5BNQA

Crystal structure of hrankl-mrank complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
156
structure length
156
Chain Sequence
AQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor necrosis factor ligand superfamily member 11
publication title A RANKL mutant used as an inter-species vaccine for efficient immunotherapy of osteoporosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 32
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bnqA00
3MI8A 2QE3A 2HEWF 2KA3A 2WNVB 4KGGA 4MXWA 4E4SA 4QPYA 3AB0A 1U5ZA 4TWTA 1I9RA 4DOUA 4N90A 2Z5WA 4NN0A 1GR3A 2Q1MA 5L36A 1DU3D 1PK6A 2ZPXA 4J6GA 1OQDA 2JG8B 2JG9B 3FC0A 1OSGA 5KC5A 5L19A 3QBQA 4G3YC 4HT1T 3B9IA 4GIQA 3K48A 2WNUA 2E7AA 4QQLA 1OQEA 1PK6C 1S55A 2HEYF 4OUMA 1O91A 2R6QA 5BNQA 3URFA 1JTZX 5CIRA 1U5YA 2JG8A 4F3JA 4OULA 3K51A 5KC6A 2QDNA 4E4DX 4MXWB 1KXGA 2WNVA 1XU2A 1A8MA 4QQOA 4MSVA 2O0OA 3IT8A 4QQHA 4D7YA 1XU1A 1C28A 1JH5A 2WNUC 2R32A 1C3HA 1TNFA 3B94A 2Q8OA 4QQ2A 1PK6B 2R30A 2RJKA 2OIIA 4QQPA 3ALQA 2JG8C 3B93A 3LKJA 2ZJCA 5KWRA 4RSUA 2WNVC 1RJ7A 2JG9A 2RJLA 4OUSA 2TUNA 4KG8A 5TSWA 3V56A 3L9JT 1IQAA 1DG6A 4EN0A 3ME2A 4MXVA 4DB5A 2HEVF 2AZ5A 2WNUB 2X29A 3QD6A 3WD5A 1D2QA 1KD7A 1TNRA 1WCKA 3TWIA 1D4VB 3TYJA 4KGQA 1RJ8A 4G4FA 1ALYA 4TSVA 1U5XA 2TNFA 5HBAA 2RE9A 1D0GA 2JG9C
chains in the Genus database with same CATH superfamily
5J48A 3MI8A 2E32A 1EV12 1Z7S1 3I54A 4TLFA 2EVXA 3GJBA 4YGBA 1H8VA 4IESA 4AGGA 5J3UA 1PVC3 3HN3A 1Q8VA 1RIRA 4Y3OA 1DZRA 1QDOA 4HFSA 5FXXA 2ZA9A 2P3KA 2DUPA 2YC0A 3J7MA 2YYOA 1DP0A 1CAWB 1HN1A 3BOPA 4GXLA 4O7XA 5FZLA 3VBHC 2WN2A 1UQXA 2XUMA 4JTOA 4AFDA 2P3YA 2ZS6B 1BBT1 1UKGA 3JD71 1YLLA 3ATGA 3WQ1A 2NZ9A 1KITA 4Q8KA 1OQDA 2WZR3 3ACFA 5LWBA 4BM8A 1AYN3 2RJ2A 5F9TA 1PGW2 3NJVA 5FP7A 1B35A 2SBAA 1VJ2A 2TEPA 1TE1B 4AG4A 2Y6HA 3HWJA 1EAH3 4RGKA 5EJZB 5KC5A 2OS2A 3FHIB 5DABA 5H9QA 4ET7A 2AGSA 4QPGC 3WW1A 1G9DA 1JYNA 2WN3A 5FREA 4AVBA 5SV5A 2VXRA 2YC2A 2ZX4A 3N9LA 5J7MA 1DHKB 4OCTA 4OQ8A 4UWDA 2Q8DA 1W2TA 4BPZA 3RWKX 2HEYF 3K2OA 4A7KA 4BU2A 1N1TA 1WA4A 4GMP0 2JENA 2GNTA 1LHUA 5BUVA 5C9AA 3O1TA 4YVWB 4F3JA 3HEIA 2CGNA 4IV1C 5CYYA 2W87A 1PGW1 1KFUL 4E4DX 2CWMA 5FK7A 4IGPA 5FV3A 5IFTA 1PGL2 3M7AA 5A3WA 1O8SA 5C4WA 3ELNA 4NHLA 4CU6A 3DXUA 1QY4A 1UCXA 4IDZA 4D7YA 1MS8A 3AZZA 4AI3A 5JOYA 3AMHA 4YNIA 2WO7A 3I59A 2DBNA 3Q8BA 4JDOA 2E9QA 3VBRC 4LITA 1MEC2 1TNFA 3TBDA 4ES8A 1QNWA 4YW3A 3D4KA 1YQ2A 2FMYA 2YBPA 3UL2A 4NHXA 3ALQA 4LBJA 2D5FA 5BY5A 5JMCA 1PZ8A 3LKJA 2MNGA 1QF3A 1OA2A 1ULDA 3I4IA 3LPGA 4YVSC 5KWRA 4R9CA 3NAPC 1JZ2A 2F4PA 1B35B 1UNBA 1S2EA 3H1WA 4XFFA 2QKDA 2YXSA 1PGL1 4XFCA 1W2AX 3O1UA 1MS1A 4LUMA 5TSWA 1LCLA 4IEPA 3AP9A 2ARBA 2VMFA 2R0HA 2XJSA 5FMDA 1SLTA 1RITA 1W6MA 2W39A 1LAJA 4YM1A 4E27A 1WW7A 3PL0A 2ZHLA 4PJYA 1NA1A 2DCYA 2VECA 3KMHA 3QACA 3S7IA 1RJ8A 1NCQC 3FUQA 3GZUC 1ULCA 1GP5A 2YB7A 4XAEA 3SEPA 4AEDC 5C33A 5C9AB 5FY1A 1FATA 2RE9A 4QGNA 2R041 3IAPA 1L7QA 1W04A 5ACA1 2G4IA 2BGOA 1VBB3 3L2HA 2WZPP 2VBDA 3RDIA 1GMMA 4LHLA 2Y34A 2BWAA 4K3UA 3S0MA 3U11A 4QX7A 1E5HA 1TMF2 1VP6A 2B9VA 2BERA 4K7JA 4V2WA 3WF1A 5C4WB 2XJUA 1QJX2 4FPLA 4QXBA 2R062 3SH5A 1APNA 3U10A 3VL8A 3MF9A 3U4XA 3BIEA 3I59B 1QOSA 2E7QA 1XNKA 2CDOA 2Q1ZB 2R0FA 4UFIA 4NN0A 2PLV1 4UBHA 3ILFA 5EQUA 5C7GA 2YG0A 3S5AA 1F4HA 1ND3C 2DURA 1QU0A 1RUG3 5BPXA 1FPN2 5L7OA 2BWCA 5GJ6A 1RUH1 4K8RB 2I2SA 5C3OA 5C3RA 4C0BA 2VNVA 4XTPA 5K7PA 4DPNA 2VMIA 3OBRA 2QQNA 2GC3A 3LWCA 4IXLA 4XF1A 3B01A 2FDHA 2KD7A 2W1QA 2G19A 4E2SA 4YG6A 1GANA 1BEV3 3PMEA 3UKVA 5AC92 4FBFA 4NR1A 4U2AA 2N7GA 3WP5A 1UOFA 1W6MB 4GIQA 1RXGA 5FYCA 4NIAA 1TME1 1BQPA 1NA1B 4ISRA 4AFMA 1J1TA 2H0BA 1FPN1 3I2IA 5GALA 1OQ1A 3ZSJA 1S0JA 1CX4A 3CO2A 4LMFA 2D98A 2ZHKA 5HCFA 1O59A 1HW5A 1Y9QA 4QGMA 3SKJE 2BYVE 2CDPA 1NYWA 2XUEA 4JKLA 4JKMA 4NVPA 2O8OA 1NZIA 1QJFA 2E63A 2Y6FA 3SH4A 5JDBA 2Q0AA 3OYWA 4Q4Y3 1MR5A 1HXS1 5IW0A 2VZQA 5C8CC 3KT7A 1SHWB 1W3VA 1ZBA3 3ORJA 1AR61 1U5IA 4CDUA 2BPA2 3ZYFA 1A34A 5FMBA 2NN8A 3X29B 4CPBD 1DFQA 4COVA 4GALA 4XJ8A 4L9BA 3UGHA 5L7OB 1YQ6A 2V09A 3FLRA 3NQHA 3LE0A 4PLMA 3NNLA 1R091 2GC2A 1GFF2 1RUF1 3OPTA 4YZ4A 2YV8A 1DGRN 1EUUA 1T2XA 1UF2C 5FY9A 1EUTA 1Y9GA 3ZPOA 1QQP1 4JGYC 4P9JA 2RM23 5H9SA 2ZAAA 5F5IA 4JZRA 4RYDA 3RYKA 2DVGA 3VKOA 5EZWA 4LBNA 5C8WA 5GZFA 4YW1A 4XVHA 1IKPA 2ZMNA 4XJAA 1V6OA 3NNGA 1AXZA 1JUHA 4C8DA 3NNJA 4EN0A 