5BNQA

Crystal structure of hrankl-mrank complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
156
structure length
156
Chain Sequence
b'AQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor necrosis factor ligand superfamily member 11
publication title A RANKL mutant used as an inter-species vaccine for efficient immunotherapy of osteoporosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 32
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bnqA00
2OIIA 1TNFA 2RE9A 4G3YC 2HEWF 3B93A 3L9JT 4OUSA 3IT8A 4KGGA 4D7YA 1XU1A 4G4FA 4QQOA 2RJKA 2Q1MA 2Z5WA 4KG8A 2R6QA 4QQPA 1ALYA 3K48A 4QQHA 3TWIA 4MXWA 4MXVA 1O91A 1OSGA 1OQDA 1DG6A 2JG8C 1D2QA 2ZJCA 1KXGA 1PK6B 4NN0A 2JG9B 4OUMA 2RJLA 1U5XA 3URFA 2ZPXA 1D4VB 2E7AA 3V56A 3QBQA 1RJ8A 5TSWA 2JG8B 1XU2A 3WD5A 2R30A 5L19A 5KC6A 3B94A 4TWTA 1GR3A 3B9IA 2QE3A 5CIRA 2Q8OA 1C3HA 2WNUA 4GIQA 1JTZX 3MI8A 1U5YA 2WNUC 3AB0A 1IQAA 1WCKA 4E4SA 5L36A 1KD7A 3FC0A 3ME2A 4F3JA 4HT1T 5KWRA 4QQLA 1C28A 4KGQA 3QD6A 2WNVA 4MXWB 1OQEA 1D0GA 2WNVC 1PK6A 2R32A 2JG9A 1RJ7A 3ALQA 1S55A 4TSVA 1DU3D 4DB5A 2TNFA 5BNQA 4OULA 4QQ2A 1I9RA 3TYJA 2WNUB 4QPYA 4DOUA 5HBAA 1A8MA 1U5ZA 2HEVF 1TNRA 2JG8A 2O0OA 1JH5A 4RSUA 4EN0A 4N90A 3K51A 4E4DX 5KC5A 2QDNA 2TUNA 2KA3A 2AZ5A 2WNVB 2X29A 2HEYF 4MSVA 3LKJA 4J6GA 1PK6C 2JG9C
chains in the Genus database with same CATH superfamily
2WNOA 1F5FA 1VALA 1DF0A 3MLKA 4HLTA 4NWVA 3WCRA 1RUOA 1ZZ7A 4XEZA 2XHNA 3SEEA 2G9FA 5AVPA 1DGWA 2K9ZA 2W1QA 4NPLA 2C4XA 5GZCA 5I91A 1W0PA 1VBC3 4LTAA 2JEMA 5F5QA 5IVFA 3FBYA 2G4IA 3PLQA 3OSDA 5JPMB 2JE9A 4XDPA 5FY0A 5JOXA 4LITA 1NCQB 4Q29A 4O65A 5JVVA 3AKQA 3CKHA 1WMDA 1OA3A 1PGW1 2KD7A 1YIPA 1GOHA 3GGLA 1NOVA 1OF3A 5LA9A 3WV6A 3ZXDA 1UYPA 4DEVA 1W8HA 3NKTA 3WSOA 1EV11 1QOOA 4ATFA 4NHYA 3GCXA 5L7OC 2HWC3 3E97A 3RQ0A 1R082 1FMD3 3QLQA 4QPWA 3LFMA 5FLJA 1LB2A 3GHNA 3HMYA 1U5XA 3KLSA 1AR91 1ASJ1 1HQLA 2HBUA 4JHTA 1HW5A 2HYKA 3CLPA 1PX4A 2VVFA 3I3BA 2DFCA 5CBLA 4BXFA 1W8ZA 1AYM1 1ZBA1 2A7AA 2JE7A 1L7QA 2WO2A 2ZHLA 4FPHA 1SEFA 5A7WA 4HZFA 1W9YA 2VU9A 4V1PA 2NLRA 2VUCA 3NQHA 1JS9A 1R1A3 2FQPA 1PIV1 3ATGA 3PNAA 3POWA 5FZGA 4DEQA 2XONA 4XJ9A 4E8DA 4RGKA 2OQ6A 4CCKA 3ON7A 3JB4C 4RL7A 1MS5A 3OOXA 4MYEA 5HCHA 5EJZB 1DQ4A 1HKDA 5DUVA 5FO8B 1LJ7A 1JTZX 4HKWA 1IQAA 2B39A 3J7NA 4A6SA 4JGYA 4UFJA 2VNOA 4UW6A 2WA4A 4CDQB 3VBFA 2L9LA 1C28A 5ACA2 2EAAA 2RHPA 4QGNA 2WNVA 1S0BA 4MGKE 1VBA2 5A6QA 5KXEA 1JYXA 5H9SA 2R16A 3LOIA 3POGA 1XRUA 3ZDSA 1MEC3 1SLCA 1HRV2 3FUOA 5IT6A 2E31A 2ZGKA 2JDHA 4OUEA 3BU0A 3NSTA 3RMXA 2CGNA 1RUH3 4M01A 2WWJA 4ZPIA 1TEIA 1IZ3A 1PX3A 1FT9A 3AP5A 4B29A 1OKQA 2VOKA 3AMQA 3E6CC 3K3OA 2AH2A 1DZRA 1FOD3 3ECQA 4WZCA 2XL9A 2C6SA 1FV2A 1UF2C 4GWNA 2O0OA 4IE4A 4UWDA 3RI8A 4WVZA 3TAYA 4B4PA 1A3KA 4Q4Y3 4E4DX 4LLFA 1OT5A 1OLME 4AQTA 4EJRA 1EUTA 3OPWA 4AVTA 4YARA 1ZBE1 2D6MA 4YGDA 1Y43B 1QJU1 3USUA 3WQ1A 1X8MA 4YW5A 1MQTA 1ZNPA 4D7YA 2RS51 1N1YA 4LHNA 2GP5A 1W6QB 1BBT3 1RUG1 2VW2A 3MICA 4Q0QA 1RUC1 3FE5A 3JQXA 2JECA 5FWEA 2C1FA 3GZAA 4NIGA 4XF0A 1G9CA 1ALYA 3ILFA 4ZU5A 4CP9A 1UO9A 3RSJA 1OPMA 3UT0A 1EAH3 5JOZA 3I3DA 4D6RA 2XUMA 3DXUA 1JZ4A 1AR71 1CESA 1DG6A 3WP5A 1J3RA 3MFAA 1Z7S2 3TN92 2A71A 4AFCA 2DVFA 1D2SA 1NT0A 4AZZA 5FYSA 5FYUA 1MZ6A 1YCIA 1RL3A 1S2EA 1RUI3 1U12A 4IEUA 5CAZA 3A23A 2ID4A 1CIYA 4XJAA 3LOBA 2CGPA 1W39A 3C7EA 3EO6A 2D3PA 3RWNA 3KMHA 5FZOB 2E7AA 3MIBA 1TVGA 2VNRA 4HVOA 4BOWA 4PHZA 2AUYA 3E6BA 3R05A 2UYAA 3WLUA 4AFBA 4CP1A 1OKOA 2VBPA 3MF6A 4W4ZA 5IK5A 4Y5TA 1MS4A 2XLGA 3AJYA 3WG2A 2WNEA 5DABA 2VH9A 4JC1A 4INDA 4I0AA 3I2HA 5CB7A 3VKLA 3WDVA 3WQBA 4FQ4A 4JRLA 2XWBB 2VZUA 4XVHA 4Y22A 2WKKA 3ZMNA 4A42A 1HRI1 2IFRA 3V0AA 3O1TA 2Q4SA 3N9OA 4FBFA 2BBVA 1J3PA 2J1RA 3MZHA 3P5BA 4WVWA 4NRQA 1XPWA 1IS5A 2ZX0A 1T2XA 3ZN6B 1AL23 1GV9A 4XF1A 2K0GA 2G19A 2Y6HA 2FDJA 3I2FA 2YHJA 4BQWA 3WF3A 4LUKA 3CJIB 5EJ1B 5DUUA 5K8SA 5JPNB 4MG2A 3O0XA 5H9RA 1GZCA 4XYXA 2RM23 1SLIA 1KQRA 3KS7A 4QQ2A 1YO8A 2A75A 2O8OA 3MW3A 1NAEA 1ZRRA 1R092 2OS2A 2XKOA 3VN4A 4RFRB 3SISA 4Q8LA 5FR3A 2GAUA 1UMHA 1V6JA 2J1VA 3KV9A 3ZFFC 1H8TA 4XXAA 5FZ4A 2CSGA 2VULA 2FDIA 1JMUB 1QJY3 3WF2A 3O1PA 3K51A 4AVCA 5F1RA 3ITQA 4FVVA 4K20A 3SEPA 5GZFA 2QDNA 2D3RA 2P6CA 5BNNC 1UOGA 1OLQA 1SG3A 2JJ6A 3R0RA 4LO4B 5FUPA 1J58A 2PHRA 2WO1A 1RMU2 5C5TA 1W6OB 5J37A 4LKDA 1BQPA 4DIQA 2I07B 3JD72 3V64A 3ZYRA 5KHIA 4ZXEA 3HN1A 2WR9A 4O9EA 1LRHA 3N9QA 1NXMA 1WBFA 4IGQA 1XNTA 3LDBA 2HWB3 3D6EA 2MEV2 3GNEA 3GJBA 5FYVA 3FHAA 4ISRA 4XABA 1YJKA 4TLFA 4UFLA 2OZJA 2VUAA 5A7NA 2D97A 2VZPA 1QJFA 3EHKA 1WZXA 2D6PA 2W39A 5LBFA 3WP4A 1SFNA 1QF3A 4Q0UA 1MACA 2CL2A 2WS92 3AMPA 2RG4A 1PNGA 1RHI2 1W3VA 5F32A 2IC1A 4XHXA 2ZAAA 3P3PA 4QX3A 2H0VA 3ZO0B 3OPTA 3ZKYA 4IGPA 1DYPA 3I2DA 4PF5A 1KS4A 1W0NA 4ITCA 3N4MA 1OA2A 1HJFA 2WRAA 3MW4A 4DY3A 2E53A 2O8QA 4F8AA 4YPJA 1NY72 5ACA1 1SCSA 4LE3A 3WQ0A 3I7DA 1UZYA 4DXSA 3DYMA 1XYNA 3DYPA 3POBA 2VMDA 1VBA1 1NG0A 3FFZA 5A7QA 4ES9A 3POSA 2C26A 2XJQA 1HRV1 1XOYA 5HV4A 4CCJA 1R64A 4D7SA 5FYHA 1TQ5A 1OXCA 1QDOA 5DAQA 1EY2A 3M3CA 4WM8C 4LOSA 4S2HA 2DUOA 3TEXA 3VLBB 1UYZA 1HXS2 5L19A 2XJUA 