3A4IA 4N3CA 5B1EA 3KPYA 1R5JA 1DV1A 2F9MA 3FNFA 3QVWA 2XAFA 4WI1A 4DMHA 4DZRA 1H2LA 4KBYA 5IAAA 5IVHA 2DLDA 4F4CA 1FXHA 1K6IA 1MT0A 4YQFA 2H51A 2R72A 4MVJP 5A6SA 4LZOA 4BJ5A 4KIUA 3WZLA 4RWZA 5IABA 2G88A 3UAYA 1K9SA 2WLTA 1SUEA 1S3IA 3D0RA 3FZQA 2YV5A 3LD9A 1MGOA 2XTJA 3AP2A 2VIIA 4I9QA 1BEUB 3V1LA 2P11A 5BN4B 2F67A 3MIZA 3ZP4A 5EXDA 3K5MA 4EO7A 4ZO9A 1JLLA 3Q15C 2X1MA 4GX1A 3QEBZ 5ECGC 1XZEA 4M9RA 3E5MA 2C5EA 3RUIA 2K2WA 3WLKX 3FZGA 4NDNE 5MGBA 3OTHA 1W9MA 6REQB 1NM5C 2Z2KA 2NVOA 2P30A 3WWYA 4WNYA 1XMOO 4YP9A 1RXCA 3DV2A 1ZH4A 2BP7A 2GBLC 1S1CA 2XUFA 2OCCC 1NVGA 1NMQA 3H01A 3G0IA 7GPBA 5F3RA 3FPHA 3QUWA 3RAPR 4OOFA 4DCSA 5ALNA 4YCDA 3HKCA 3OT1A 2Y66A 5ALYA 5KREA 2YEVA 1GAXA 3L5OA 4D9MA 3ZJUA 2LJ2A 2IYFA 4E33A 1E6CA 1HDCA 1F8UA 5AW0A 3PXUA 5AM3A 2RHWA 1JHZA 4GP9A 1ZQ9A 3BRWA 2JEXA 4LRYA 5C31A 3UAWA 2QUKA 3CRZA 3GRUA 4TTJA 5CPBA 3S0WA 2NSYA 5ARDA 4L8GA 4Y9DA 3VU0A 3W8RA 4X64B 1CQIB 2D2EA 2YICA 2QTAA 4GMGA 1FDRA 1GA6A 3BE8A 4WNIA 5LLSA 5JTUA 1LUWA 2XB2A 3QHQA 3C4QA 2JKYA 3WJ2A 2AE1A 5BWMA 2I6DA 3KS9A 1O5TA 2DWEC 1J7JA 1CULC 1WPXA 1L1FA 1NMUB 1X52A 3BAAA 1NAIA 1P72A 2B34A 2AGAA 4J11A 1X94A 2CKMA 1NVAA 2EGUA 1CQJA 2Z09A 5J5CA 1K7SN 2ZG6A 5CITA 1Q43A 1QV9A 1L2TA 3MBOA 4Y2PA 3AUYA 2BAGA 2JGDA 1PTKA 1NA5A 4R7GA 4D0NA 1E18A 4FQ7A 1JI3A 1RT9A 5LD2C 4D9JA 2HTEA 3WKDA 3T1QA 3MTQA 4AS3A 2QP4A 2EXXA 3CINA 4UOQA 2YS6A 4GKBA 3BD8A 4MUIA 4JL5A 3VZDA 2BSXA 4IJQA 4BO7A 1CVIA 1A7KA 1CDOA 4G0NA 1SC6A 4RADA 4WESB 3ZEAA 3F3YA 1NBIA 4IEIA 4CT0A 4KP4A 2WPDD 1II8A 1NQUA 3F5SA 3FFXA 4QGAA 3O9OA 3PLAC 1NOJA 4ZT6A 4YEDA 4R31A 4X7MA 2CLOB 3WWEA 4MVX