2VCCA 1S4CA 1FXZA 2JWPA 3OUJA 5LY2A 1DQ2A 3WDYA 2EIDA 2J1AA 1HX6A 2WWJA 4LBMA 4JAAA 4R4XA 2W08A 3A0KA 1UIKA 3MF6A 4HKLA 4K20A 1CD3G 3MW2A 4MOAA 4P5YA 2ZMLA 1OKOA 4FFIA 1NY72 1RUI2 2DU1A 5FZ1A 3NW4A 2OT7A 1RL3A 3N35A 5FP3A 3UNPA 2KA3A 4KGGA 3KS7A 5KHJA 4XJWA 1F4AA 3ASIA 4I0AA 1YI9A 2WZEA 2X05A 3HT2A 1RUE2 4QPYA 2C26A 1NLRA 2JX9A 2W5FA 1N3QA 1UY1A 5CVRA 1I9RA 3RGBA 2D3SA 4A2UA 3AK0A 1POV0 1ZZ7A 3RZZA 1YFXA 1YWKA 1UZVA 1HJGA 3OY8A 4FP3A 2JIGA 4N90A 4I0BA 1PVC1 1X50A 3W5MA 3WOGA 1B09A 1GQPA 3AMMA 4CDXC 2EIBA 2XJVA 1K5JA 4ZZ8A 4UYBA 5A3MA 5FZOA 5JXGA 5CFCC 1NOVA 3J7LA 3M4FA 2VC9A 5BNNC 2AACA 3PTYA 4OI2A 5DQ0A 1ULFA 3FJSA 1VBE3 5GZCA 1DYOA 4PHZA 4UF0A 5FZGA 3MPBA 4GKYA 3T0DA 5H9RA 1PVXA 2WZR1 1COV2 3M70A 1AYN1 2JXAA 3VZOA 2ZGTA 3QBQA 4PBPA 2NPIA 1EAH1 2CGOA 3AX4A 4CUBA 4G3YC 3CQOA 3DGTA 5FMOL 4OQ9A 1BK0A 1GU3A 1OFSA 2PHFA 1SACA 2VY0A 3PVBB 4XE9A 2IVIB 3H50A 1E5RA 1O3QA 3NJZA 3SXWA 5JOXA 1V9U1 5ABJA 4XACA 4NIDA 1CPNA 2D40A 2DCJA 2RVAA 3AJYA 4XC9A 4P02B 1RXFA 2WFPA 2WJSA 2H6CA 4J1WA 2VVDA 1EYBA 1N47A 1IPSA 4HMZA 1IS6A 2Z42A 4LA2A 4A7ZA 2A6VA 1AXYA 2KR2A 2AEYA 4B7EA 5LBFA 2VMDA 1W3XA 3AZVA 1XE0A 1NCRC 4NPRA 1CIYA 2C9AA 1BKZA 4QKDA 3BPZA 1W6QA 2BW8A 4AEJA 4AVAA 4INDA 5FZ7A 4XCBA 4AHZA 4BYYA 4C1WA 1YNAA 4NO4A 2B42B 5CBLA 5DMYA 2RR13 5FZOB 5D8AA 3OGGA 4XFBA 3WF0A 2BZDA 4LA3A 4B4RA 2XL7A 1PMJX 2UWAA 4UF0B 4RSUA 1DCSA 5FO9B 4XABA 3ZYHA 3ZXJA 4AFAA 2EXJA 1YI7A 4CVUA 2XBO3 1UN1A 1XYPA 1UO9A 2PHDA 4EN6B 2JDMA 4Q4X3 1CZVA 1S1AA 4URTA 3GALA 2DTYA 4HK9A 4CDWA 1ZX5A 2PHTA 4HK8A 2JECA 5FPXA 2C1FA 4L2NA 1NE4A 2HWB3 2RS33 4HSJA 3CZUA 2J22A 1SZBA 1C8M2 2ZGSA 3R4DB 2G9ZA 2Y6JA 5DAXA 2CGPA 2UY8A 5F7UA 4AI1A 1PHMA 2Q1FA 4NWWA 1JODA 4Q0UA 1Q43A 3M3CA 3I49A 1PIV2 4YVWC 3ZR6A 5ABJB 5F3GA 4UFHA 5FZ0A 3V0AA 2R1DA 1WGPA 1SFNA 2X09A 2YBSA 2C4XA 2K46A 1AX2A 4B8EA 4LOTA 3THTA 3WSOA 4CCCA 1UX7A 2BBAA 4UW6A 1VBB1 1XPWA 4NJ4A 2OYZA 2R1BA 2B8MA 4CZSA 5JPNB 4AQTA 3CJIB 3NMBA 4ARYA 2D6MA 3BODA 3CDZB 3VGIA 1BEV2 1W6QB 2BNOA 4KU8A 4RR3C 2OKXA 3RZGA 4TTGA 5LASA 3NKGA 3AXEA 3PU3A 5D8AB 2WO3A 5FXWA 3GXUA 3ACIA 2GMMA 1Z7S3 3IIAA 1RUG1 1B35C 1IZ3A 5GZDA 4Q2FA 3USUA 1J3RA 3WXPA 3J9SA 5H9PA 2DCKA 4DXZA 4XUNA 2RG4A 3JB8A 5F5QA 5FYBA 1OPMA 3KV5A 4AL9A 4CDWB 4XMAA 4UBGA 4UW5A 5FUPA 1S0CA 3I2DA 4C91A 4Z2AA 3O0XA 4Q4Y2 1ULPA 1BZWA 4GH4A 1BBT3 1PK6C 4FVVA 4Y5SA 5C9AC 3H8OA 4FI9A 1GWKA 1G7YA 3DF0A 4LO8A 5ANQA 1ST8A 2JDYA 5F2WA 3V0AB 2WFF2 2WO2A 4MYEA 2FDFA 2JDAA 3BUCA 2XXZA 5KC6A 4WM8B 4XDOA 3K4DA 1LHOA 4DUVA 3O7OA 2PELA 3QH7A 2MHFA 3T2OA 1NX9A 2VR4A 5F37A 2NM1A 3GZEA 2DWRA 2RM22 4QM8A 4NHYA 2ZGOA 5IWFA 1SG3A 4CCEA 4K6BA 3LGRA 4LE3A 1OC1A 1HRI2 3D5OA 3ZKUA 3I2FA 5F3EA 4ES9A 3VBSA 2K0GA 1BVP1 3KSCA 4EV0A 2E53A 4Q4Y1 3RMYA 4QB6A 4URAA 5I0DA 2WWUA 1ZBA1 2SLIA 2Q8OA 3I2KA 4TN7A 1W0OA 4FPOB 4PF1A 4DS0A 1C1FA 2UWCA 4QB1A 1OA3A 1UOGA 4FFHA 2P5BA 2AH2A 3ZXGA 2ZX2A 2ET7A 1LEMA 2ZJCA 4QX1A 3JCIA 2YROA 2LRPA 1VBD3 3USUB 2WNVC 2GC1A 2W3JA 3JB4C 4XYXA 5ANNA 5LZ6A 2JDZA 4OUSA 4XJUA 4AE2A 3BGAA 3WR0A 2PFWA 4AVTA 2C6SA 3N9MA 3WDTA 2OVUA 1TZOA 2HWE1 1O3SA 1H30A 1GNYA 3HAGA 1F15A 4UXAA 4B1MA 3LA2A 4LT5A 1UIJA 4XQWA 4GH4B 1NA1C 2OZJA 4BK4A 4XQ4A 3BIWE 1MQTA 2E7TA 4Y1XA 1UYZA 2AREA 2RHPA 3HD8B 4CCNA 4GWNA 4E8CA 5F3CA 1OLRA 4FCAA 2Y8KA 4Q1RA 2VXJA 2YFZA 1SCRA 4BXSV 3WNNA 1QJY3 2GNDA 4LORA 4AVVA 2RS51 1KRIA 1GP4A 4LBQD 1AYM3 2GNMA 1VBE2 3M1HA 1XNDA 3ZPYA 3KGZA 1OLQA 4YGCA 1UW8A 5FBZA 5F8PA 1ZZ6A 1ZZ8A 4BK5A 3NJXA 2PXJA 2W0XA 1DQ6A 3VBSB 2XG3A 1UU5A 2Y26A 4IL7A 2WYFA 4V1PA 2Z5WA 1WD4A 1PNFA 2P17A 1JYTA 5L7OC 2YHJA 5A7NA 4Y5Z0 2XOMA 3D8CA 3ZN5A 3J8F2 2Q1MA 2JB4A 3POSA 4JVAA 4WM7A 2JEMA 1Y3TA 3LCPA 3FX3A 2EIEA 4J6GA 2BFUL 1LOGA 1PO22 4I3GA 3WX5A 1I1EA 4JV4A 4YGDA 3I3BA 5DAVA 3MHZA 3TOJA 3T09A 3CIHA 2WIIB 3NRUA 5GKAC 5JSOA 3HQRA 3LEMA 1W6NA 3D0SA 2DVFA 1PX4A 1WCUA 2J7MA 1VBE1 4E4ZA 5FOBB 4LHKA 2UY9A 3RZHA 3QCWA 1A6CA 1N1VA 5C6CA 2X8KA 3DKQA 3BTYA 5A32A 2IC1A 4LPLA 2HKXA 2D7FA 4KMQA 5IYYA 3NL1A 4LLFA 1VBC3 4MGZE 1ODMA 3BTAA 2ZEZA 1MQTB 2ARCA 1O3TA 1EPWA 1I5ZA 3IDCB 3VBUA 3AKQA 4GWIA 5CIRA 1U5YA 4CUCA 2VG9A 3ROUA 3SKVA 4G9SB 4FFGA 4D94A 5A6ZA 3ZYRA 1QXPA 2WLQA 4FPKA 2OW4A 2RR12 3BOWA 5DUUA 1S2KA 3AP7A 3N7LA 2VNRA 4QU2A 4YARA 1SMVA 3UKTA 4KWUA 2EALA 1BK1A 5JZGA 2ARAA 1XC6A 5BXXA 1JYVA 5E1RA 5FJKA 3J4UH 1FI2A 1GICA 4HVRA 1ENRA 4KWLA 4BB3A 3VBFA 