3AYEA 5I0TA 3BPSA 4OLLA 1SZBA 4IEYA 1AX2A 3UKNA 3WR0A 4E2GA 4YW2A 1PO23 1JN2P 2B8MA 5L7OB 1SMVA 4FFGA 4IEVA 4XIKA 3LPFA 4GIQA 4Y24A 1RUF3 1O8SA 5I8TA 1Q43A 4B1MA 5C33A 2V4AA 1WMXA 1WLTA 5GLWA 4TTGA 5JAXA 4C1WA 4PIXA 3SQOA 4OHWA 3UGHA 2YU2A 1POV3 3ZXKA 5FK8A 4E2SA 1NCQA 3VKOA 5L9RA 1ENXA 4Q4X3 3O1UA 4FXKB 4E2QA 1JUIA 3THCA 1BYHA 3L2HA 4Y26A 2ZS6B 2J22A 2BRTA 2ZGSA 1IKQA 1AR81 3BN6A 3Q8AA 4AI0A 5LASA 4I09A 2R073 2VGDA 5GALA 3VBHC 4XQWA 4L0PA 2F6BA 5J96B 4XUPA 2RJ2A 4OULA 3ZXJA 1V9U2 3I2GA 3LWCA 4W6WA 5FFOC 1GU3A 4GWIA 3T09A 4R9CA 3MV11 5JIAA 1B09A 1H1IA 2Q30A 4U36A 4ZZ8A 4N53C 2PTMA 1RUNA 2CY6A 1NLQA 2BVVA 4Z2WA 4LE4A 1V0AA 4NROA 1Z7S1 3TN91 1JH5A 1WCQA 1XNAA 5FV3A 1W9TA 4GB32 3BTXA 5KC5A 3V65A 1W2OA 3RZJA 2X53S 5FZKA 1OUXA 2EIDA 1O59A 2KM2A 2X29A 3PUAA 1QU0A 1BJQA 4E8CA 3ZN4A 1APNA 3KT1A 4OVEA 3U1XA 1YQ5A 3KF3A 3POIA 5BY5A 4L97A 2EF6A 1BEV2 2XUEA 2YC0A 3WNPA 1N3PA 1GYKA 3BYWA 1B35A 3AKRA 3H3ZA 3J7LA 4JTNA 2XJTA 4LNVA 4RR3C 1Q8QA 3CZUA 1ZZ9A 5C3OA 4XIOA 3ZLIA 3K48A 5FP4A 5FY8A 3LEIA 1W2UA 2JDZA 2GN7A 3MDPA 5FY7A 3UKVA 2O14A 2GMMA 2G9GA 5DG2A 3ZXEA 1OVPA 1SBFA 1D2QA 2ZX2A 3T1LA 2WABA 3OB8A 4CCNA 3JB8A 3JBG2 4CCEA 5LZ6A 3BTYA 1UXXX 4JKKA 4V2VA 5F3EA 3VD4A 4R52A 2VVEA 5IVJA 4UI9L 1G9AA 2OW4A 3VUOA 4QKNA 3IM0A 3BGAA 2PLV3 3ILNA 3GM8A 4YVWC 2RVAA 3ZYFA 4IEQA 2GMEA 1OLRA 4XFBA 5EXOA 5JCTA 1E57A 5I8SA 1OFNA 4CEWB 4YZ1A 3OGJA 1PNFA 2VZ1A 2WZEA 2VD7A 3ZMOA 4CPBA 2JENA 4A4AA 5FQ0B 1RJ8A 5F8PA 4XJWA 2UY8A 5JXIA 2XDVA 2VMIA 1DGRA 3J9SA 3LDKA 4HONA 2E6VA 2IXJA 1BVP1 1QHDA 3GCWA 3HR9A 1ODNA 4MZUA 3WXPA 1QDCA 3CHXA 5IFPA 1R091 4BQ2A 3O1VA 4F7ZA 2YYOA 3SLIA 2Q8OA 2GH2A 4AEDC 5KHGA 2ARCA 2HWE3 4JV4A 3AFGA 1SQ4A 1LESA 1U5YA 2WNUC 1U0AA 1VB2A 2IXLA 2YBPA 1U5IA 1YXWA 1AR63 2BOIA 3LF7A 1IHMA 3TNQA 1XSQA 1KD7A 1REDA 3OBRA 4LBLA 4D94A 3SC7X 4FAHA 1VRH2 1XNBA 4RS5C 1RMU1 1RUE2 1O4YA 2OA2A 1QNWA 3OGRA 3JD71 2DV9A 2W9XA 3RJ2X 1UCXA 3U07A 1CD3G 4MGZE 5EYYA 4AI2A 5CFDC 4RHV3 3ABZA 1Z78A 2WSUA 3VZMA 2MEV1 4FCAA 5AVAA 5C8CC 1NKGA 1J59A 3MUY1 1V6MA 3HNBM 1RXGA 5FZ1A 5FZAA 1QOSA 1I9RA 1BLZA 5A7SA 1Q3EA 3ZFGC 2XVKA 4NUBA 4K8RB 1A8MA 1NUKA 2VNVA 5FZOA 5LBBA 4BPZA 2GALA 2XVLA 5H9PA 4PQ9A 4Q26A 2BBAA 2WS91 5IHRA 4K7JA 3MIDA 1E5HA 2BTVC 2JDMA 2ZKNA 1W03A 4P9GA 5FBZA 2CHHA 4JVAA 1DHKB 3OGVA 3MIEA 1VBE3 4HOOA 3VBOC 3ZYBA 1K12A 2CTVA 2QBXA 4N7IA 2ZGMA 4DUVA 1NY71 3H3LA 4C91A 2GU9A 3IAQA 3FMGA 3EXUA 4XZPA 1UL9A 1OLMA 4NR1A 3RZZA 2OIIA 3KVBA 2P17A 3L9JT 5DUWA 3CU7A 4ARYA 2QQLA 4QQOA 2Q1MA 4BQ5A 1UOFA 5FK7A 1KJLA 4Q0SA 4Y5Z0 3H7JA 1VMHA 2XLAA 1H4HA 5FJKA 2V72A 3CF6E 3T2TA 3ZFFB 1JZ2A 3FJSA 2OT7A 1SLLA 2VOVA 4L11A 4QQHA 2XVGA 3RRDA 3THDA 1HXS1 5JI7A 1FNYA 3OBAA 4IEOA 5D8AC 5C70A 2TBVA 1XE8A 1UOBA 4OZOA 3WT3A 2WUHA 2ZGOA 2DURA 1RUD2 4IE0A 5BNNB 3CJIA 5JOWA 1WA6X 3LA3A 4QXCA 4CDWA 1F2NA 1US3A 3AMHA 4D0QA 1W9WA 1KXGA 1WMFA 2VZVA 4P9WA 2YXSA 3PUIA 4ZONA 4QXBA 1Q8VA 5K0UC 1QQP3 2HWC2 1JZ5A 1OHFA 2C0ZA 2A3YA 1FMD2 4BJ0A 5JXGA 5FPLA 4XAAA 3KWVA 2RR13 3GDBA 1US2A 1YFUA 3OY8B 1IG3A 2ZPXA 1W04A 1GNHA 4AEMA 4Q4W3 2PHTA 1D4VB 5FKBA 5FJHA 3V56A 1AYN3 1QIQA 3RFRA 1W6OA 2OVUA 2WQ8A 3NNMA 1R1A2 4MVTA 2K2SA 1I3HA 4QWNA 5ABJC 1V9U1 4FPOB 4NHLA 2BNMA 4EQVA 3SH3A 2PHDA 1LOCA 1GWMA 5EPAA 1JW6A 5CKQA 1PVC3 1UNBA 3ETQA 5FBJA 5IFTA 3I49A 1DGWX 3T0DA 2ZGQA 1CAVB 2A5ZA 1EUUA 2VUDA 2JIJA 1AVBA 3R4SA 4XILA 5FYMA 5A1AA 2P4EA 2DCTA 4GB31 5CVRA 4FSJA 1ULDA 2A3WA 1N3QA 1K5JA 2HWF2 5BNPC 4J25A 3TEWA 1QJX3 2PAKA 4XUTA 2QQIA 4IUGA 5F39A 1ND2C 4GWJA 4LBKA 4NIAA 5LWBA 4C8DA 3J8F1 5EYXA 2WQZC 2RDNA 1MEC2 2ZA9A 4MXWB 5CEHA 4WM8B 5C4WC 1W6PB 1Q8PA 2AYHA 2FHRA 3OBTA 3GF6A 2BQPA 2KR2A 1BEV1 1AJKA 5T54A 2VTXA 3WF1A 4TSVA 1RUH2 5B4NA 5LBCA 4B7EA 2J1UA 4COYA 5BNQA 1A8DA 4IW3A 2BNNA 4EN9B 3VB9A 1UWWA 2VTXJ 3B5LB 4CUBA 3IKWA 3OUIA 5FPXA 1QWRA 2IWGB 5IAVA 1TME2 1AX0A 1XSRA 4X8PA 5FZ8A 5IJRA 1NA1C 2GZWA 1FOD2 4YZ3A 3WG4A 5IVCA 1SBEA 1VBD3 2BU9A 3LCPA 4QKFA 4XMAA 3K4AA 5LEKA 3H0OA 1H1AA 1YFXA 2IFWA 4PIYA 4Q4Y2 1TMF3 5C71A 3BI3A 5JSPA 3JBG1 2MNGA 3J7MA 1AXZA 2OPWA 3VHNA 4JDOA 3SITA 2B46X 4BIFA 4ORFA 3I3EA 3P6BA 2BGPA 1PZ8A 2TUNA 4HXCA 4IV3C 4OI2A 3ZKUA 3Q8FA 2HYXA 4CCCA 1O3TA 4AI8A 4O61A 4YVSC 4NIIA 4BMEA 3ZPOA 4EWEA 5L7OA 1RUJ3 3I97A 1X9PA 3LKJA 4H2AA 4KMQA 5HI0A 1S2BA 3VBHB 4Q4V1 2DDUA 3USSA 1W28A 2BJSA 2VOXA 3DYOA 5FDBA 2DWRA 2JIGA 3C7HA 5BV6A 4FPEA 3O0WA 4L92A 4QPGC 3S7EA 3PIJA 4N53B 3WP3A 2JWPA 1RB8G 2YU1A 5E16A 2QUOA 1CAUB 4PDWC 4LULA 5FLHA 1EAH2 1PGL2 4YGBA 5ANNA 2OYZA 1I1EA 4IERA 4XBQA 2VCCA 3LEGA 2PN5A 4DXTA 3L2YA 5JXHA 4N43C 5C5UA 5C6CA 2MPFA 2VY0A 2X5IB 3DPRC 3POFA 5DAPA 5AFEA 3RVHA 5GLZA 1O4TA 1P8JA 1LHWA 3BALA 1VRH1 2D7FA 2SLIA 4RGGA 1RUE1 3NJYA 2NMNA 3C3VA 2DVBA 1TZOA 3BPZA 4RR3B 4AFDA 5G05L 3AP9A 5IYYA 1N47A 2YGMA 1D4M2 2PQSA 4Q2FA 4I2OA 3ACLA 3MV01 1W6NB 4HKLA 2YZ4A 5CU1A 1QEXA 5E6HA 1S4CA 4IV1C 4LK6A 4QPIC 4S2FA 4Y33A 2DTYA 3LE0A 1AR93 2Y6FA 1UU5A 3GALA 1XU2A 5FPAA 5T5LA 1G9BA 1E5RA 2W46A 1QGLA 4XFFA 3T1MA 3KGLA 2LS6A 3HT1A 4RQPC 1O8PA 3B00A 1LU2A 1W3XA 4JZRA 2VCBA 2Q8CA 5JZGC 4HSJA 1NXD1 1AYM3 3NJXA 3OUHA 1J1LA 3ZSLA 