1VMJA 3AYAA 2XPJA 3AYDA 1XU1A 2XBO2 1SDDB 1TME3 1C1LA 2RDRA 2EIGA 3DEMA 3RRDA 4CU7A 4IEZA 5CG9A 3POFA 1H2MA 3PHMA 2Q4SA 4WM7B 4CXWA 4I0WB 4XUOA 2HWB2 3LSDA 3RJ2X 1JOJA 3VLBB 1I6XA 4EWDA 3BPSA 5SV8A 1S0FA 1YQ8A 3J7NA 1CWPA 3W59A 3FUOA 1QKQA 1S2BA 3VDDA 1W6NB 1JUIA 2PAKA 2TUNA 4XF0A 1VAMA 3HNMA 3OEBA 5K4LA 4WVMA 1Q8QA 3KV9A 4RD7A 2WT0A 5A3OA 4A7YA 3ZXFA 5A32B 1FAYA 3H8RA 3WDXA 1REEA 4D0QA 2XBO1 3M3EA 3A4UA 4MXVA 4XIKA 2HEVF 1N1SA 3AMQA 4Q4X1 1FMD3 4HKOA 1ASJ2 1H2KA 1R093 2W95A 3I2HA 1RUJ3 4W6XA 3VHRA 1TNRA 4OYUA 4BQYA 1DBNA 4N9IA 3VBUB 2HWB1 2RS31 1QQP3 2VMCA 3NJYA 1LHNA 1MS0A 3KVBA 2GU9A 3W5NA 1UY0A 3IMNA 1RVF2 3VHNA 5KXDA 1X8EA 2VZPA 4Y22A 1HRV2 3RZMA 2YDEA 3H3ZA 3EYPA 3IN9A 4M3CE 1BYHA 1Z7S2 5B4XA 3RI8A 5JZGB 3RI9A 1SCSA 1LGNA 4X6QB 2OXBA 4OUEA 1YIPA 3VBFB 2FZ2A 5JI7A 3H8UA 3D3AA 1R64A 3WNLA 4LJHA 1GUIA 2VMHA 2P3IA 1LEDA 3RFRA 3ES4A 2J1SA 3KQRA 4XEZA 1R083 4NAOA 2GZWA 4AGVA 4Z07A 4LE4A 1DU3D 1VIWB 2E33A 2YC4A 3MLLA 4NRQA 2O14A 4ZKTB 1WCQA 2Y6GA 3ZMNA 1H8TC 1BBT2 1MZEA 1OUSA 2FCUA 4IEVA 1GSLA 1CESA 4RFRB 2Y64A 1LOFC 5HV4A 5FYSA 1OOPA 2LTNA 3VDDB 3N9OA 4CEWC 4HXCA 5GLZA 3SC7X 1Q8SA 2RS13 3AC0A 3BU0A 1UXXX 4WVMB 3ZKYA 3ZFEA 4KU7A 5FY0A 2ILMA 3MIGA 2DUOA 2VUCA 5E89A 4N7IA 4P9WA 3RSJA 1MZ6A 3OGVA 4QPIA 4DRVA 1KDMA 2JE9A 3W58A 2I07B 2CYFA 4WVVA 4XIOA 5FP9A 5FXZA 2E7AA 3VZNA 3Q8EA 4CU9A 1W2OA 3SMHA 1O91A 4CCKA 2R6QA 4XJ9A 2ZX3A 3PVEA 2D6LX 1QH7A 1F31A 4LXLA 1FYUA 5D1IA 2JG8A 5A7OA 3VL9A 3I3EA 2VTXA 3LEIA 3D82A 5JXIA 2VCMA 4UAPA 2C9KA 3MEPA 1LOAA 2FQPA 2ATFA 2ZACA 4N9HA 2VZSA 3CJIC 3R05A 2GC0A 1SLAA 4JGZA 4IUGA 5BYNA 4ASMB 3NNFA 1FOD3 3AP4A 4K9SA 1J84A 4XBQA 2RDQA 5F6KA 4COWA 4CP0A 4QXCA 3VKFC 1QDCA 4N43A 4ARXA 1V9U3 3DUIA 4QHOA 4CRQA 1IS5A 1PZ7A 1L7LA 1OMIA 2UYBA 4XCAA 3M3OA 4TLGA 1LKNA 3LD8A 4Q0VA 3PMSA 2WNOA 1NZCA 1AL23 2B5HA 2FD8A 1H4HA 2J1TA 5B4NA 3NO8A 1OOPB 1DGWX 1LECA 2PN5A 1MVEA 2R16A 4EN7B 5C71A 1MPXA 2FDIA 1W8OA 1DQ4A 1LRHA 3ZFEB 4CDWC 1VBD1 4CCJA 3VDBA 1QJY2 2WSUA 1ZZ9A 2JKBA 3L9JT 4CSWA 4PDWA 3MICA 1XB9A 2VMEA 4QPIB 1V6IA 2VJXA 1RUNA 2QQVA 3ZFFA 1ZRRA 3A22A 2DCTA 1KEXA 5HCHA 3DKWA 3LF7A 3ZIXA 2ADDA 4LNVA 1OH4A 3WG2A 2QBXA 1V6KA 5AVAA 3LA7A 3WDVA 5GZGA 2WABA 1IGOA 2NQYA 4WZFA 4XBNA 2VVEA 3T3YA 4WM8C 4AW7A 2ZZJA 3CNAA 2R042 1D7PM 1S0GA 5ACA2 4QXKA 2PHLA 1SFYA 3A7QA 4YW6A 4Y1YA 3WP6A 5KXCA 1CZSA 3B7MA 5FY8A 1CQ9A 1URXA 2ZGMA 1JMUB 1I5PA 1QJY1 1ULOA 2Y6LA 3GBFA 2IUWA 4JGZB 3TNQA 1W8UA 5FP4A 1UY4A 2VCAA 3VKNA 3NV4A 3P6BA 4C0HA 1AYM1 2AYHA 2VW1A 2HYXA 3A0NA 5LRRA 4QAWA 3HT1A 3JQXA 1LJ7A 4N43B 1PX3A 4FAGA 4LIUA 1JZ7A 1SBFA 2A71A 2PLV2 2F17A 3KT1A 3MDPA 2QZ2A 3SCHA 5L36A 3APBA 2ZPXA 3MW3A 2VVFA 1OURA 2VU9A 1XNTA 4CCOA 1RUH2 2QUOA 2UU8A 2A3XA 3PVNA 1LHWA 1GOGA 1Y9MA 2GDFA 3KQ4B 4H7MA 4AI0A 1ODNA 1HN0A 4ZS2A 1WWYA 2R071 1LHVA 3GCXA 3FN9A 3BCWA 3TRSB 1MZFA 4Y4YA 1GNZA 2VPVA 4GD4A 1XSRA 4PDWB 1LR5A 3VBOA 5C3SA 3O1PA 2IFRA 2VOWA 1GQGA 3ZFFB 4ASKA 2X53S 4GH4C 3ZSMA 3B9IA 4PQ9A 1DF0A 1HB4A 4PLOA 4UW3A 1W9SA 5FAXA 5IVEA 1TME2 4FQZA 1S0EA 1JW6A 5JR7B 4K40A 1VBC1 2CWSA 1W8FA 3WP4A 1X9TA 3ZXAC 5EV7A 3AYCA 2YPJA 3WQ7A 3HR9A 5LY1A 2CHHA 1WLCA 2R49A 5EPAA 1CAUA 3I2OA 3ZMOA 4CEYC 4OHWA 2O8QA 2QQKA 1KXGA 2RMU3 2VZUA 3ECQA 4M4PA 4F8AA 4QX0A 1QHDA 3BYWA 1ND2A 1TEIA 1O4YA 5E16A 4P9IA 4FTBA 1ULGA 1TVGA 3A23A 3VBSC 1HXS2 4Y26A 4XDQA 2HWD3 2PHUA 2EF6A 4J25A 4BH9A 5K0UC 1AR62 5JOWA 4Z2WA 3AP6A 4XURA 4FPYA 3PUSA 4L8QA 5FMCA 1ENSA 1R092 1UZZA 1NLQA 1RUF2 4GA9A 4LO4B 3LPFA 1RUJ2 4NMIA 3U07A 2F6BA 2GH2A 3VZMA 3WHUA 3WV6A 4EE2A 4XBLA 2UWBA 5IAVA 1JYWA 1QQP2 5KBFA 4YZ1A 3HQUA 1RJ7A 2YGLA 2VUJA 1UMIA 2RJLA 3H7YA 1LNSA 3RZKA 2ZGNA 4COYA 4IGOA 1UOJA 2LW8A 5A6YA 1MS9A 5LBBA 2XLGA 3ZXLA 5FYVA 1SEFA 2XQRA 3CU7A 1SLCA 4P08A 1DLCA 1RHI3 2FZ1A 4QX3A 1H6XA 1XE7A 2GAUA 3PNAA 1DG6A 4OZOA 4XMIA 1W9WA 3ME2A 1UPSA 3ILRA 2DYCA 4XOGA 4D6RA 4DB5A 1H1IA 2JKXA 1XNCA 2ZEWA 2XJQA 4O9GA 4HOOA 4O61A 3GCWA 3TYJA 5DZGA 3GZAA 3KB5A 3MFAA 5D21A 1FMD1 4UT5A 3U4SA 3WEZA 3DPRA 1OBNA 2G1MA 2ZKNA 1RUJ1 2BJSA 4IEUA 1U5XA 2YU1A 3C3VA 4Q4V3 3M8LA 3FE5A 4YW7A 2JDUA 3ZFGC 3C7GA 2ZAHA 1CAUB 2JG9C 4B4PA 5ISLA 2DDUA 4BE3A 3IMMA 1JXNA 3MLKA 3EQEA 2HWE3 3QLQA 3HNBM 4A41A 2ZX0A 3C7FA 3JXSA 5FZ8A 1KQRA 1ND2B 2EXIA 1RUC3 1QMJA 1VMFA 2JDKA 4QDQA 4Y1ZA 3UK9A 1UY3A 5AFEA 5JOZA 4LUKA 2W2IA 4K21A 3MO4A 1G6NA 4JDNA 4MADA 3HJRA 1X7NA 4DOUA 2PQQA 3O1RA 1LGCA 1AHSA 1KJLA 3B02A 4RS5A 4ZU5A 1MVQA 2IXCA 3H9AA 4PI2A 4WM7C 1PVC2 1UYYA 4NHMA 4JHTA 5E88A 2IZWA 3K4ZA 5J36A 3SITA 4EQVA 3POYA 3WP3A 1STMA 3K3NA 4FPGA 1CGPA 1LU1A 2RS53 1R081 4FPJA 1W6OA 3RVHA 1AF9A 2V4VA 4X6RB 3W9AA 5LA9A 1ENXA 5CNAA 5APAA 4LHSA 4RA0A 2WRAA 3ZN6A 4LO7A 1AVBA 1W8WA 5L19A 2WZR2 5L9VA 2XL9A 3WNKA 1AYN2 1ZZBA 4R8HA 1O8PA 4JC1A 1SDWA 3OYWB 4P14A 5ERLA 3ON7A 4IV3A 2RS11 2X5IC 5IT6A 5FZMA 4AOCA 1JU3A 1WLWA 1EAH2 4CDUB 3D6EA 4RFT0 3WG3A 2YZ4A 2EXKA 1DGLA 3IB3A 2UYAA 3BALA 1D4M3 1Y4WA 2WNUA 3DYPA 2DFCA 1LTEA 4L97A 2C5DA 5FZEA 4YZ2A 4MHUA 4Z8BA 5LW9A 4NIHA 1NKGA 2VGDA 1VMHA 4LR4A 1C4RA 4P00B 3V65A 3WHTA 1JTZX 3T30A 2PHWA 1GLHA 2CAVA 3DPRB 4L99A 1V9U2 1POV1 3R4UA 3OJBA 2XVKA 2G9GA 3ZYPA 2DF7A 2ARXA 4PT6A 4DIQA 4KWKA 2VO5A 2Y6KA 2LROA 3WNPA 2VZ3A 2B4KA 4TYSA 2FMDA 4NWVA 2E26A 4PBOA 2PTMA 4MH0E 5J98B 4RS5B 1OUXA 5EP9A 1XNBA 1G9FA 2R32A 3JUUA 4RQPA 1WBLA 5G04L 3NKTA 4XW3A 3I3MA 2AC1A 2VNOA 1S0IA 5F2SA 1FOD1 1FNZA 2B45X 3O1VA 1XQNA 2RJKA 1N3PA 4NRPA 5A7WA 3UGGA 1WLTA 4QQPA 1LGBA 4FQ4A 1LU2A 1W6OB 2AR6A 2ORZA 3VD4A 1US3A 4IETA 5CKMA 2WNEA 3ACLA 5A7PA 3VDDC 3C7OA 3LDRA 3WUCA 1ZRDA 4YFZA 1XYOA 3ZN6B 1WMEA 3AM2A 1AL21 2XDVA 4HLTA 1F5JA 3I97A 3ACHA 4UW4A 3GM8A 5KXBA 3HBZA 5KHIA 1HIXA 4IV3B 1XE8A 4A45A 4MGSA 2V4AA 4PI0A 3DCQA 3DYMA 4AAXA 3BKZA 3MIBA 2EICA 3NV2A 4Q8LA 3OY8B 4FXGB 1WCDJ 2WNUB 2GP5A 2X29A 3NVCA 4ITCA 4YGEA 3HPNA 3QD6A 4PIXA 1D2QA 1KD7A 2J1UA 1WCKA 5C3QA 4DXTA 3VBHA 2IXIA 4KGQA 4DINB 4FFFA 1OHFA 4GULA 1FV2A 1ZBE3 1YFWA 5FZDA 2DCZA 3N7KA 2PAMA 5T5LA 2Z79A 4HSLA 2LM3A 2QE3A 3POBA 4CP9A 1OLME 2ZGLA 1GYKA 2ZCWA 3EMRA 1C5IA 4SBVA 3T2PA 5IVJA 2ZOEB 3LSEA 4OVEA 4NIGA 5HCBA 2OQ7A 4Y24A 3ST7A 3ZSKA 4N7UA 5FRAA 1X82A 1VBB2 3N9QA 4QPGA 5JVVA 3ZR5A 2WL1A 3TN93 1GZWA 1EY2A 3RZLA 3T4VA 4FAHA 5KHKA 4RQPB 1QOOA 4D8MA 3MIHA 2EA7A 2XLFA 5DZEA 3SNMA 3L2YA 1CAVA 5A7WB 5E8AA 2DU0A 3PDQA 3DXTA 2G9FA 3DN7A 3EJKA 2YBKA 1OOPC 1S0BA 3Q9OA 4YM0A 4YM2A 1YO8A 3UV9A 3KV6A 3UESA 1RUG2 2W91A 1W03A 5HXVA 4WVZA 3V64A 4IV1A 4KI5M 5IVFA 3ZFEC 4XFAA 4YW2A 1NAEA 5DDJ1 4D69A 2P6HA 5A3UA 4I02A 5F1RA 4I2OA 2CNAA 2JDPA 1H6YA 4W4ZA 1YIFA 1VAVA 4QHZA 1BMV1 3GZTB 1IS4A 2QFEA 3FZ3A 3M2MA 1JYIA 4LLOA 5LA1A 4IEXA 5C3PA 2Y33A 2XVLA 1V70A 1UZ0A 2HWD2 5GLTA 5T54A 3VBRA 3MIEA 4PLNA 4CYDA 2VOXA 3GGLA 4YG3A 3IDAA 3WUDA 4MUVA 4AWDA 3FHQA 4AHYA 1A3KA 2BNNA 2VNGA 3IWZA 3O0WA 4OULA 4CP9B 5A3TA 2BP6A 2I74A 2W1WA 2XB6C 4XJZA 4YVSA 4FT8A 1QIQA 3NAPA 2MEV3 1O5LA 4RGAA 4OI1A 1FT9A 2VULA 1DDLA 5EIYB 4W6YA 3UETA 2BTVC 3IT8A 2BOIA 4QPGB 2RMU1 4HPKA 1OF3A 2P34A 4MZUA 1C28A 1GZWB 4N43C 4Q4W1 2JB8A 2NLRA 3VHOA 5G05L 4QDRA 2FDGA 2HWD1 1QNYA 1ZBA2 1CAVB 1K5MA 2HWC3 2P3JA 4S2FA 2W94A 3KT4A 5FWJA 4QD2A 5A80A 5CU1A 1NCQA 4B3NA 5C5UA 3H42B 4OI4A 4ASLA 3H0OA 4BHPA 4IV1B 4LKFA 5FPZA 1UMHA 3TEXA 4FSJA 4IE7A 4LULA 1HQWA 2I45A 5KHHA 1DIWA 3ZLIA 4XF9A 1SLBA 3S57A 5C4WC 3V56A 2HWE2 3N9PA 2XKOA 1QEXA 4ATEA 1QJEA 5DN2A 2XHNA 4YYOA 4NPLA 3BI3A 3VV1A 3TB0A 1XJAA 1RHI1 5T5JA 4GB33 3VBRB 2BRTA 2W52A 1D4VB 1UYXA 2WQZC 3G7DA 4COUA 4F83A 1ND3A 3FWEA 3KD4A 5JSPA 3F2ZA 1EV13 1N3OA 2WSVA 4KL1A 4P9GA 4MHRA 5IK5A 4UFLA 4UFJA 1IS3A 1DZQA 4AK3A 1OLMA 4GMP3 4KG0A 2RS52 4Q4V1 4XZUG 2VE1A 4BQ1A 2GNBA 4R9BA 1IOAA 2PYTA 2QNKA 3AB0A 1U5ZA 4K1YA 1UYPA 5IK8A 3VZJA 3TEWA 4HPKB 4YG0A 3Q8AA 1J1LA 1Q8OA 2DTWA 3KHBA 1RUC1 3WNXA 1WW5A 1DYPA 1CN1A 3TNPB 2ZZQA 2ZEYA 4P9LA 3IM0A 4GAZA 1K5MB 5JMOA 1UXZA 1AR93 2OX0A 4NRMA 3LFIA 5A7SA 4GQ7A 1NCQB 4LQRA 5I91A 2IXHA 5T55A 5FYHA 1SPPA 2RDSA 3N9NA 1W05A 5CB7A 3T08A 2IXLA 4LIVA 1IG0A 3UJQA 5I0UA 3LEKA 4N53A 1YJLA 5JCTA 2Y0OA 3IDEA 3NWKA 2ERFA 5IVYA 2GSYA 2OPKA 2XH6A 5EYYA 2VBBA 1JZ5A 1A78A 4IEYA 1K12A 1MS4A 1CR7A 4YRDA 5JIUA 1FNYA 3IKWA 2VOKA 3VD9A 3NSTA 3VHPA 1DQ5A 1LB2A 2BVVA 2RV9A 3OBAA 4Y4RA 5I8YA 1V6NA 1ND3B 4DMIA 4YM3A 4OHZA 2WO1A 2QQPA 3BN6A 4Q0SA 3SLIA 2Y60A 3UJOA 1D4M1 2WS93 2OQ6A 3O5SA 4GZ9A 4ORFA 4BMEA 3G6JB 2WQ4A 4NE9A 2QQWA 2BBVA 4OHYA 1GKBA 2R073 4ONUA 3AMPA 1NG0A 4JGYA 3AKTA 3EHKA 4AFBA 1ND2C 1XU2A 2LALA 1W99A 2K2SA 5A7QA 5CKQA 4MSVA 1W8ZA 4M4RA 1GBGA 3QOPA 2V73A 3VZKA 2J1VA 1BVVA 3LDBA 2HWF1 4QDSA 5FCCA 1E57A 2C24A 3PUIA 4CDQA 1OPOA 1WCSA 5FPVA 2VL4A 3LAGA 4M01A 2GALA 1JOBA 2P1BA 3VUOA 1WA6X 3Q8FA 5A6QA 3VN4A 2ES3A 2GN7A 1MS3A 1ULEA 1AX1A 4BOWA 2AEZA 3J26N 1GP6A 1SPPB 3MV01 2OZ6A 