1C3HA 3P3NA 1MS1A 5L73A 2FCVA 1CIWA 3MI8A 4PI0A 5K7PA 3VZOA 1PIV3 1AX1A 4YVWB 1CN1A 1JI6A 4WVVA 2EAKA 5CYYA 1HN1A 3R4UA 4CEYC 1ONAA 4ZS3A 1PMIA 1CGPA 1M4WA 1RIRA 3W59A 4CDXC 3UK9A 4PBPA 3I3QA 2BEOA 1PO12 2R1BA 2JE8A 4LPLA 1AL22 3ZVXA 2XKPA 3AFKA 1VBB2 4NHMA 2QTWB 5DXDA 2VQTA 4MHUA 4FQZA 1CAXA 2CWSA 1C8NA 4OI0A 3LGRA 1SHWB 2Y34A 3DECA 2WN3A 1JOBA 2TEPA 3SH4A 4P9IA 2UWCA 5FMDA 1W99A 2RMU1 1OH3A 1UYXA 3IBMA 3Q8EA 4A3XA 3VHRA 4AEDB 3S57A 4S2GA 1S2KA 4UOJA 2JKBA 3HN3A 4EN6B 5FOBB 2WNUB 4LBQD 2NMOA 3MF9A 2OUJA 4BK4A 1TG7A 4CEWA 4K1YA 1FX5A 3VDCA 3FUQA 3HJRA 4AEJA 1GP4A 1RUD1 4Z8BA 1LHNA 5A7OA 3TEZA 3MHZA 1GUIA 5BNOC 1QJY2 4MV2A 5FQ0A 3CZJA 5KHKA 4RS5B 3VD5A 3DKWA 4LQRA 4RSUA 2CDPA 1WW6A 1QXPA 3HNMA 3W21A 2LALA 1HB1A 1WCDJ 2CNAA 4ATEA 2RDSA 4A7ZA 5FXZA 2HWC1 3UJQA 3VBSC 5DQ0A 1FMD1 1I5PA 5E88A 1PHMA 2ETEA 2KXLA 2UWAA 4ZXKA 1V70A 3WUDA 4DRRA 1F4AA 5CFDB 4MSVA 4GKXA 4AGRA 2HWB2 3HBZA 3WDWA 2Q8EA 1ZBE3 1PMJX 2RJKA 1NZCA 2WYFA 3N9PA 3PJQA 3GHMA 2JDKA 5T50A 4FPFA 1CPNA 3BB6A 4HMZA 4HPKB 4P02B 2GC2A 1GP5A 2P3YA 2RS53 2QQVA 1UIKA 2ZGTA 2ZEWA 1O91A 4H7MA 5GZDA 2R061 1DQ6A 1RUC3 4EN8B 2LM3A 1OQDA 4P9JA 3IDCB 4EE2A 4H3WA 4XDQA 4ASLA 1OMIA 4GMP1 4LO6B 4YRDA 3N7KA 1SCRA 2YB7A 1AL0G 3I2IA 1HX6A 3H1YA 3N36A 4YZ4A 2GC0A 3RG0A 2J1AA 4OCTA 4AHWA 2E33A 1AR73 1S1AA 4FXGB 5LEJA 2W92A 2HWF1 1VLNA 3H8XA 2VW1A 1ENRA 3GZTB 3I59B 1O7FA 4CU8A 3U75A 5LY1A 1H2LA 1X7NA 3C7FA 1YI9A 4YW4A 4AI3A 1MEC1 5DMYA 1ZYBA 3BKZA 1FV3A 3RZLA 5D8AB 5F37A 5LA2A 2DU0A 1RUH1 4DRVA 1BKZA 2ZZJA 1BMV2 2F17A 3WG3A 5CKNA 5FP9A 4CCOA 3FHQA 4IESA 1TME1 1GWKA 3BOPA 1PO22 1FOD1 1IS6A 1GWLA 3ACGA 1RUF2 1QOTA 2EXIA 2XXZA 3MYXA 4JQTA 4K1ZA 3ZFFA 2ZEYA 2PHWA 4Q4Y1 5EV7A 3AB0A 1ENQA 2RDQA 2VZOA 4ASMB 4XJ8A 1UZVA 4RFT0 4W50A 4AVSA 4CU6A 2FD8A 1EPZA 1VAKA 4OHXA 3SHRA 4MGTA 1JOPA 2A6YA 2Q1ZB 4QDQA 3LB9A 2H6CA 2A73B 4FT8A 3PURA 4LKFA 4Q4X2 3T2PA 3RYRA 4LIVA 3VBFC 4C0HA 5CG8A 2WWSA 3KSCA 1Y9GA 1HRI3 1W8WA 2V5YA 1D0GA 2WNVC 2HLEA 2VOTA 4Q1RA 2VAUA 4QXKA 2R072 1YQ2A 3EMRA 3WNNA 2ARAA 3KF5A 4W6YA 2E51A 3RZMA 1PGL1 1AZDA 2LTNA 2P2KA 5SV8A 3VGIA 5CNAA 3UNPA 5FWJA 5IVVA 2JDYA 5A32B 1BCXA 1EPWA 1H9PA 4A6OA 4BDVB 4XAEA 2Y0IA 3G6JB 5DDJ3 5BNPB 2ORZA 5T52A 2XJPA 1ND2B 2Z79A 3I8TA 2Q0AA 1H6XA 2F4PA 4JHZA 1XB9A 2DUPA 3H8RA 1TE1B 1ZA7A 5C4WB 4NJ4A 2AREA 3D82A 1ND3B 2PAMA 1CAVA 5FMBA 4YFWA 1RITA 2GNBA 1COV2 2D6KA 3GJAA 2PMWB 1NYWA 2YDEA 3AZWA 3B93A 1D4M1 4JTOA 4M3CB 4SLIA 1LHUA 4G4FA 3ROUA 1H2MA 1JUHA 3NO8A 1UD1A 2Z5WA 1NA1B 4DO0A 2WZPP 3IPVB 3KQRA 2CWMA 2IXHA 4XFIA 4UFHA 2ES3A 5JR7B 2R6QA 5DAXA 4GH4A 3WW3A 3ZX7A 3O1MA 1Y7BA 1RC6A 3TWIA 4QX8A 5LB6A 4MXWA 3ZSKA 4JQRA 2IVJA 4XUQA 3WVJA 5A3MA 3KVAA 4NAOA 1F8VA 2XGXA 4IV3B 2C9KA 2ZJCA 3H1MA 4AQSA 4HVQA 3WEZA 4YVSB 4QXHA 3RNSA 1R081 5EWSA 2FCTA 1KEXA 5J1XA 3ORJA 4BXSV 1JODA 3FLPA 4Y1ZA 2B9VA 3BU7A 2W47A 3ENRA 4HSLA 5L9BA 1S0EA 1PO11 2EIGA 4QPGB 4BQ3A 3M3OA 4I3PA 4JGZC 4LOTA 1AL21 4LR4A 2ZHMA 4CDQA 4BIOA 4A41A 1VBB1 1UKRA 2WT2A 3PJYA 4PDWB 4LBOA 3U4SA 1H9WA 2Z4FA 1SPPB 1W8UA 3AXEA 2WWUA 2YC4A 5ACA3 3VBRC 4PBOA 2YG0A 4KWKA 4QHZA 4CP2A 2DCYA 4XURA 3S0MA 2HBTA 2AACA 2Z42A 2GDFA 1BXHA 2CDOA 4HBNA 4QGMA 5K4LA 2B5HA 1S0JA 2BW8A 4N43B 4QKBA 5FKCA 3VBHA 3NAPC 4PJYA 4MLOA 1HRV3 3B9IA 2XHKA 3E5UA 4AR2A 2HWE2 1JOJA 4R9DA 4J1WA 1AXKA 1MZEA 3Q9OA 1D7PM 1RINA 2OQ7A 3IN9A 3KGZA 1QJY1 1UOJA 1UPIA 1X8EA 2YBKA 3NV4A 3ZXFA 3T4HB 2RS32 4YG6A 4E27A 5F5IA 1CAUA 4YM0A 4ES8A 4XHBA 1OI6A 2QFEA 1J84A 2PHXA 4F3JA 4E9KA 4AWDA 4NHKA 3WG1A 2DVDA 5IVYA 4DY5A 1DQ1A 5GZEA 3I3MA 4NPMA 4L99A 4KGQA 3OYWB 4FI9A 4IV1B 4NRPA 4QPIB 1GZTA 1MZ5A 2ZZQA 4AOCA 1V6NA 4CU7A 4XJUA 1Y4WA 2WC2A 2X5IA 3K2OA 3OD0A 4RHV2 4OHZA 2YROA 2HWB1 3MBWA 3OEBA 1W2NA 1YQCA 1K45A 5JZGB 3WNOA 2D98A 2WBKA 3AL5A 4TN7A 3CO2A 4ISQA 4DB5A 4UF0B 3FLTA 4XFAA 2WZ8A 4HETA 4M3CF 5ISLA 5FY5A 4LHKA 5CFCC 1C8M2 4KWJA 2QQJA 1AR83 4GJZA 1Q5OA 4CEYB 4CXYA 3PL0A 1U5ZA 2ZGNA 1W6NA 3U14A 3PMSA 4FAGA 5B2GB 3RZKA 1F5JA 4CTEA 4CDXB 1SBDA 4HANA 3OPZA 1XYPA 4N90A 4GMP0 1LHVA 3LAGA 4XPVA 3T4VA 4V2WA 2KA3A 1CAWB 2OZ6A 2WZR3 1PZ7A 2D3SA 4BCUA 1Z7S3 4K6BA 1N3OA 3N9NA 1G9FA 1ULEA 4LBMA 4AL9A 3RJRA 2ENRA 2HWD2 4NMIA 4XXPA 4IGOA 1LGBA 3MIFA 4N9HA 3THTA 2RDRA 2ZX4A 3OEAA 2ZCWA 1AUYA 3AK0A 5KHJA 4NIHA 2CAVA 2LW8A 3ZFEC 2YV8A 2P34A 5LK5A 4P9YA 2UU8A 4FP2A 1BMV1 1X50A 2A6XA 5BNOB 3WX5A 4XUNA 4LORA 4XCAA 4OMCA 3PVNA 5I0UA 3ZXAC 2VZQA 1C4RA 2D6NA 4MXVA 5A3NA 1LHOA 3IZOA 1VE0A 3CL1A 3VBSB 3LFIA 2W1SA 1G7YA 1RUF1 1XXNA 5FMOL 3R6SA 1MR5A 5EHDA 5FZDA 1NCRC 3KB5A 4AEDA 1QQP2 2PHLA 1UY4A 3MGUA 1DYKA 4UT5A 5IK8A 4NN0A 3KHBA 4D8MA 1W06A 1RVF2 2JX9A 3M2MA 2XQRA 4L9BA 5DAWA 1POV1 1Z0HA 3TRSB 1OPOA 1WW5A 2NP0A 5LRSA 4EWDA 4YW1A 4PT6A 1LOAA 3ZPYA 1W6MB 3AJZA 2IUWA 3CQOA 4HN1A 4MUVA 5GJ6A 1HQNA 5JWPA 2D6OX 3D8CA 4OFGA 1UX6A 4BISA 3BTZA 3ZIXA 4E4HA 5CFDA 4LT5A 1YHFA 3MW2A 1IS3A 2ZGRA 4FPLA 4FTBA 2O1QA 4LJHA 5CISA 1G86A 4UFIA 5C9AC 4XF3A 1PVC2 4JCKA 1X82A 2GC3A 3K75B 1BK0A 3ST7A 4JDMA 5LY2A 1CONA 2XG3A 3DN7A 4BLIA 4ZU7A 5BPXA 1REEA 1SFPA 1SLTA 4XFHA 3N9MA 3PVEA 2WAAA 5L36A 3ME2A 4G9SB 3GBWA 