2V5DA 4AHWA 3S7EA 5BNPA 4N53B 3ZYIB 2VCBA 1XYNA 2R7EB 4MGIE 3ETPA 2BOJA 3RNSA 4LO5B 5GLWA 2WAAA 3GDBA 4DNYA 1J3QA 1W9FA 5A1AA 1W8HA 2QQMA 2W9XA 4CDUC 1AUYA 2P2KA 1MS5A 4R52A 5D2AA 3POGA 2W1SA 1Z0HA 2E51A 2QZ3A 3USSA 2YUEA 2A6WA 1GWLA 5FLJA 4CCMA 2QCSB 2WYSA 4HL0A 4Q4X2 3AP5A 1MACA 3ZXEA 4AFCA 2QQOA 1GWMA 4CDXA 3ZXDA 3ZSLA 3MGUA 1H4GA 2RS32 2ZBJA 4OMDA 1DQ0A 4JKKA 1JN2P 5BNNA 1TMF3 1W2NA 5EJ3A 1V0AA 4QHBA 3OD0A 1QJX3 2HEWF 2CL2A 2BQPA 2FBEA 1ZBE1 2R063 3OBTA 5FZIA 4BLIA 4E4SA 1YQCA 2XR4A 5LK7B 4DY3A 1WZXA 2D97A 3E5UA 3N36A 4DY5A 1RGSA 3LB9A 4KBZA 4NHKA 2W92A 3M3IA 5JAXA 4LEJA 2BU9A 1P8JA 1ACCA 2CAUA 3AJZA 1E5IA 3BVCA 3HBKA 4CDQB 4U36A 4E8DA 5IHRA 4NROA 1RUOA 2XONA 5FPLA 4CXXA 1HV0A 1DGWA 1M4WA 1PMIA 3M3QA 3PLQA 3PUHA 3TN91 3LEGA 1BJQA 3KV4A 4IGQA 4H2AA 4XPVA 5FDBA 5JSRA 3KCXA 2JE7A 2W46A 5LBEA 4FTSA 3S30A 3OPZA 5BNPB 3DECA 4BJ0A 3KHCA 3P3NA 1HV1A 4PQQA 3ZOIA 1WLDA 1BXHA 2QQUA 3CLPA 2D44A 4ISQA 2A6XA 2BVBA 5IAXA 1O4ZA 3AZYA 4MX3A 5FPBA 2JE8A 1D0HA 2V72A 3VB9A 3T1MA 1GZTA 1WMDA 2D5HA 4A6SA 1NCRA 3K48A 5LBCA 2VQAA 1HKDA 4ZY9A 1KDKA 4CDXB 2JICA 4YW4A 5JUVA 2VQUA 3URFA 1JS9A 1VRH3 2ZTNA 4KH9A 4CXYA 4MVTA 3AZXA 2RDNA 2HWC2 3HMYA 4Q1PA 1W9TA 4LK7A 1XNAA 2ZEXA 5BNNB 1X36A 2QDNA 1CPMA 1TG7A 2E31A 3HOBA 4EJRA 2VMGA 5CADA 3N4MA 1J59A 4LTAA 1RB8G 1EP0A 1UX6A 3RYPA 1UPIA 4BQ3A 1AXKA 4B4QA 1X33A 4QQOA 1KJRA 4S2DA 5FPAA 5FOJB 3VKMA 2B7YA 5B2GB 1UU4A 2MEV1 4HETA 5HCAA 3AL6A 1VALA 1N1YA 4RQPC 1WD3A 1Z78A 1AZDA 2D6PA 2QQIA 1AJKA 4WVWA 4Q29A 1AL0G 4ZU4A 4W50A 1POV3 2ZGUA 4LKEA 3P3PA 3HNYM 5ABJC 5FUIA 1QWRA 5A70A 2DUQA 4GB32 4Z92B 4YVWA 2HWC1 3PJQA 3J7HA 2VTFA 4OFGA 4W65A 4AQSA 4CCDA 4Y22B 3T0AA 4AAPA 1VBA3 3JBG1 4UOJA 2D6NA 2VZ1A 3POJA 2L9LA 4AVCA 4XZPA 2YGMA 5FZ3A 3KM5A 5LCWL 3EO6A 5F5AA 5F6LB 5IJRA 1SFPA 1VBD2 3HIFA 1POQA 1Q5OA 4YLZA 1W90A 1OI6A 3A21A 4ZS3A 4CE8A 5JXJA 3PIGA 1NCRB 5BNOA 4CPBA 3E1F1 1RUI3 3B3QE 3NNMA 1AR71 3O0VA 1KS5A 1W0NA 3PIJA 4RR3A 1RMU1 5D8AC 4A42A 1H0BA 1HDKA 1R1A1 4FOVA 3ILNA 4K8FA 4E2GA 4GB31 5HBAA 5EJ1B 1RUE3 3GF6A 4RHV3 3UYJA 1O3RA 3ZSEA 4UI9L 1AR92 1EV11 2WWSA 5DG2A 3O1SA 4TZDA 4JQRA 3I3QA 3E5XA 2Q8EA 2P4EA 3ITQA 2XVGA 3WW3A 2CU5A 4Q27A 4GWJA 5CFDA 1RTVA 4M0NA 4GMP1 3VZLA 1RC6A 1WUVA 2IFWA 2ZGKA 3THPA 5EFUA 3K75B 1PO13 1ZA7A 1Q3EA 2IXKA 3UT0A 1AJOA 4D7SA 1AYM2 3PUQA 4RL7A 2D3RA 3OG2A 3R6SA 4BCUA 2CY6A 2C0ZA 3JZVA 4OLLA 1H1MA 3S5QA 1UU6A 1PK6A 3D0JA 3W20A 4NUBA 4I01A 4BLJA 1KS4A 1J3PA 5KXEA 1SQ4A 1WBFA 2WDBA 3MIFA 5IVCA 3GYDA 1COV3 3I2GA 4JRAA 3CL1A 1A8DA 2JG8B 1V6LA 1AR91 3PJYA 2VOTA 3AFKA 2WR9A 2WS92 1VAKA 5FP8A 1PM7A 3U37A 1LENA 1JI6A 5FWEA 1WW6A 2R072 4M3CA 4LKDA 5L9BA 1L3JA 2B39A 2WKKA 4DUXA 3FBMA 2W68A 5E6HA 1VR3A 4C90A 2WLPA 5BNOB 2VH9A 3B69A 3P5BA 3TEZA 1OF4A 3ZO0B 3ZXKA 3H1MA 3T2QA 4IEWA 4RR3B 1VB2A 1S55A 4HG6B 4QMAA 3MPPG 1W9YA 4HBNA 1KFXL 3BTXA 1ZREA 2LS6A 3RPQA 3F95A 1VBC2 5DAPA 3H3LA 1XBFA 1S0DA 4YW5A 2FHRA 5DDJ3 1W2UA 2EXHA 4BWOA 2ZX1A 2WS91 4IERA 1H9PA 3N3HA 2WNVA 4JDMA 4QXHA 3C2UA 3JU9A 3OSDA 4FP2A 2B9UA 1WMFA 4OZXA 3ES1A 3AYEA 5L9RA 2ZKLA 4EN9B 5CFDB 3MUY1 4HKWA 4V2VA 2J1RA 1ZRFA 4Y1UA 4NIIA 4KWJA 4UFKA 1MEC1 1C3HA 1K5MC 2V5YA 5LRSA 2DV9A 3WF2A 1YEWA 1YRZA 3ZX7A 1J58A 4HANA 2PQSA 4QQ2A 5GM0A 3SCFA 1PK6B 2R30A 4BIFA 4DFSA 1JOPA 2PMWB 1IG3A 5HV0A 4ZZ5A 3WY6A 4CUAA 2PAEA 2WQ8A 1JHJA 3OGJA 4LBOA 5JPMB 2TBVA 2W1UA 3SQOA 4AZZA 4AHXA 2D3PA 3POEA 4XFHA 4M3CB 4QKFA 1XOYA 1LESA 4HN1A 4E4HA 2J42A 3CHXA 1C8M3 2VQ0A 4Q4W3 1W8NA 1RUD3 2XJPA 4GJZA 2KM2A 3OTFA 1IPJA 1PIV3 4CA9A 1F9KA 5DUVA 5FLHA 3WD5A 4CCLA 4CTEA 2FCTA 4FPFA 4Q5OA 3UKNA 1DQ1A 4C1XA 3C7HA 5CA6A 1V00A 4Z1VA 2WZ8A 3WF3A 3JQWA 4EROA 1E5SA 1FMD2 3B00A 3U14A 4TSVA 2YY1A 4IEOA 3CJXA 2A6ZA 2YMZA 1D0GA 3N7JA 5I0TA 3K4AA 1RYYA 5KHGA 4NPMA 5IK4A 1Q8PA 2GH8A 1ZA4A 2WNVB 2Y0IA 1IHMA 3S6PA 3INAA 3AKRA 5FZ6A 3MW4A 4N8MA 1TMF1 2ET1A 5I8SA 5LK5A 1C57A 1Y7BA 2DBIA 4ZXKA 1QJX1 3QH6A 2R061 2ORXA 3SH3A 1WW4A 1UOBA 2EAKA 5JLVA 5A3LA 4WBBA 3P1IA 1MQTC 3WZ1A 2QDRA 1PGSA 2HBTA 4W6WA 2OA2A 5GLUA 2VOVA 4X8PA 3AKPA 1G9BA 2NP0A 2DVDA 2D43A 3MYXA 5L73A 3WNOA 4WV8A 2VD7A 4B1LA 1R082 2MPFA 4N53C 3WF4A 4XUTA 3U78A 4BQXA 2HJIA 1VRH2 4GJYA 5IK7A 3GBWA 5FPUA 2VUAA 2ZGQA 1F35A 4IE6A 4MGQA 4A3XA 4H14A 2PA7A 5AC91 1REFA 3FFQA 4XXAA 1V6MA 1ZNPA 5HI0A 5A3NA 2RS12 3POIA 3WQBA 4GKXA 4QWNA 3U0ZA 5KR7A 5M0TA 3MZHA 4H7LA 