1J3QA 2JXAA 1WGPA 3H7YA 1VJ2A 4A45A 1Y9QA 2YGLA 2ZX1A 5FO9B 1COV1 1NCQC 3T0BA 1E5SA 5FTTC 4CU9A 2ZEXA 1HQWA 1RMU3 3O7OA 4AHXA 5J48A 4H14A 3AMMA 3JD73 1FXZA 3PVOA 4QT6A 2PFWA 3GZEA 2ERFA 3I59A 2XLFA 3D4KA 1W6QA 2H0BA 2JDUA 4Y20B 2WSVA 5D1IA 3UYJA 2QZ3A 1C57A 1DYOA 5EFUA 1VBD2 4Z82A 3VV1A 4BE3A 4BQ1A 4JAAA 3WW4A 5C8WA 1GZWB 2EIBA 5D8AA 5A3WA 1TMF2 4M4RA 1XBFA 1TNRA 4IEXA 4L8QA 4MH0E 5LA1A 4FPJA 3JU9A 1NX9A 4LXLA 4EWAA 3POYA 1LAJA 4M0NA 2GMPA 5JIUA 1KRIA 2D44A 5HCAA 2JICA 1CWPA 2WNVB 2WS93 1RUJ2 5HCFA 1J83A 2PHUA 2W2IA 5A3TA 4J6GA 1PK6C 4EROA 4K40A 2RS12 3S5QA 2JG9C 5FRAA 5KHHA 5AFBA 4WV8A 2HEWF 1CX1A 2V4VA 3IT8A 4EYUA 1OOPC 2IXKA 1JBCA 4QU2A 4GA9A 1ULFA 1HV1A 1DLLA 5IWFA 5JXJA 3UJOA 1O3SA 3O12A 4N7UA 5I0DA 1BVVA 4WVMB 4CDQC 2VZSA 3ACHA 2GNDA 2R043 1B35C 4QQPA 5J7MA 4QB6A 2PYTA 1RHI1 2ADEA 2XPJA 3H8OA 4XE9A 1RGSA 3GYDA 5LBEA 1UU4A 2EALA 2VQAA 4EZ4A 2D6LX 2C24A 2HWE1 1Q8SA 2VC9A 3DEMA 1MVQA 1ULCA 5AC93 4XJZA 3JXSA 4LHLA 1GP6A 3QOPA 1XE7A 2RS31 2YPJA 2XBO2 3AP6A 3M4FA 5FZCA 3WNKA 1QH6A 3PHMA 5FPUA 1NZIA 1FPN3 3FZ3A 4FOYA 3USUB 5L9VA 5A32A 1DZQA 1H0BA 3VD9A 3WZ1A 4BWOA 1ZRFA 3IDEA 1JYWA 1G9DA 2PAEA 4IE6A 4A3ZA 2BP6A 4QHBA 1ND2A 1BK1A 4RHV1 4OHYA 1VBC2 1SDDB 3NWKA 5FLIA 3H3UA 1LOBA 1PM7A 4FFIA 2VQ0A 5DN2A 5FZ0A 3ZN6A 4ZZ5A 4CP9B 1LR5A 5C4WA 5TSWA 1W2AX 2WFF3 3B02A 1DQ2A 4DMIA 1ND3A 1H1MA 4AVBA 4BZ4A 1PVXA 2R1DA 3HIFA 1C8M1 4O7XA 3X29B 4TWTA 4M3CA 3JCIA 4XACA 2VBDA 4PQQA 4Q8KA 1QNYA 3I2KA 1NA1A 2VZ3A 2P1BA 3IPVA 5FP7A 1PIV2 4QM8A 5FY4A 5JOYA 2DF7A 3B01A 3ZR5A 4DXRA 4AGVA 3BIEA 2ZGPA 1T6BX 2YBSA 2R0FA 4JGZB 2IZWA 2LRPA 2B42B 5A3UA 1G6NA 1CJDA 3MUZ1 3ACFA 3N3HA 4FFHA 3RYPA 4OI4A 2BGCA 1JYVA 4LBQB 4CSWA 3VBRB 4IV3A 1W2TA 1NQDA 1WW4A 3FWEA 1OH4A 4NO4A 1CVNA 1O4ZA 2ATFA 4WZFA 1DIWA 3U78A 2HWD1 3IMMA 2FZ2A 1ZZ6A 1OQEA 2SBAA 3MFCA 3NAPB 3QH6A 4HK9A 5F3IA 4Y1XA 3ZXGA 4AQ2A 2R7EB 2OXBA 2R0HA 1S55A 2VM9A 2Q8DA 4FPYA 4LO7A 2A70A 1R1ZA 2G1MA 3J8F3 1UU6A 3ZSEA 4QPGA 5A33B 4ZS2A 4Y1VA 1ULGA 4LEJA 3H1WA 2YUEA 3R4DB 4QPYA 5E8AA 3WNMA 3H8UA 3RS6A 3VHOA 2Q5TA 2VO5A 4PDWA 3VBUC 1ZZCA 3BIWE 1SPPA 2W94A 5DZGA 1GOFA 1H2KA 2Z2SB 1LODA 4ZKTB 5FIXA 5FP3A 4Q27A 1WBLA 1UX7A 2BNOA 1QQP1 4QDSA 3VKNA 4YZ2A 3SH5A 1LGNA 4N43A 3HBKA 4XW3A 1RVF1 4AF9A 3WINE 4Z92B 3MIGA 3AP7A 2V73A 1O3RA 3ES4A 4LKEA 1POV0 1OC1A 3JBG3 3ZR6A 1LOFC 5HXVA 1GQPA 2RE9A 1ZBE2 2VE1A 4I02A 4IETA 2PHFA 5CFCB 1KITA 4W8JA 3N7MA 5FZEA 4GALA 3N7LA 3BTAA 3HQRA 2RV9A 1GBGA 1G8WA 3O5SA 3EJKA 2W3JA 4H55A 1ST8A 1YYNA 2J1TA 1HN0A 1QH7A 4GD4A 4KG8A 1HB3A 4Q4V3 4IV1A 4QPIA 4D7TA 1YQ8A 3S30A 1RUC2 4ZU4A 3UV9A 3LDRA 3BUCA 3VZJA 3E5XA 5J36A 5FZMA 2AEYA 3OD4A 5GZGA 4FTSA 2JG8C 4P9XA 2HH9A 4Z1VA 5JZGA 2VG9A 5FYCA 4UBGA 1UMZA 1GZ9A 2FBEA 3ZOIA 2PQQA 3O14A 3OCPA 4UF0A 4OQ8A 4A7YA 4CDWC 1XNKA 3AKPA 4PF1A 1AR72 4LMFA 5G04L 5FY9A 4YYOA 2XB6C 3BCWA 2W08A 3U11A 1C1FA 2H6BA 4CEYA 1F35A 3MPPG 1YFYA 2NN8A 1BBT2 4IEWA 4AK3A 2XWJB 3RGBA 4CUAA 1VPHA 3ZFEB 5A70A 3ZYGA 3URFA 1CX4A 5DZEA 1UXZA 1ZVFA 2P3IA 3WDYA 4AI9A 4TYSA 1QKQA 1URXA 4O9GA 4MHRA 3BODA 1VB4A 2LUWA 3ACIA 1CAWA 1RUE3 1S0CA 3ETPA 2GSYA 3AYAA 3QBQA 5FZIA 3U0ZA 4UXAA 1WCUA 2D5HA 4KWLA 1XE0A 3PUSA 2VXJA 2DCKA 5BXXA 1NCRB 3B94A 4MOAA 2Y8KA 2Y38A 1WD3A 4RA0A 4LBNA 5I0RA 1KFUL 5JUVA 4BU2A 5A7PA 3N7JA 1WLCA 4Y4RA 5LK7B 5F9TA 1RUI2 1CJPA 3A22A 3OGSA 1HJGA 5LRRA 1X33A 4XETA 2XJSA 3NV3A 5BNOA 4WM7C 4B1LA 5CG9A 3TEYA 4AQ6A 1NLSA 1AHSA 2ARXA 2BGOA 3HNYM 3KHCA 3PIGA 1EV13 3LEKA 3NV1A 1F15A 3T2QA 1K5MC 4K3UA 3VBSA 4BQXA 1RUJ1 3FHIB 1YFWA 3ZXLA 4QX0A 3KCCA 3I4IA 2FDGA 4ZY9A 2Y64A 2E32A 2IXIA 2RS11 4Q1PA 5IUQA 1ASJ3 1YRZA 3PU3A 4AHZA 1O5UA 5D21A 1WKYA 4AGGA 4COVA 1BHGA 5C9AB 1NE4A 1WA4A 1QJZA 5JSRA 2TNFA 2XH6A 2Y6KA 4HKOA 4P14A 1ZBA3 3HWJA 4XBNA 3VDDC 3OJBA 1M06G 4P00B 5EIYB 3M70A 2Y60A 3ZYJB 5HBAA 2ZX3A 1EYBA 4KBZA 2DCZA 1MZFA 1W6MA 1IPKA 4NPRA 5DDJ2 2HKXA 3W58A 2VXRA 2ADDA 2RMU3 4AVAA 3PUQA 1UZZA 5JSOA 4LA2A 2NQYA 4PLMA 3O1OA 2ZMLA 2XOMA 1KJRA 2ZGUA 2XBO1 1REFA 3MO4A 4FOWA 4QX5A 5F6KA 4YZ5A 1ZX5A 2A3XA 3LD8A 1RUD3 4B7KA 1STMA 3E5QA 2JDPA 3RPQA 1JZ3A 1UKGA 1DP0A 1HB2A 4H7LA 4YSFA 5HV0A 3K77A 5C3RA 2RM22 2W1UA 1GLHA 3POJA 4CDUC 1XU1A 4YM1A 1N1SA 1VBC1 2IXCA 5T5PA 2R49A 2GNMA 4DPNA 4K9SA 4K8FA 3FBMA 3IAPA 2FMYA 1I6XA 2AEZA 4LO8A 1LOGA 3FFQA 4AYUA 3KZ4C 2OPKA 1SFYA 4HN0A 4UW3A 5FZBA 1H30A 2DTWA 2Y6JA 2BVBA 5D2AA 1CR7A 3LA7A 5FUIA 3DUIA 4XF4A 3NNLA 2AGSA 1WLWA 3WW1A 2Y33A 1K3IA 3UGFA 4LA3A 3RZGA 4ARXA 4XFGA 2FMDA 1VMFA 1SLBA 2Y0OA 1PK6B 4Y20A 5FYTA 2R063 2E63A 5FO7B 4BA6A 5C8CB 2JG9B 1V6LA 4AXOA 5FYZA 4YM2A 5JDBA 1OOPB 4FP3A 1GZWA 1AJOA 4GMP3 1KDMA 4QAWA 1PM4A 4NE9A 3ZFGB 3LSDA 5FYBA 3RI9A 1LULA 3WNXA 4Q5OA 1OVSA 3WW2A 1QJU3 3ZIWA 4B4RA 3J4UH 2XR4A 1B35B 3M3QA 1HDKA 4UBHA 2QQMA 1R1A1 1Y3TA 2UYBA 1ZZBA 2HWF3 1KS5A 3KV6A 5B4XA 4ZHNA 3S5AA 1RUG3 2QCSB 2LROA 2I2SA 3VBOB 2I74A 3WQ7A 3DV8A 5F2SA 3WD5A 5I8YA 5DAVA 2QQKA 2R30A 1JHNA 5CA6A 2B4KA 5KC6A 1NLRA 2ZACA 4NWWA 2VMEA 2QE3A 3IMNA 5CIRA 3AXDA 2GP3A 1UPSA 1L7RA 3HT2A 5A3LA 4KH9A 4M4PA 1NQJA 4WVMA 4XBLA 1QXJA 2C5DA 5I93A 1TME3 2WIIB 2CGOA 1ZM1A 2WLPA 4E4SA 4MX3A 2Y6GA 4CE8A 3ES1A 1V6OA 4COZA 1UQXA 5GLUA 1IPJA 5F5CA 2FDHA 4FTEA 3V0BB 2FCUA 2ZTNA 4W6XA 1C5HA 3AZXA 2EXKA 4M3CE 3VDBA 4D3WA 1JZ8A 2F4LA 1Q8OA 3KT7A 2JB8A 1S0GA 5BUVA 3PTRB 5F5AA 2JDAA 2NPIA 5FAXA 1PGSA 4MGQA 1DU3D 2VZRA 4HK8A 5F7UA 1LU1A 2QJVA 2VR4A 5FZ7A 5K0UB 2WFPA 5E89A 1V6IA 1AR82 1W9FA 5LATA 3TYJA 5LW9A 4FPCA 4FPKA 4XC9A 2NYYA 4QM9A 1OD3A 4IE7A 4QB1A 2PA7A 4GULA 2WN2A 5FCCA 5FP8A 4CEWC 2K46A 3LZZA 3N9LA 2DBNA 3AX4A 4JGYC 1X9TA 1XC6A 3IDBB 3RDIA 5BNNA 3B69A 3LIGA 4Q0VA 2WZR2 2C9AA 2QDRA 3GBGA 1W8TA 2A6WA 1O6UA 3WF0A 4COUA 1LKNA 4MGSA 4Y4YA 3AYCA 5ABJB 3AVRA 1BBT1 1OBNA 4R8HA 4I0WB 3NNFA 5KXBA 3M3EA 2BERA 4JGZA 4L2NA 1VIWB 3OTFA 1ZREA 1FI2A 5H9QA 3OY8A 4KWUA 4RYDA 2JB4A 3DGTA 1EAH1 4ONUA 3H9AA 3VBUB 5A3PA 5GLTA 3U10A 4LBQA 1IOAA 3ELNA 2VZTA 3VBRA 4F83A 3IWZA 4URAA 1D4M3 2WA3A 2ZEZA 3MLLA 2ZXQA 1RTVA 1H6YA 2EXJA 3NAPA 2DFBA 4R4ZA 1JYNA 2UY9A 3EBRA 2WT0A 3M8LA 3MEPA 4FOVA 4JDNA 3T30A 1UZWA 1RUI1 4OI1A 4CZSA 2E7QA 5A33A 4XF9A 4RD7A 2VMCA 1C1LA 4FFFA 4XTPA 3KT4A 4QB2A 3K4ZA 3FL7A 5T5JA 1W8FA 2WT1A 3A21A 2J42A 3A4UA 1FYUA 2ET7A 2RJLA 5HCBA 4AFAA 4P5HA 1MQTC 3GZUC 1R083 4XDOA 2DCJA 2BWCA 5DPNA 1AF9A 2WLQA 3BVCA 4UW5A 4MADA 2VNGA 1E5IA 4BM8A 5A6YA 4AAXA 5FOJB 4CYDA 1PO13 1MVEA 5IVEA 1OUSA 4KL1A 2E26A 4PCRA 2WQ4A 3M1HA 4WM8A 2JG8B 2XQXA 1W6PA 2UWBA 1ULOA 4HL0A 1VBB3 2X8KA 1LEDA 1ZRIA 3N35A 5FXVA 1UY1A 4PIZA 4OYUA 4CDWB 1LOEA 4CA9A 2X09A 2J1EA 3NL1A 4JKLA 5CFCA 5T3NA 5DDJ1 1DFQA 2WINB 4BQYA 5CZKA 4XZUG 2VBBA 3ASIA 2GC1A 2GN3A 2PLV2 4KU8A 3B7MA 1YNAA 1YLLA 3LPGA 1VRBA 4IDZA 1S0DA 2VCMA 1KDKA 5M0TA 3OBZA 4HT1T 3PU8A 1VMJA 3DKQA 1DBNA 4QQLA 3APBA 5CKMA 4GKYA 4WBBA 3A7QA 1XNCA 4PLOA 1WW7A 2BZDA 3QD6A 1LGCA 4B8EA 1D0HA 3M7AA 4LIUA 4CVUA 1IQDC 2RM21 3E1F1 4J1XA 4LKSA 2W1WA 1VBA3 2R32A 2BFUL 3NKGA 2XJRA 5DG1A 3VL9A 3NW4A 4QX2A 5IAXA 2QQPA 1RJ7A 5C3QA 3H50A 3DPRB 5FZ9A 2VJXA 3HAGA 2CAUA 1BZWA 4YGEA 1H4GA 3ZFEA 2V09A 4CCMA 3W9AA 5JMOA 4CXXA 4N53A 4DOUA 1AR62 1YI7A 4WM7B 1OFSA 1JXNA 4AEKA 1F4HA 1FATA 2UURA 1K5MB 2Y26A 4OQ9A 3AZVA 3KCXA 1OURA 4GAZA 4N8MA 5LCWL 2DUQA 5HPOA 3HQXA 1NCRA 3AL6A 1ENSA 3D5OA 2WO3A 2J1SA 2EICA 5JR2A 3K46A 4I01A 3SCGA 2Y6LA 2W5FA 2VMGA 1GOGA 2VQUA 4RQPB 4YW7A 4UW4A 4DZGA 3IIIA 5GKAC 3SCFA 1TNFA 3B9CA 3VDDB 1MS9A 1S0FA 4RR3A 1GQGA 5J09A 2A1XA 3CMGA 1O3QA 2HJIA 3VKMA 2R042 1JU3A 1DGLA 5FXXA 4CPBD 3WDTA 3NJZA 2A6ZA 3ZYPA 4GH4C 2A6VA 4KI5M 5DZFA 1VAMA 1VBE2 2N7GA 1H8TC 2GH8A 1GQHA 5GLVA 3AMNA 5C9AA 5AC92 1A34A 1RXFA 3W5MA 1UY0A 2E7TA 1LNSA 1LEMA 1ZRDA 5T55A 1PMHX 1O5LA 4CCLA 3TN93 1FPN2 1LTEA 2B7YA 4HG6B 3CNAA 4OMDA 3WDXA 3JQWA 2XJVA 4QMAA 3AZYA 4CDUB 3AYDA 4YVWA 4OUMA 4META 3DF0A 3NVCA 4GJYA 3WNLA 4AI1A 2NM1A 4UYBA 5FY1A 1VAVA 1YIFA 3VHPA 3PUHA 1DQ5A 1OD5A 3OGGA 4LHSA 3T3YA 4YFZA 2E9QA 2WFF2 2Z69A 4LUMA 3VD7A 4I0BA 2BOJA 4AHYA 1PO21 1QJEA 1JYIA 1W9SA 2DYCA 3TB0A 4DQAA 2D93A 4XUOA 3FX3A 1GANA 3K4DA 3JUUA 1GNYA 3HVDA 4R4XA 4DUWA 3H42B 3IB3A 3PMEA 5SV5A 5F2WA 4S2DA 4DINB 2FDFA 1H2NA 2WNUA 4GQ7A 4IXLA 3INAA 2VMHA 4KBBA 2RR12 5FYIA 4TXWA 2I45A 3DCQA 1UY3A 4XFCA 2DVGA 2MHFA 4Q4X1 1IPSA 3FC0A 4XQDA 2WZR1 4CP0A 4D6QA 1IGOA 1JYCA 4IE5A 1WUVA 2W68A 4Q4W2 4RS5A 2P37A 5J3UA 3VZNA 5EP9A 2YY1A 3UL2A 4D69A 1OF4A 3T2OA 1AYN2 2B45X 2R071 4GZ9A 4NIDA 2EIEA 2AR6A 2CYFA 4P9LA 1UMIA 4UFKA 3DL3A 3ZYIB 2EXHA 1PK6A 3RMYA 3RWKX 5C8CA 4BHPA 3PDQA 1W8OA 2JG9A 2X5IC 3CBNA 5C3SA 3J8F2 3VDAA 5KXDA 1OOPA 1T6GC 4YG0A 1ODMA 2ZABA 2DU1A 3LQCA 2W52A 3EB7A 3ZFGA 3HD8B 4COWA 1COV3 1UW8A 3AKSA 4MGYE 4QGLA 3KV4A 4NOTA 2YFZA 3C7GA 3S6PA 3JZVA 5FPZA 3WHUA 3O1RA 4HPKA 3UGGA 5F6LB 1R093 4Y1UA 2HEVF 2QKDA 2OX0A 3F95A 3WF4A 3SCHA 4EZHA 1DQ0A 4QU1A 1A6CA 1LECA 1QJX2 3CEWA 3VBOA 1XNDA 4AVVA 1W05A 4XMIA 4R9AA 1HB4A 3T0AA 3AM2A 3LIHA 5FPVA 3SKJE 2ORXA 4C90A 2VPVA 1WCSA 2X10A 3KQ4B 4HFSA 1CAXB 4Y1YA 5A7WB 4CUGA 5FZLA 2QVSB 1ZZ8A 3PTYA 4AFMA 2AZ5A 5KXCA 4OHVA 4KGGA 5EZWA 2VL4A 5IK7A 4UAPA 3RYKA 4AW7A 1L7LA 2WJSA 1CZTA 1HIXA 2X05A 3C7OA 2VVDA 2FDKA 2EVXA 1GNZA 4Q4V2 3CJXA 3LSEA 1CZSA 3VL8A 5C7GA 1UAIA 2MEV3 3VZLA 3V0BA 1JU4A 1XYOA 1ZA4A 2W0XA 3AZZA 3D3AA 4JGYB 1GFF2 2BUKA 4I3GA 3VBFB 2BFUS 1OSGA 2EA7A 3VKFC 2JDNA 4CCDA 3TBDA 1YEWA 2GNTA 3NV2A 2P5BA 1DZTA 3EYPA 2BDRA 2PLV1 1RHI3 5K0UA 2YMZA 5A6XA 4D6SA 3RZHA 3D0JA 1CQ9A 1MS0A 5LA0A 2ZGLA 5JI9A 4QD2A 4DNYA 1W90A 3HEIA 2QQWA 3QACA 4LK7A 1WWYA 2WL1A 3FLRA 4DFSA 3P1IA 4GWMA 2DVAA 3UKTA 4BH9A 2RS33 4DS0A 1Q56A 5T5OA 2PELA 4EV0A 1GICA 5FZHA 4AE2A 2AC1A 2VCAA 5FYYA 4X6RB 5HXMA 2BWAA 3ZM8A 5ABJA 1Y9MA 3IDAA 4QX7A 1FAYA 3TNPB 5CADA 1LENA 4YWAA 4URTA 4PI2A 1GKBA 1AR61 1IS4A 2ZMNA 1HXS3 4OZXA 1W0OA 3QH7A 3KD4A 4XTMA 1K42A 2JD4A 3VBUA 3ZSJA 4C1XA 3ZDVA 4A2UA 4P08A 1PGW2 4NAMA 4I30A 1EP0A 1F9KA 1C8M3 1MQTB 1WCKA 3AKTA 3SXWA 1EV12 5BNPA 4SBVA 4FPGA 3U37A 4JKMA 1DDLA 2B9UA 1YJLA 1SLAA 4AG4A 1WLDA 2FZ1A 2QQUA 4GXLA 2D5FA 4YGCA 4Z07A 1AR92 1ASJ2 1UY2A 3HQUA 4MGIE 4RN5A 1OQ1A 4XOGA 4A7KA 1WD4A 4BMBA 4TZDA 3OUJA 1JZ7A 1UIJA 1LOFA 1W8NA 2JD9A 1DGRN 5K9YA 1HV0A 1MS8A 2YC2A 4IEZA 3U4XA 4B4QA 1AYM2 1ZBA2 1JYTA 4YM3A 2AENA 2R041 3THPA 3SNMA 