3DV8A 1DLLA 2WFF3 3H8XA 4EN8B 3KGLA 2WUHA 3WDWA 4LHNA 3C7EA 3ZDVA 2HYKA 2QQJA 3KCCA 3LA3A 4H3WA 1PMHX 5FR3A 4YZ5A 2ZGRA 4IE0A 1XXNA 5LA2A 5T5PA 5FO7B 1W6PA 5A33A 1EPZA 4FOYA 1VRH1 5FFOC 1HRI3 2ENRA 4R9AA 1CVNA 5JIAA 3VD7A 1O5UA 5FXVA 2JDHA 1VBA2 4QKBA 4AI9A 4CDQC 4BDVB 3GHMA 4QX2A 1DYKA 3FL7A 1H1AA 1OT5A 3KLSA 1V6JA 3KF5A 3WG4A 4EZHA 1O4TA 5AVPA 3MLJA 3ZVXA 4QPWA 3V0BA 3VDAA 3VBUC 1FOD2 2Z4FA 3CZJA 3ENRA 3FHAA 3OF1A 3IIIA 4OHXA 5T3NA 5JWPA 1JZ4A 2VQTA 5BNPC 3K77A 3LDKA 3RWNA 1O7FA 4PIZA 2ZGPA 3I3DA 5JZGC 1VPHA 2FDJA 1OKQA 4I30A 1FX5A 4RHV2 2BNMA 4ZU7A 5FY7A 1AL22 1SLLA 2HWF3 4S2HA 2QJVA 3VBFC 1VBA1 5FUNA 1GOFA 2WA3A 4I3PA 3B5LB 5FMOS 4BISA 2PHXA 2OUHA 2AZ5A 1H2NA 1TQ5A 4JTNA 4A3ZA 3WCRA 2NMOA 4EZ4A 2KXLA 4D6SA 1C8NA 1PO12 5EHDA 4YPJA 1FV3A 4XHXA 4J1XA 5DZFA 1OD5A 3SEEA 4R4ZA 2ETEA 1NY71 1RUI1 1YJKA 1NXD1 4G4FA 4B29A 1H8TA 2JDNA 1W6PB 5A33B 3KF3A 1YCIA 1HLCA 1T6BX 1LOFA 1YHFA 4R9DA 5IVBA 1JZ3A 2JJ6A 4AXOA 4XUPA 2Q8CA 4CEWA 2QVSB 1RUE1 1G9CA 4RHV1 3FFZA 3H1YA 2ZXQA 3WG1A 3TAYA 1CJDA 3J8F3 1YFUA 3NV1A 3UGFA 4PF5A 2XWBB 4LBLA 1ZZCA 1PO23 1G86A 1NLSA 3V0BB 2GN3A 2DVAA 5FY4A 5FZBA 1PO11 2O1QA 3VKLA 1M06G 4IE5A 4XILA 2P37A 3THDA 1JU4A 1YQ5A 1G8WA 4BXFA 1SBDA 3VD5A 4CP2A 1O6UA 1X9PA 5DXDA 4DUWA 5FZFA 3KVAA 4F7ZA 3EBRA 3MFCA 1NUKA 1OSGA 2VZOA 4LBQA 3E5QA 1COV1 1UMZA 2WT2A 3AVRA 2W47A 4P5HA 2FCVA 1W06A 4QX5A 3FBYA 5DDJ2 2F4LA 5F3IA 3ZN4A 5BV6A 2AENA 4EYUA 3CJIA 4HVQA 1VRBA 3MIDA 3RG0A 3WVJA 4DEVA 3R4SA 1YXWA 1BMV2 1JHNA 1Q56A 1VE0A 4FXKB 1K45A 5DAWA 5FYTA 1NT0A 2J1EA 3CBNA 4META 3HQXA 3LIGA 1J83A 4OUMA 2P6CA 2QQLA 4A4AA 5FIXA 2VAUA 4JHZA 4M0HA 4JX0A 2WC2A 4BIOA 1HB3A 3IAQA 2JD4A 1H8TB 4M3CF 2A75A 2XJRA 1OA4A 3CMGA 4BMBA 4IE4A 2A6YA 3OGSA 4DQAA 4CEWB 4LO6B 3AZWA 5EXOA 4QM9A 1A8MA 4YZ3A 3CEWA 2DVBA 3O1OA 1BLZA 1ZRCA 1BCXA 1OD3A 2Q5TA 4QPIC 2JD9A 5FYYA 2RMU2 2XJTA 1YYNA 3ZYBA 4ZHNA 3I2JA 1JH5A 4Q26A 2HLEA 4L11A 3DL3A 1LOCA 4Q4W2 4XTMA 1RUD2 5FZAA 3SHRA 3O12A 3IZOA 2GMEA 4XF3A 2VUDA 3TEYA 1QJU3 4RN5A 3VBHB 4JCKA 1AR83 2OIIA 5FBJA 2EAAA 3VD3A 2JG8C 2K9ZA 5F32A 2AUYA 1QJZA 2ID4A 3B93A 2A5ZA 2IXJA 3MBWA 4LKSA 4QT6A 5DAQA 3AL5A 4KNCA 1DGRA 2XKPA 4WM8A 3WW2A 3BB6A 4AR2A 5I0SA 4KQ7A 4KBBA 4LBQB 2NYYA 5CG8A 1WMXA 3PVOA 4JQTA 4JGZC 1ASJ3 5JI9A 5C70A 4HVOA 3K3OA 4HONA 2VW0A 3FLTA 1IQAA 2E6VA 2Z69A 1REDA 4XQDA 2VTXJ 3GNEA 4PCRA 3VBOB 5BNOC 3HN1A 4TXWA 1RINA 1C8M1 4B7KA 1U0AA 4DXSA 1RVF3 1K42A 1IPKA 1RUD1 3HVDA 3LOIA 1JZ8A 3GBGA 1RHI2 4W8JA 5K8SA 5A1LA 1HRV3 1UAIA 4QU1A 1PIV1 4FOQA 3IPVA 4IEQA 1UY2A 3JBG3 4AEDA 3BU7A 4K1ZA 4XETA 4CU8A 3IDBB 4E9KA 3T0BA 2A3YA 4AEMA 3CF6E 3GHNA 4MG2A 1OFNA 5DG1A 5FZHA 3BTZA 4Y20A 1YUDA 4BQ4A 3MV11 4Q4V2 5CFDC 4WZCA 3WQ0A 3OUIA 4AVSA 4MGKE 4YWAA 4PDWC 4AEKA 5I93A 3ZFFC 2XHKA 1AR73 1F5FA 3C8XA 3LFMA 1QXJA 4IQPA 1PM4A 1RMU3 1BEV1 1RUC2 2ZHNA 1C5HA 1R1A3 1Y43B 2H0VA 2OUJA 3JD73 3POWA 1UKRA 4MV2A 4BQ2A 5LEJA 3WT3A 5AFBA 3THCA 3DYOA 1H2LA 3PTRB 1JBCA 3Q8CA 5J37A 3OGRA 3ZDSA 3B9CA 2IWGB 1UZWA 3I8TA 1CAXA 4QGLA 3ZM8A 2FDKA 5I0RA 3E6BA 4LOSA 1JZ6A 4AI8A 3FC0A 4YVSB 3WINE 1OXCA 1UZYA 5FYZA 4CEYA 1JYXA 2A73B 3NAPB 1GZCA 3AVSA 2VM9A 1LODA 3EB7A 4BZ4A 2QTWB 2WINB 3RMXA 1HB2A 1W8TA 5FQ0A 1LULA 1VB4A 2BDRA 4MO3M 1W39A 3AMNA 4FOWA 3N7MA 4HT1T 5FLIA 2VZVA 4X8NA 4QKNA 5K0UA 3RS6A 2CTVA 1F2NA 3T2TA 3KWVA 2YU2A 1LOEA 3K46A 5LATA 3WLUA 5BNQA 4FPCA 3I7DA 3IPVB 2WFF1 5J1XA 4HN0A 4MGYE 1D4M2 4AEDB 1ZRIA 1NQDA 2D6OX 5GLVA 5CISA 2WAOA 4ZONA 3K51A 1IKQA 3WCSA 1ENQA 1WKYA 1ZYBA 2B46X 4P9XA 1YFYA 4Y20B 2A70A 1HJFA 1BHGA 2RM21 5FYIA 3ETQA 3RYRA 5A3PA 3VBOC 2O0OA 1HRI1 4OHVA 2A7AA 5FZKA 5J96B 4BA6A 4NOTA 5IFPA 2HWF2 5C8CA 5IUQA 2BV4A 4NAMA 2LUWA 5I8TA 1HQLA 3B94A 2WA4A 1K3IA 1MZ5A 1SLIA 1ZVFA 2PHRA 3OCPA 3WNMA 4DEQA 4BQ5A 2BFUS 4Q0PA 1CZTA 1CAXB 1UD1A 4AQ2A 5T50A 5GZEA 2VZRA 4EWAA 4IW3A 3ZFGA 2JG9A 1DZTA 5FKBA 5FZ4A 3U75A 4UFMA 2DFBA 4LK6A 4CEYB 4EWEA 2D6KA 3ABZA 1JYCA 4KG8A 4ATFA 3LIHA 3WDUA 4Z82A 1MEC3 3O14A 4RGGA 5FQ0B 1ONAA 5DPNA 4ZXEA 4H55A 2IVJA 5C5TA 4XAAA 4AQ6A 4AF9A 5K9YA 1CIWA 1OH3A 1UL9A 1VLNA 5K0UB 1F8VA 2GMPA 2ZABA 5HXMA 3LQCA 3LOBA 3TWIA 4PIYA 1PNGA 2R043 1PZ9A 2UURA 5ACA3 1L7RA 5FO8B 3PU8A 1AX0A 4FPHA 5F5CA 1ALYA 1X8MA 2BGPA 3OUHA 4FTEA 1GNHA 3RJRA 5FYMA 3OBZA 1OVSA 4MXWA 1LOBA 2D93A 1ZBE2 1QGLA 5CEHA 3AXDA 4S2GA 4TWTA 5IVVA 3OPWA 4Q0QA 2PLV3 4LBKA 5A6XA 2WT1A 5C8CB 