3UETA 1H8VA 2HWD3 3LA2A 3G7DA 3B3QE 4AAPA 5FXWA 1V9U3 1VBE1 2RMU2 3SMHA 3ZYHA 5FMCA 5AC91 1VP6A 1N1VA 2ZAHA 1V6KA 4Y3OA 1PZ9A 1SDWA 2JG8A 3WP6A 4RGAA 1SACA 3GXUA 4EN0A 4CUCA 2WYSA 4BLJA 1FPN1 3AVSA 3CIHA 5ANQA 5FMOS 2WAOA 2VUJA 2DBIA 1RYYA 4GB33 5E1RA 4YVSA 4B3NA 1X36A 1MS3A 3CDZB 4ASKA 2YPDA 2PXJA 5F3CA 2ILMA 4LLOA 4BB3A 3DXTA 2JKXA 5IVBA 4G3YC 1RVF3 2Q1FA 3HPNA 4NVPA 4A44A 1N1TA 4OUSA 5EQUA 5A1FA 2ZKLA 1IG0A 1YWKA 3D0SA 4QDRA 3WHTA 5JMCA 2XL7A 4ET7A 2BPA2 4KG0A 1OA4A 2WFF1 3Q8CA 1J1TA 1C5IA 4R9BA 1BEV3 3T08A 4XCBA 1KGYA 3K3NA 2YFUA 5KR7A 4Y22B 2NZ9A 3BOWA 4QX1A 3EQEA 3NRUA 2OUHA 3MPBA 2P6HA 4JRAA 4JX0A 3V0AB 2G9ZA 4KNCA 5ERLA 1GSLA 3WOGA 4P5YA 1CPMA 3WY6A 3O1SA 4UFMA 4CRQA 4Q0PA 3DPRA 3LEMA 3C2UA 2QQOA 1POQA 2RR11 1XJAA 2R062 4PLNA 4DXZA 5GM0A 4YW6A 2OKXA 1QMJA 3I54A 3KCYA 4Q4W1 5FPBA 5FZ3A 1FNZA 1ACCA 4WM7A 2P3JA 1QXRA 4IQPA 3W20A 3S7IA 2P3KA 1QJU2 1AYN1 4M0HA 1K5MA 3VZKA 4DUXA 2CV6A 2J7MA 2ZHKA 2QQNA 4XQ4A 2VTFA 1DLCA 4Z2AA 2RS52 3C8XA 4K21A 3MIHA 3OYWA 5JLVA 4KU7A 4GH4B 1RUG2 5APAA 3WUCA 3NMBA 5J98B 1H8TB 1MPXA 1UYYA 2QZ2A 2VECA 4YW3A 1PVC1 4QKDA 4FO9A 3OG2A 2WO7A 1UZ0A 2W95A 3E6DA 4RQPA 5FZFA 2VMFA 1KFXL 3HOBA 2VOWA 1NE6A 1ND3C 3CJIC 3VDDA 2IVIB 1GR3A 2ZMKA 3AC0A 1YQ6A 5DUXA 3J7HA 5FUNA 1VR3A 2ARBA 3ILRA 4M00A 4TLGA 4HVRA 5A80A 3UESA 3I2OA 1QJX1 3WDUA 5A3OA 2ZHNA 4IEPA 3A0NA 3QCWA 4CDXA 3WCSA 3POEA 3MLJA 5KWRA 2W87A 3NNJA 1GMMA 2ET1A 5IATA 1JZ6A 1L3JA 3KV5A 4QHOA 2XMLA 3VD3A 1XQNA 1F31A 1VRH3 4LBJA 1QY4A 5I0SA 1CZVA 4YLZA 4BYYA 1ZRCA 3W5NA 3I2JA 3GBFA 2QNKA 4Y5SA 5A6ZA 4EN7B 1YC61 3J26N 4FOQA 4NHXA 3PVBB 5F3GA 2BV4A 3ALQA 2V5DA 1I5ZA 1UN1A 1VBD1 3M3IA 4CDUA 4NRMA 4X8NA 5IW0A 3NJVA 1LCLA 4MO3M 2RS13 4BQ4A 2ZOEB 2ZBJA 1S0IA 5KBFA 1DCSA 3KM5A 1TMF1 4C0BA 5FZ6A 4YG3A 1A78A 2D40A 2WDBA 2W91A 4KQ7A 1V00A 4X6QB 5EJ3A 3Q8BA 3FN9A 5IK4A 3A0KA 4IL7A 2BYVE 5BYNA 2D43A 1AXYA 3NNGA 4E4ZA 3ZSMA 1HLCA 1HRI2 1YUDA 2VW0A 3SKVA 1ULPA 2CU5A 3O0VA 3AP4A 5FREA 5C3PA 4LO5B 4N9IA 2HEYF 4BK5A 3TOJA 3ZN5A 1WMEA 2XBO3 3F2ZA 4U2AA 1JHJA 4W65A 4CXWA 4YNIA 5A1LA 3IIAA 3OF1A 1IKPA
chains in the Genus database with same CATH topology
1F5FA 1VALA 1DF0A 3MLKA 4HLTA 4NWVA 3WCRA 1RUOA 1ZZ7A 4XEZA 2G9FA 5AVPA 1DGWA 2K9ZA 5GZCA 5I91A 1W0PA 1VBC3 4LTAA 2JEMA 5F5QA 3FBYA 2G4IA 3PLQA 5JPMB 2JE9A 5JOXA 1NCQB 4Q29A 5JVVA 3AKQA 1WMDA 1OA3A 1PGW1 1YIPA 3ZXDA 1NOVA 3NKTA 1EV11 1QOOA 4ATFA 5L7OC 2HWC3 3RQ0A 1R082 1FMD3 3QLQA 5FLJA 1LB2A 3GHNA 3HMYA 1U5XA 3KLSA 1AR91 1ASJ1 1HQLA 1HW5A 2HYKA 3CLPA 2VVFA 2DFCA 5CBLA 1AYM1 1ZBA1 2A7AA 2JE7A 2ZHLA 4FPHA 1SEFA 4HZFA 2VU9A 4V1PA 2NLRA 3PNAA 1R1A3 2FQPA 1PIV1 3ATGA 3POWA 4XJ9A 3JB4C 4RL7A 1MS5A 4MYEA 1DQ4A 1HKDA 5DUVA 5FO8B 1LJ7A 1JTZX 4HKWA 1IQAA 2B39A 4JGYA 2VNOA 4UW6A 2WA4A 4CDQB 3VBFA 1C28A 5ACA2 2EAAA 2RHPA 4QGNA 2WNVA 1S0BA 4MGKE 1VBA2 5KXEA 5H9SA 2R16A 3LOIA 1XRUA 3ZDSA 1MEC3 1SLCA 1HRV2 3FUOA 2ZGKA 3NSTA 3RMXA 2CGNA 1RUH3 4M01A 1TEIA 1IZ3A 3AP5A 1FT9A 4B29A 1OKQA 2VOKA 3AMQA 3E6CC 2AH2A 1DZRA 1FOD3 3ECQA 4WZCA 2XL9A 1FV2A 1UF2C 4GWNA 2O0OA 3RI8A 4B4PA 4WVZA 3TAYA 1A3KA 4Q4Y3 4E4DX 4LLFA 4AQTA 4EJRA 4YARA 4AVTA 1ZBE1 2D6MA 4YGDA 1Y43B 1QJU1 3USUA 3WQ1A 1X8MA 4YW5A 1MQTA 1ZNPA 4D7YA 2RS51 1N1YA 4LHNA 4Q0QA 1W6QB 1BBT3 1RUG1 2VW2A 3MICA 1RUC1 3FE5A 3JQXA 2JECA 2C1FA 3GZAA 4XF0A 1G9CA 1ALYA 3ILFA 4ZU5A 3RSJA 1OPMA 5JOZA 1EAH3 2XUMA 1AR71 1CESA 1DG6A 3WP5A 1J3RA 3MFAA 1Z7S2 3TN92 2A71A 4AFCA 2DVFA 1D2SA 1MZ6A 1YCIA 1RL3A 1RUI3 1U12A 4IEUA 5CAZA 4XJAA 3LOBA 2CGPA 1W39A 3EO6A 2D3PA 3RWNA 3KMHA 2E7AA 3MIBA 2VNRA 4HVOA 4BOWA 2AUYA 3E6BA 3R05A 2UYAA 3WLUA 4AFBA 4CP1A 3MF6A 5IK5A 1MS4A 2XLGA 3AJYA 3WG2A 2WNEA 2VH9A 4JC1A 4INDA 4I0AA 5CB7A 3VKLA 3WDVA 4FQ4A 4JRLA 2XWBB 4Y22A 2WKKA 3ZMNA 1HRI1 2IFRA 3V0AA 2Q4SA 4FBFA 2BBVA 1J3PA 3MZHA 4WVWA 1IS5A 2ZX0A 3ZN6B 1AL23 1GV9A 4XF1A 2K0GA 2YHJA 4LUKA 3CJIB 5DUUA 5K8SA 5JPNB 3O0XA 5H9RA 1GZCA 4XYXA 2RM23 1SLIA 1KQRA 3KS7A 4QQ2A 1YO8A 2A75A 2O8OA 3MW3A 2XKOA 1ZRRA 1R092 3VN4A 3SISA 4Q8LA 2GAUA 1V6JA 3ZFFC 1H8TA 4XXAA 2VULA 1QJY3 3K51A 4AVCA 4FVVA 4K20A 5GZFA 2QDNA 2D3RA 5BNNC 3R0RA 1OLQA 2JJ6A 4LO4B 1J58A 2PHRA 5J37A 1RMU2 1W6OB 1BQPA 2I07B 3JD72 3V64A 3ZYRA 5KHIA 3HN1A 4O9EA 1LRHA 1NXMA 1WBFA 2HWB3 3D6EA 2MEV2 3GNEA 4ISRA 1YJKA 4TLFA 2OZJA 2VUAA 2D97A 3EHKA 2W39A 2D6PA 3WP4A 1SFNA 1QF3A 4Q0UA 1MACA 2CL2A 2WS92 3AMPA 1PNGA 1RHI2 2IC1A 4XHXA 2ZAAA 3P3PA 2H0VA 3ZO0B 1DYPA 3I2DA 4PF5A 1KS4A 4ITCA 3N4MA 1OA2A 3MW4A 4DY3A 2E53A 2O8QA 4F8AA 1NY72 5ACA1 1SCSA 4LE3A 3WQ0A 3I7DA 1UZYA 1XYNA 1VBA1 1NG0A 3FFZA 4ES9A 3POSA 2XJQA 1HRV1 4D7SA 1TQ5A 1QDOA 3WV6A 1EY2A 3M3CA 4WM8C 3VLBB 4S2HA 2DUOA 1HXS2 5L19A 2XJUA 3AYEA 5I0TA 4OLLA 4IEYA 1AX2A 3UKNA 3WR0A 4E2GA 4YW2A 1PO23 1JN2P 2B8MA 5L7OB 1SMVA 4IEVA 4XIKA 4Y24A 4GIQA 1RUF3 5I8TA 1Q43A 5C33A 1WLTA 5GLWA 5JAXA 4C1WA 4PIXA 4OHWA 1POV3 3ZXKA 4E2SA 1NCQA 3VKOA 1ENXA 4Q4X3 4FXKB 4E2QA 1JUIA 1BYHA 3L2HA 4Y26A 2ZS6B 2ZGSA 1IKQA 1AR81 4AI0A 4I09A 2R073 2VGDA 5GALA 3VBHC 4XQWA 2F6BA 5J96B 4OULA 3ZXJA 1V9U2 3LWCA 4W6WA 5FFOC 4R9CA 5JIAA 1B09A 1H1IA 2Q30A 4U36A 4N53C 2PTMA 