5A1FA 2X5IA 5F39A 1QOTA 3LZZA 1R1ZA 3PURA 4L92A 5T52A 4DXRA 2YPDA 2A1XA 1RUH3 4XXPA 4AYUA 1GR3A 3J8F1 5LA0A 3OB8A 1NE6A 4SLIA 3TN92 4XUQA 2VZTA 3DPRC 5CAZA 1IQDC 4CP1A 1G9AA 1PO21 3RQ0A 3SCGA 3OEAA 1XSQA 2Y38A 5CFCA 4XHBA 1XRUA 3KCYA 4O65A 3ZFGB 4XFIA 5FZ9A 2JG9B 4GWMA 4I09A 5CZKA 4JGYB 3ACGA 4HZFA 1YC61 1CJPA 4XFGA 3ZYGA 2Q30A 3E6CC 5LB6A 1W28A 2VBPA 4DRRA 2HH9A 2XGXA 4RS5C 1US2A 4MLOA 1FPN3 4OI0A 1D2SA 5CKNA 2BGCA 3SISA 4QQLA 2WBKA 3H7JA 5IATA 4Y33A 1OQEA 3AFGA 2YFUA 1NXMA 2A3WA 2ZMKA 3EXUA 2XMLA 3FLPA 2VW2A 3OD4A 3W21A 2Z2SB 2RR11 4YSFA 1QJU2 5HPOA 1AR82 1GV9A 2CSGA 1GOHA 1HXS3 1U12A 4MXWB 4D6QA 5T5OA 2ZHMA 1HQNA 5AC93 1H9WA 1W0PA 1AR63 1UWWA 2NMNA 3O1MA 4IV3C 4YFWA 3GJAA 4P9YA 5FY5A 5EWSA 2H6BA 3FMGA 3PUAA 1ZM1A 3KZ4C 4QQHA 5FK8A 2MEV2 2X5IB 2BUKA 4COZA 4E2QA 2WNUC 5FKCA 1T6GC 1RUF3 4ZPIA 4QX8A 4A6OA 4QB2A 2ADEA 2XQXA 1CAWA 1GQHA 1CX1A 3E97A 3ZYJB 4OMCA 1NQJA 3VDCA 4CUGA 5J09A 5CFCB 3T4HB 3E6DA 1QJU1 1HB1A 3R0RA 5JR2A 2XWJB 3RZJA 1AR81 3T1LA 4XDPA 4FPEA 3OOXA 3JBG2 5DUWA 3U1XA 4JRLA 2CV6A 5FZCA 4AGRA 2OPWA 3NV3A 4L0PA 4DZGA 5LEKA 3MUZ1 4XF4A 4A44A 4AI2A 4O9EA 4D3WA 4Y1VA 1QXRA 4M00A 2HBUA 4MGTA 3AKSA 1I3HA 1KGYA 1GZ9A 5EYXA 1ASJ1 4FO9A 3H3UA 4Y5TA 3WW4A 5FJHA 2XLAA 2GP3A 2JIJA 1AR72 4DO0A 2BEOA 1QH6A 1RMU2 3CKHA 1OVPA 2X10A 1R1A2 1SBEA 3JD72 4D7TA 1RVF1 5FTTC 3IBMA 4BQWA 1CONA 5JXHA 2TNFA 3ZIWA 1HRV1 5DUXA 5FYUA
chains in the Genus database with same CATH topology
5J48A 3MI8A 1EV12 1Z7S1 3I54A 4TLFA 2EVXA 4YGBA 1H8VA 4IESA 4AGGA 5J3UA 1PVC3 1Q8VA 1RIRA 1DZRA 1QDOA 4HFSA 2ZA9A 2P3KA 2DUPA 2YC0A 4GXLA 2YYOA 1CAWB 3BOPA 3VBHC 2XUMA 4JTOA 4AFDA 2ZS6B 1BBT1 1UKGA 3JD71 1YLLA 3ATGA 3WQ1A 2NZ9A 1KITA 4Q8KA 1OQDA 2WZR3 4BM8A 1AYN3 5F9TA 1PGW2 1B35A 2SBAA 1VJ2A 2TEPA 1TE1B 4AG4A 5KC5A 3HWJA 1EAH3 3FHIB 5H9QA 1G9DA 2AGSA 4QPGC 3WW1A 5FREA 4AVBA 5SV5A 2VXRA 2ZX4A 5J7MA 1DHKB 4BPZA 2HEYF 4A7KA 1N1TA 1WA4A 4GMP0 2JENA 2GNTA 1LHUA 5BUVA 5C9AA 4YVWB 4F3JA 2CGNA 4IV1C 1PGW1 1KFUL 4E4DX 2CWMA 1PGL2 3M7AA 5C4WA 3ELNA 4NHLA 1QY4A 1UCXA 4D7YA 1MS8A 3AZZA 4AI3A 5JOYA 3AMHA 4YNIA 3I59A 4JDOA 2E9QA 3VBRC 1MEC2 1TNFA 3TBDA 4ES8A 1QNWA 4YW3A 3D4KA 3UL2A 2FMYA 3ALQA 4LBJA 2D5FA 5BY5A 5JMCA 1PZ8A 3LKJA 2MNGA 1QF3A 1OA2A 1ULDA 3I4IA 4YVSC 5KWRA 4R9CA 3NAPC 2F4PA 1B35B 4XFFA 3H1WA 2QKDA 2YXSA 1PGL1 4XFCA 1MS1A 4LUMA 5TSWA 1LCLA 4IEPA 3AP9A 2ARBA 2R0HA 2XJSA 1SLTA 1RITA 1W6MA 2W39A 4YM1A 4E27A 1WW7A 2ZHLA 4PJYA 1NA1A 2DCYA 2VECA 3KMHA 3QACA 3S7IA 1RJ8A 1NCQC 3FUQA 3GZUC 1ULCA 4AEDC 4CP1A 5C33A 5C9AB 1FATA 2RE9A 4QGNA 2R041 5ACA1 2G4IA 1VBB3 3L2HA 2WZPP 3RDIA 4LHLA 3S0MA 2BWAA 4K3UA 3U11A 1TMF2 1VP6A 5C4WB 4K7JA 2XJUA 1QJX2 4FPLA 3SH5A 2R062 3U10A 1APNA 3VL8A 3MF9A 3U4XA 3I59B 1QOSA 2E7QA 1XNKA 2Q1ZB 2R0FA 4NN0A 2PLV1 4UBHA 3ILFA 1ND3C 5BPXA 2DURA 1QU0A 1RUG3 5L7OA 1FPN2 2BWCA 5GJ6A 1RUH1 2I2SA 4C0BA 4XTPA 5K7PA 4DPNA 2VMIA 3OBRA 2GC3A 3LWCA 4IXLA 4XF1A 3B01A 4E2SA 4YG6A 1GANA 1BEV3 3PMEA 3UKVA 5AC92 4FBFA 4NR1A 4U2AA 2N7GA 3WP5A 1W6MB 4GIQA 1TME1 1BQPA 1NA1B 4ISRA 4AFMA 1J1TA 2H0BA 1FPN1 5GALA 1OQ1A 3ZSJA 1S0JA 1CX4A 3CO2A 2D98A 2ZHKA 5HCFA 1HW5A 1Y9QA 4QGMA 2BYVE 1NYWA 4NVPA 2O8OA 2E63A 3SH4A 5JDBA 2Q0AA 3OYWA 4Q4Y3 1MR5A 1HXS1 5C8CC 3KT7A 1ZBA3 1AR61 1U5IA 4CDUA 2BPA2 2NN8A 3X29B 1DFQA 4COVA 4GALA 4XJ8A 4L9BA 5L7OB 2V09A 3FLRA 4PLMA 1R091 2GC2A 1GFF2 1RUF1 4YZ4A 2YV8A 1DGRN 1UF2C 1QQP1 4JGYC 4P9JA 2RM23 5H9SA 2ZAAA 3RYKA 2DVGA 3VKOA 5EZWA 4LBNA 5C8WA 5GZFA 4YW1A 1IKPA 2ZMNA 4XJAA 1V6OA 1AXZA 1JUHA 4EN0A 1FXZA 1DQ2A 3WDYA 1HX6A 4LBMA 4JAAA 4R4XA 2W08A 3A0KA 1UIKA 3MF6A 4HKLA 4K20A 1CD3G 3MW2A 2ZMLA 1NY72 1RUI2 2DU1A 3NW4A 1RL3A 3N35A 2KA3A 4KGGA 3KS7A 5KHJA 4XJWA 3ASIA 4I0AA 1YI9A 3HT2A 1RUE2 4QPYA 5CVRA 1NLRA 2JX9A 1N3QA 1I9RA 2D3SA 4A2UA 3AK0A 1POV0 1ZZ7A 3RZZA 1YFXA 1YWKA 3OY8A 4FP3A 4N90A 4I0BA 1PVC1 1X50A 3WOGA 1B09A 3AMMA 4CDXC 2XJVA 5A3MA 5CFCC 1NOVA 3M4FA 5BNNC 3PTYA 4OI2A 1ULFA 3FJSA 1VBE3 5GZCA 3MPBA 4GKYA 5H9RA 1PVXA 2WZR1 1COV2 3M70A 1AYN1 2JXAA 3VZOA 2ZGTA 3QBQA 4PBPA 2NPIA 1EAH1 2CGOA 3AX4A 4G3YC 3DGTA 5FMOL 1OFSA 2PHFA 1SACA 2VY0A 3PVBB 4XE9A 3H50A 1O3QA 3NJZA 3SXWA 5JOXA 1V9U1 5ABJA 1CPNA 2D40A 2DCJA 3AJYA 2WFPA 2WJSA 2H6CA 4J1WA 2VVDA 1EYBA 1N47A 4A7ZA 4HMZA 1IS6A 2Z42A 4LA2A 2A6VA 1AXYA 4B7EA 3AZVA 1NCRC 4NPRA 2C9AA 1BKZA 3BPZA 1W6QA 2BW8A 4AEJA 4AVAA 4INDA 