1RUNA 2CY6A 2BVVA 4Z2WA 4LE4A 1Z7S1 3TN91 1JH5A 4GB32 5KC5A 3V65A 2X53S 2KM2A 2X29A 1QU0A 1BJQA 3ZN4A 1APNA 3KT1A 4OVEA 5BY5A 4L97A 2EF6A 1BEV2 2YC0A 4CDQA 1N3PA 1GYKA 3H3ZA 1B35A 3AKRA 4RR3C 4JTNA 2XJTA 4LNVA 1Q8QA 1ZZ9A 4XIOA 3K48A 1W2UA 2JDZA 2GN7A 3MDPA 3UKVA 2GMMA 2G9GA 5DG2A 3ZXEA 1SBFA 1D2QA 2ZX2A 3T1LA 3JB8A 3JBG2 4R52A 2VVEA 1G9AA 2OW4A 3IM0A 2PLV3 3ILNA 4YVWC 4IEQA 2GMEA 1OLRA 4XFBA 5EXOA 5JCTA 1E57A 5I8SA 1OFNA 4CEWB 4YZ1A 3OGJA 1PNFA 3ZMOA 2JENA 5FQ0B 1RJ8A 4XJWA 2UY8A 2VMIA 1DGRA 3J9SA 2E6VA 2IXJA 1BVP1 1QHDA 3HR9A 4MZUA 3WXPA 1QDCA 1R091 4F7ZA 2YYOA 3SLIA 2Q8OA 2GH2A 4AEDC 5KHGA 2HWE3 4JV4A 3AFGA 1SQ4A 1LESA 1U5YA 2WNUC 1U0AA 1VB2A 2IXLA 3DF0A 1U5IA 1YXWA 1AR63 3E97A 3TNQA 1IHMA 1KD7A 1REDA 3OBRA 4LBLA 4D94A 4FAHA 1VRH2 1XNBA 4RS5C 1RMU1 1RUE2 1O4YA 2OA2A 1QNWA 3JD71 2DV9A 3RJ2X 1UCXA 3U07A 1CD3G 4MGZE 5EYYA 4AI2A 5CFDC 4RHV3 1Z78A 2WSUA 3VZMA 2MEV1 4FCAA 5AVAA 5C8CC 1J59A 1V6MA 1QOSA 1I9RA 3ZFGC 1Q3EA 2XVKA 1A8MA 4BPZA 2GALA 2XVLA 5H9PA 4PQ9A 4Q26A 2WS91 4K7JA 3MIDA 2BTVC 2ZKNA 4P9GA 5FBZA 4JVAA 1DHKB 3MIEA 1VBE3 3VBOC 2CTVA 4N7IA 2ZGMA 1NY71 4C91A 2GU9A 3FMGA 3EXUA 4XZPA 1UL9A 4NR1A 3RZZA 2OIIA 2P17A 3L9JT 5DUWA 3CU7A 4QQOA 2Q1MA 1KJLA 4Q0SA 4Y5Z0 3H7JA 2XLAA 1H4HA 3CF6E 3T2TA 3ZFFB 3FJSA 4L11A 1SLLA 2VOVA 4QQHA 2XVGA 3RRDA 1HXS1 5JI7A 1FNYA 4IEOA 5D8AC 2TBVA 1XE8A 3WT3A 5JOWA 2ZGOA 2DURA 1RUD2 5BNNB 3CJIA 3LA3A 4CDWA 1F2NA 3AMHA 1KXGA 1WMFA 4P9WA 2YXSA 1Q8VA 5K0UC 1QQP3 2HWC2 1OHFA 2C0ZA 2A3YA 1FMD2 2RR13 1YFUA 3OY8B 2ZPXA 1GNHA 4AEMA 4Q4W3 2PHTA 1D4VB 3V56A 1AYN3 1W6OA 2OVUA 1R1A2 4MVTA 2K2SA 1I3HA 5ABJC 1V9U1 4FPOB 4NHLA 2BNMA 3SH3A 2PHDA 1LOCA 1JW6A 1PVC3 3ETQA 1DGWX 2ZGQA 1CAVB 2A5ZA 3R4SA 4XILA 1AVBA 2DCTA 4GB31 5CVRA 4FSJA 1ULDA 2A3WA 1N3QA 2HWF2 5BNPC 1QJX3 2PAKA 1ND2C 4LBKA 3J8F1 5EYXA 2WQZC 1MEC2 2ZA9A 4MXWB 4WM8B 5C4WC 1W6PB 1Q8PA 2AYHA 2FHRA 3OBTA 3GF6A 2BQPA 5T54A 1BEV1 1AJKA 4TSVA 1RUH2 4B7EA 4COYA 5BNQA 1A8DA 4EN9B 2BNNA 3B5LB 3IKWA 5FPXA 1QWRA 2IWGB 1TME2 1AX0A 4X8PA 1NA1C 2GZWA 1FOD2 4YZ3A 3WG4A 1SBEA 1VBD3 3LCPA 4XMAA 5LEKA 3H0OA 1H1AA 1YFXA 2IFWA 4PIYA 4Q4Y2 1TMF3 5JSPA 3JBG1 2MNGA 1AXZA 3VHNA 4JDOA 3SITA 2B46X 4BIFA 4ORFA 2TUNA 1PZ8A 4IV3C 4OI2A 1O3TA 4AI8A 4YVSC 4EWEA 4BMEA 5L7OA 1RUJ3 3LKJA 5HI0A 1S2BA 3VBHB 4Q4V1 3USSA 2VOXA 5FDBA 2DWRA 5BV6A 4FPEA 3O0WA 4L92A 4QPGC 3S7EA 4N53B 3WP3A 1RB8G 5E16A 2QUOA 1CAUB 4PDWC 4LULA 5FLHA 1EAH2 1PGL2 4YGBA 2OYZA 1I1EA 4IERA 4XBQA 2PN5A 3L2YA 4N43C 5C6CA 2MPFA 2VY0A 2X5IB 3DPRC 5AFEA 5GLZA 1O4TA 1LHWA 3BALA 1VRH1 2D7FA 2SLIA 4RGGA 1RUE1 2NMNA 3C3VA 2DVBA 3BPZA 4RR3B 4AFDA 3AP9A 1N47A 2YGMA 1D4M2 4Q2FA 3ACLA 1W6NB 4HKLA 2YZ4A 5CU1A 4IV1C 4QPIC 4S2FA 2DTYA 1AR93 3GALA 1UU5A 1XU2A 5T5LA 1G9BA 1QGLA 4XFFA 3T1MA 3KGLA 3HT1A 4RQPC 5JZGC 3B00A 1LU2A 4HSJA 1NXD1 1AYM3 1J1LA 3ZSLA 1C3HA 3P3NA 1MS1A 5L73A 5K7PA 1CIWA 3MI8A 3VZOA 1PIV3 1AX1A 4YVWB 1CN1A 4WVVA 2EAKA 4CEYC 3R4UA 1ONAA 1PMIA 1CGPA 1M4WA 1RIRA 3W59A 4CDXC 3UK9A 4PBPA 2BEOA 1PO12 2R1BA 1AL22 3ZVXA 2XKPA 3AFKA 1VBB2 4NHMA 5DXDA 4FQZA 1CAXA 2CWSA 1C8NA 4OI0A 3LGRA 2TEPA 3SH4A 4P9IA 2UWCA 2RMU1 4A3XA 3IBMA 4AEDB 3VHRA 4S2GA 1S2KA 2JKBA 4EN6B 5FOBB 2WNUB 4LBQD 2NMOA 3MF9A 2OUJA 4CEWA 4K1YA 1FX5A 3FUQA 4AEJA 4Z8BA 1RUD1 1LHNA 5BNOC 5FQ0A 1QJY2 4MV2A 5KHKA 4RS5B 3DKWA 4RSUA 1WW6A 1QXPA 4A7ZA 2LALA 2CNAA 1WCDJ 4ATEA 3UJQA 2HWC1 3VBSC 1FMD1 5E88A 1PHMA 2ETEA 2KXLA 2UWAA 4ZXKA 1V70A 3WUDA 4DRRA 5CFDB 5F1RA 4MSVA 4GKXA 4AGRA 2HWB2 3HBZA 3WDWA 1ZBE3 2RJKA 1NZCA 3PJQA 3GHMA 5T50A 4FPFA 1CPNA 3BB6A 4HMZA 4HPKB 2GC2A 2RS53 1UIKA 2ZGTA 1O91A 4H7MA 5GZDA 2R061 1DQ6A 1RUC3 4EN8B 2LM3A 1OQDA 4P9JA 3IDCB 4H3WA 4XDQA 4ASLA 1OMIA 4GMP1 4LO6B 4YRDA 3N7KA 1SCRA 1AL0G 1HX6A 3H1YA 3N36A 4YZ4A 2GC0A 3RG0A 4AHWA 1AR73 1S1AA 4FXGB 5LEJA 2HWF1 1VLNA 2VW1A 1ENRA 3GZTB 3I59B 1O7FA 1H2LA 1X7NA 4AI3A 1YI9A 4YW4A 1MEC1 1ZYBA 1FV3A 5D8AB 2DU0A 1RUH1 4DRVA 1BKZA 2ZZJA 1BMV2 3WG3A 4IESA 1TME1 3BOPA 1PO22 1FOD1 1IS6A 1RUF2 1QOTA 2EXIA 3MYXA 4K1ZA 3ZFFA 4Q4Y1 2PHWA 5EV7A 4ASMB 3AB0A 1ENQA 4AVSA 4I2OA 4XJ8A 4RFT0 1EPZA 1VAKA 4OHXA 3SHRA 2A6YA 2Q1ZB 3LB9A 2H6CA 2A73B 4FT8A 3VBFC 4Q4X2 4C0HA 5CG8A 3RYRA 2WWSA 3KSCA 1HRI3 2V5YA 1D0GA 2WNVC 4Q1RA 4QXKA 2R072 4W6YA 2E51A 1PGL1 1AZDA 2LTNA 2P2KA 5SV8A 3VGIA 5CNAA 5A32B 1BCXA 1EPWA 1H9PA 2Y0IA 3G6JB 5DDJ3 5BNPB 5T52A 2XJPA 1ND2B 2Z79A 3I8TA 2Q0AA 2F4PA 2DUPA 1TE1B 5C4WB 2AREA 3D82A 1ND3B 2PAMA 1CAVA 4YFWA 1RITA 2GNBA 1COV2 2D6KA 2YDEA 1NYWA 4SLIA 3AZWA 3B93A 1D4M1 4JTOA 4M3CB 1LHUA 4G4FA 3ROUA 1H2MA 1JUHA 3NO8A 1UD1A 2Z5WA 1NA1B 2WZPP 3IPVB 3KQRA 2CWMA 2IXHA 4XFIA 2ES3A 5JR7B 2R6QA 4GH4A 3WW3A 3ZX7A 1Y7BA 1RC6A 3TWIA 4MXWA 3ZSKA 4JQRA 3WVJA 5A3MA 1F8VA 2XGXA 4IV3B 2ZJCA 3H1MA 4AQSA 4HVQA 4YVSB 3RNSA 1R081 5EWSA 3FLPA 4Y1ZA 3BU7A 3ENRA 4HSLA 1S0EA 1PO11 2EIGA 4QPGB 3M3OA 4I3PA 4JGZC 1AL21 4LR4A 2ZHMA 4BIOA 1VBB1 1UKRA 2WT2A 3PJYA 4PDWB 4LBOA 1H9WA 3AXEA 5ACA3 3VBRC 4PBOA 4KWKA 4CP2A 3S0MA 2DCYA 2Z42A 4HBNA 4QGMA 2GDFA 1BXHA 2B5HA 1S0JA 2BW8A 4N43B 3VBHA 3NAPC 4PJYA 4MLOA 1HRV3 3B9IA 2XHKA 3E5UA 2HWE2 1JOJA 4R9DA 4J1WA 1AXKA 1MZEA 3Q9OA 1RINA 3IN9A 3KGZA 1QJY1 1UPIA 3NV4A 1X8EA 3ZXFA 2RS32 4YG6A 4E27A 1CAUA 4YM0A 4ES8A 4XHBA 1OI6A 2QFEA 2PHXA 4F3JA 4E9KA 4AWDA 4NHKA 3WG1A 2DVDA 4DY5A 1DQ1A 5GZEA 4L99A 4KGQA 3OYWB 4IV1B 4QPIB 1MZ5A 2ZZQA 1V6NA 4XJUA 2WC2A 2X5IA 3OD0A 4OHZA 4RHV2 2YROA 2HWB1 5JZGB 2D98A 3CO2A 4ISQA 4DB5A 3FLTA 4XFAA 4HETA 4M3CF 4LHKA 5CFCC 1C8M2 4KWJA 1AR83 1Q5OA 4CEYB 1U5ZA 2ZGNA 1W6NA 3PMSA 4FAGA 5B2GB 1F5JA 4CTEA 4CDXB 1SBDA 4HANA 3OPZA 1XYPA 4N90A 4GMP0 1LHVA 3LAGA 4XPVA 2KA3A 1CAWB 2OZ6A 2WZR3 1PZ7A 2D3SA 4BCUA 1Z7S3 4K6BA 1N3OA 1G9FA 1ULEA 4LBMA 3RJRA 2ENRA 2HWD2 4XXPA 4N9HA 1LGBA 3MIFA 3THTA 2ZX4A 2ZCWA 1AUYA 3AK0A 5KHJA 2CAVA 3ZFEC 2YV8A 2P34A 5LK5A 4P9YA 2UU8A 4FP2A 1BMV1 1X50A 2A6XA 5BNOB 3WX5A 3PVNA 5I0UA 3ZXAC 1C4RA 2D6NA 4MXVA 1LHOA 3CL1A 3VBSB 1G7YA 1RUF1 1XXNA 5FMOL 3R6SA 1MR5A 1NCRC 3KB5A 4AEDA 1QQP2 2PHLA 3MGUA 1DYKA 5IK8A 4NN0A 2JX9A 1RVF2 3M2MA 4L9BA 1POV1 1Z0HA 3TRSB 1OPOA 1WW5A 2NP0A 5LRSA 4EWDA 4YW1A 1LOAA 3ZPYA 1W6MB 3AJZA 4HN1A 4MUVA 5GJ6A 5JWPA 1HQNA 2D6OX 3D8CA 4OFGA 1UX6A 3ZIXA 5CFDA 4LT5A 1YHFA 3MW2A 1IS3A 2ZGRA 4FPLA 4FTBA 2O1QA 1G86A 5C9AC 4XF3A 1PVC2 4JCKA 1X82A 2GC3A 3ST7A 4JDMA 1CONA 2XG3A 3DN7A 4BLIA 4ZU7A 5BPXA 1REEA 1SLTA 4XFHA 3PVEA 5L36A 3ME2A 4G9SB 3GBWA 1J3QA 2JXAA 1WGPA 3H7YA 1VJ2A 1Y9QA 2YGLA 2ZX1A 5FO9B 1COV1 1NCQC 5FTTC 1HQWA 1RMU3 3O7OA 4AHXA 5J48A 4H14A 3AMMA 3JD73 1FXZA 3PVOA 4QT6A 2PFWA 2ERFA 3I59A 2XLFA 3D4KA 1W6QA 2H0BA 4Y20B 2WSVA 5D1IA 2QZ3A 1C57A 5EFUA 4BE3A 1VBD2 4Z82A 3VV1A 4BQ1A 4JAAA 3WW4A 5C8WA 1GZWB 5D8AA 1TMF2 1TNRA 4IEXA 4L8QA 4MH0E 4FPJA 3JU9A 4EWAA 3POYA 4M0NA 2GMPA 5JIUA 1KRIA 2D44A 5HCAA 2JICA 2WNVB 2WS93 1RUJ2 5HCFA 2PHUA 4J6GA 1PK6C 4EROA 4K40A 2RS12 5AFBA 2JG9C 5FRAA 5KHHA 4WV8A 2HEWF 3IT8A 1OOPC 2IXKA 1JBCA 4QU2A 4GA9A 1ULFA 1HV1A 1DLLA 1O3SA 3UJOA 3O12A 4N7UA 1BVVA 4WVMB 4CDQC 2GNDA 2R043 1B35C 4QQPA 5J7MA 2PYTA 1RHI1 2XPJA 4XE9A 1RGSA 3GYDA 1UU4A 2EALA 2VQAA 2D6LX 2HWE1 1Q8SA 1MVQA 1ULCA 5AC93 4XJZA 4LHLA 3QOPA 1XE7A 2RS31 2YPJA 2XBO2 3AP6A 3M4FA 1QH6A 3PHMA 4FOYA 1FPN3 3FZ3A 3USUB 5A32A 1DZQA 1H0BA 3WZ1A 4BWOA 1ZRFA 3IDEA 1G9DA 2PAEA 4QHBA 1ND2A 1BK1A 4RHV1 4OHYA 1VBC2 3NWKA 5FLIA 3H3UA 1LOBA 1PM7A 2VQ0A 3ZN6A 1LR5A 5C4WA 5TSWA 2WFF3 3B02A 1DQ2A 4DMIA 1ND3A 1H1MA 4AVBA 4BZ4A 1PVXA 2R1DA 3HIFA 1C8M1 3X29B 4TWTA 4M3CA 3JCIA 4Q8KA 1QNYA 1NA1A 3IPVA 1PIV2 4QM8A 5JOYA 2DF7A 3B01A 4AGVA 2ZGPA 4JGZB 2R0FA 2IZWA 2B42B 1G6NA 1CJDA 3N3HA 3RYPA 4OI4A 2BGCA 4LBQB 3VBRB 4IV3A 1NQDA 1WW4A 3FWEA 4NO4A 1CVNA 1O4ZA 2ATFA 4WZFA 1DIWA 2HWD1 2FZ2A 1ZZ6A 1OQEA 2SBAA 3MFCA 3NAPB 3QH6A 4HK9A 3ZXGA 4Y1XA 4AQ2A 2R0HA 1S55A 4FPYA 4LO7A 2A70A 1R1ZA 3ZSEA 3J8F3 1UU6A 4QPGA 5A33B 4Y1VA 1ULGA 4LEJA 3H1WA 2YUEA 3R4DB 4QPYA 5E8AA 3H8UA 3RS6A 3VHOA 2Q5TA 4PDWA 3VBUC 1ZZCA 3BIWE 5DZGA 1H2KA 2Z2SB 1LODA 4ZKTB 4Q27A 1WBLA 2BNOA 1QQP1 3VKNA 4YZ2A 3SH5A 1LGNA 4N43A 4XW3A 1RVF1 4AF9A 3WINE 4Z92B 3MIGA 3AP7A 2V73A 1O3RA 3ES4A 1POV0 3JBG3 1LOFC 5HXVA 2RE9A 1ZBE2 4I02A 4IETA 2PHFA 5CFCB 1KITA 3N7MA 4GALA 3N7LA 3BTAA 1GBGA 1G8WA 3O5SA 3EJKA 4H55A 4KG8A 4COVA 1YYNA 4Q4V3 1QH7A 5IT6A 4D7TA 4IV1A 4QPIA 3S30A 1RUC2 4ZU4A 3UV9A 3VZJA 3E5XA 5J36A 5GZGA 3OD4A 4FTSA 2JG8C 4P9XA 4Z1VA 5JZGA 2VG9A 4UBGA 1UMZA 1GZ9A 2FBEA 2PQQA 3O14A 3OCPA 4A7YA 4CDWC 1XNKA 3AKPA 1AR72 4YYOA 2XB6C 3BCWA 2W08A 3U11A 1C1FA 2H6BA 4CEYA 3MPPG 1YFYA 2NN8A 1BBT2 4IEWA 4AK3A 2XWJB 3ZFEB 3ZYGA 3URFA 1CX4A 5DZEA 1ZVFA 2P3IA 3WDYA 4TYSA 1QKQA 1URXA 4O9GA 3BODA 1VB4A 2LUWA 1CAWA 1RUE3 1S0CA 3QBQA 2GSYA 3AYAA 3U0ZA 4UXAA 2D5HA 4KWLA 2DCKA 5BXXA 1NCRB 3B94A 2Y38A 1WD3A 4RA0A 4LBNA 5I0RA 1KFUL 3N7JA 1WLCA 5LK7B 5F9TA 1RUI2 1CJPA 5LRRA 1X33A 4XETA 2XJSA 3NV3A 5BNOA 4WM7C 5CG9A 4AQ6A 1NLSA 1AHSA 2ARXA 1EV13 3NV1A 1K5MC 4K3UA 3VBSA 1RUJ1 3FHIB 1YFWA 3ZXLA 3KCCA 3I4IA 2IXIA 2RS11 4Q1PA 5IUQA 1ASJ3 1YRZA 4AHZA 1O5UA 4AGGA 5C9AB 1NE4A 1WA4A 1QJZA 5JSRA 2TNFA 2XH6A 4HKOA 4P14A 1ZBA3 3HWJA 4XBNA 3VDDC 3OJBA 1M06G 3M70A 3ZYJB 5HBAA 2ZX3A 1EYBA 2DCZA 1MZFA 1W6MA 1IPKA 4NPRA 5DDJ2 2HKXA 3W58A 2VXRA 4AHYA 2RMU3 4AVAA 1UZZA 5JSOA 4LA2A 2NQYA 4PLMA 2ZMLA 1KJRA 2ZGUA 2XBO1 1REFA 4FOWA 4QX5A 5F6KA 4YZ5A 1ZX5A 2A3XA 1RUD3 4B7KA 3E5QA 3RPQA 1UKGA 4H7LA 4YSFA 2RM22 1GLHA 4CDUC 1XU1A 4YM1A 1N1SA 1VBC1 2IXCA 5T5PA 2R49A 2GNMA 4DPNA 4K9SA 4K8FA 3FBMA 2FMYA 1I6XA 4LO8A 1LOGA 3FFQA 4AYUA 3KZ4C 2OPKA 1SFYA 4HN0A 4UW3A 1H30A 2DTWA 2BVBA 1CR7A 3LA7A 3DUIA 4XF4A 2AGSA 1WLWA 3WW1A 4LA3A 4XFGA 2FMDA 2Y0OA 1SLBA 1PK6B 4Y20A 2R063 2E63A 5FO7B 4BA6A 5C8CB 2JG9B 1V6LA 4AXOA 4YM2A 5JDBA 1OOPB 4FP3A 1GZWA 1AJOA 4GMP3 1KDMA 3ZFGB 3LSDA 3RI9A 1LULA 3WNXA 3WW2A 1QJU3 3ZIWA 4B4RA 3J4UH 3M3QA 1B35B 1HDKA 4UBHA 2UYBA 1R1A1 1Y3TA 1ZZBA 2HWF3 1KS5A 1RUG3 2QCSB 2I2SA 3VBOB 2I74A 3WQ7A 3DV8A 3WD5A 5I8YA 2R30A 1JHNA 5CA6A 5KC6A 1NLRA 2ZACA 4NWWA 2QE3A 3IMNA 5CIRA 3AXDA 1UPSA 3HT2A 5A3LA 4KH9A 1NQJA 4WVMA 4XBLA 1QXJA 2C5DA 5I93A 1TME3 2WIIB 2CGOA 1ZM1A 2WLPA 4E4SA 4MX3A 3ES1A 1V6OA 4COZA 5GLUA 1IPJA 4FTEA 3V0BB 2ZTNA 4W6XA 1C5HA 3AZXA 2EXKA 4M3CE 4D3WA 1Q8OA 3KT7A 1S0GA 5BUVA 2NPIA 5FAXA