4AHZA 4BYYA 4C1WA 1YNAA 4NO4A 2B42B 5CBLA 2RR13 5D8AA 3OGGA 4XFBA 4LA3A 4B4RA 2XL7A 2UWAA 4RSUA 5FO9B 3ZXJA 4AFAA 2EXJA 1YI7A 2XBO3 1UN1A 1XYPA 4EN6B 2PHDA 4Q4X3 1S1AA 4URTA 3GALA 2DTYA 4HK9A 4CDWA 1ZX5A 2PHTA 4HK8A 2JECA 5FPXA 2C1FA 4L2NA 1NE4A 2HWB3 2RS33 4HSJA 1C8M2 2ZGSA 3R4DB 2UY8A 4AI1A 1PHMA 4NWWA 4Q0UA 1Q43A 3M3CA 1PIV2 4YVWC 5ABJB 3V0AA 2R1DA 1WGPA 1SFNA 1AX2A 4B8EA 3THTA 4UW6A 1VBB1 5JPNB 2OYZA 2R1BA 2B8MA 4CZSA 4AQTA 3CJIB 2D6MA 3BODA 3VGIA 1BEV2 1W6QB 2BNOA 4KU8A 4RR3C 3NKGA 3AXEA 5D8AB 2GMMA 1Z7S3 3IIAA 1RUG1 1B35C 1IZ3A 5GZDA 4Q2FA 3USUA 1J3RA 3WXPA 3J9SA 5H9PA 2DCKA 4DXZA 3JB8A 5F5QA 1OPMA 4CDWB 4XMAA 4UBGA 4UW5A 1S0CA 3I2DA 4C91A 3O0XA 4Q4Y2 1BZWA 4GH4A 1BBT3 1PK6C 4FVVA 5C9AC 1G7YA 3DF0A 4LO8A 3V0AB 2WFF2 4MYEA 5KC6A 4WM8B 1LHOA 3O7OA 2PELA 3QH7A 2MHFA 2NM1A 2DWRA 2RM22 4QM8A 2ZGOA 4K6BA 3LGRA 4LE3A 1HRI2 3D5OA 4ES9A 3VBSA 2K0GA 1BVP1 3KSCA 4EV0A 2E53A 4Q4Y1 3RMYA 1ZBA1 2SLIA 2Q8OA 1W0OA 4FPOB 4DS0A 1C1FA 2UWCA 1OA3A 3ZXGA 2AH2A 2ZX2A 2ET7A 1LEMA 2ZJCA 3JCIA 2YROA 1VBD3 3USUB 2WNVC 2GC1A 3JB4C 4XYXA 2JDZA 4OUSA 4XJUA 4AE2A 3WR0A 2PFWA 4AVTA 3WDTA 2OVUA 1O3SA 2HWE1 1H30A 3HAGA 4UXAA 3LA2A 4LT5A 1UIJA 4XQWA 4GH4B 1NA1C 2OZJA 4XQ4A 3BIWE 1MQTA 2E7TA 4Y1XA 2AREA 2RHPA 3HD8B 4GWNA 1OLRA 4FCAA 4Q1RA 1SCRA 4AVVA 1QJY3 2GNDA 2RS51 1KRIA 4LBQD 1AYM3 2GNMA 1VBE2 3M1HA 1XNDA 3ZPYA 3KGZA 1OLQA 4YGCA 1UW8A 5FBZA 1ZZ6A 1ZZ8A 2W0XA 1DQ6A 3VBSB 2XG3A 1UU5A 2Y26A 4IL7A 4V1PA 2Z5WA 1WD4A 1PNFA 2P17A 5L7OC 2YHJA 4Y5Z0 3D8CA 3ZN5A 3J8F2 2Q1MA 3POSA 4JVAA 4WM7A 2JEMA 1Y3TA 3LCPA 3FX3A 4J6GA 2BFUL 1LOGA 1PO22 4I3GA 3WX5A 1I1EA 4JV4A 4YGDA 3TOJA 2WIIB 5JSOA 5GKAC 1W6NA 3D0SA 2DVFA 1VBE1 4E4ZA 4LHKA 2UY9A 3QCWA 1A6CA 1N1VA 5C6CA 2X8KA 5A32A 2IC1A 2HKXA 2D7FA 3NL1A 4LLFA 1VBC3 4MGZE 3BTAA 1MQTB 1O3TA 1EPWA 1I5ZA 3IDCB 3VBUA 3AKQA 5CIRA 1U5YA 2VG9A 3ROUA 4G9SB 4D94A 3ZYRA 1QXPA 2WLQA 4FPKA 2OW4A 2RR12 3BOWA 5DUUA 1S2KA 3AP7A 3N7LA 2VNRA 4QU2A 4YARA 1SMVA 3UKTA 2EALA 1BK1A 5JZGA 5BXXA 5E1RA 3J4UH 1FI2A 1GICA 4HVRA 1ENRA 4KWLA 3VBFA 3AYAA 2XPJA 3AYDA 1XU1A 2XBO2 1TME3 1C1LA 3RRDA 2EIGA 5CG9A 4IEZA 1H2MA 3PHMA 2Q4SA 4WM7B 4I0WB 2HWB2 3LSDA 3RJ2X 1JOJA 3VLBB 1I6XA 4EWDA 5SV8A 1S0FA 3W59A 3FUOA 1QKQA 1S2BA 3VDDA 1W6NB 1JUIA 2PAKA 2TUNA 4XF0A 1VAMA 4WVMA 1Q8QA 4RD7A 4A7YA 2WT0A 3ZXFA 5A32B 1FAYA 3WDXA 1REEA 2XBO1 3M3EA 3A4UA 4MXVA 4XIKA 2HEVF 1N1SA 3AMQA 4Q4X1 1FMD3 4HKOA 1ASJ2 1H2KA 1R093 4W6XA 1RUJ3 3VHRA 1TNRA 1DBNA 4N9IA 3VBUB 2HWB1 2RS31 1QQP3 1LHNA 1MS0A 2GU9A 3IMNA 1RVF2 3VHNA 5KXDA 1X8EA 4Y22A 1HRV2 2YDEA 3H3ZA 3IN9A 4M3CE 1BYHA 1Z7S2 5JZGB 3RI8A 3RI9A 1SCSA 1LGNA 4X6QB 1YIPA 3VBFB 2FZ2A 5JI7A 3H8UA 2VMHA 2P3IA 1LEDA 3ES4A 3KQRA 4XEZA 1R083 2GZWA 4AGVA 4Z07A 4LE4A 1DU3D 1VIWB 3MLLA 4ZKTB 3ZMNA 1H8TC 1BBT2 1MZEA 4IEVA 1GSLA 1CESA 1LOFC 1OOPA 2LTNA 3VDDB 4CEWC 5GLZA 1Q8SA 2RS13 4WVMB 3ZFEA 4KU7A 2ILMA 3MIGA 2DUOA 5E89A 4N7IA 4P9WA 3RSJA 1MZ6A 4QPIA 4DRVA 1KDMA 2JE9A 3W58A 2I07B 2CYFA 4WVVA 4XIOA 2E7AA 3VZNA 3SMHA 1O91A 2R6QA 4XJ9A 2ZX3A 3PVEA 2D6LX 1QH7A 1F31A 1FYUA 5D1IA 2JG8A 3VL9A 3D82A 3MEPA 1LOAA 2FQPA 2ATFA 2ZACA 4N9HA 3CJIC 3R05A 4JGZA 2GC0A 1SLAA 5BYNA 4ASMB 4K9SA 1FOD3 3AP4A 4XBQA 5F6KA 4COWA 4CP0A 3VKFC 1QDCA 4N43A 1V9U3 3DUIA 4CRQA 1IS5A 1PZ7A 1OMIA 2UYBA 3M3OA 1LKNA 4Q0VA 3PMSA 1NZCA 1AL23 2B5HA 1H4HA 3NO8A 1OOPB 1DGWX 1LECA 2PN5A 1MVEA 2R16A 4EN7B 1DQ4A 1LRHA 3ZFEB 4CDWC 1VBD1 1QJY2 2WSUA 1ZZ9A 2JKBA 3L9JT 4PDWA 3MICA 4QPIB 1V6IA 1RUNA 3ZFFA 1ZRRA 2DCTA 3DKWA 3ZIXA 4LNVA 3WG2A 1V6KA 5AVAA 3LA7A 3WDVA 5GZGA 1IGOA 2NQYA 4WZFA 4XBNA 2VVEA 4WM8C 4AW7A 2ZZJA 3CNAA 2R042 1S0GA 5ACA2 4QXKA 2PHLA 1SFYA 4Y1YA 3WP6A 5KXCA 3B7MA 1CQ9A 1URXA 2ZGMA 3GBFA 1QJY1 4JGZB 3TNQA 3VKNA 3NV4A 4C0HA 1AYM1 2AYHA 2VW1A 3A0NA 5LRRA 3HT1A 3JQXA 1LJ7A 4N43B 4FAGA 1SBFA 2A71A 2PLV2 3KT1A 3MDPA 2QZ2A 3SCHA 5L36A 3APBA 2ZPXA 3MW3A 2VVFA 2VU9A 1RUH2 2QUOA 2UU8A 2A3XA 3PVNA 1LHWA 2GDFA 4H7MA 5FOBB 4AI0A 2R071 1LHVA 3BCWA 3TRSB 1MZFA 4Y4YA 1GNZA 2VPVA 4PDWB 1LR5A 3VBOA 2IFRA 2VOWA 1GQGA 3ZFFB 2X53S 4GH4C 3ZSMA 3B9IA 4PQ9A 1DF0A 4PLOA 4UW3A 5FAXA 1TME2 4FQZA 1S0EA 1JW6A 5JR7B 4K40A 1VBC1 2CWSA 3WP4A 3ZXAC 5EV7A 3AYCA 2YPJA 3WQ7A 3HR9A 1WLCA 2R49A 1CAUA 3ZMOA 4CEYC 4OHWA 2O8QA 1KXGA 2RMU3 3ECQA 4F8AA 1QHDA 1ND2A 1TEIA 1O4YA 5E16A 4P9IA 4FTBA 1ULGA 3VBSC 1HXS2 4Y26A 4XDQA 2HWD3 2PHUA 2EF6A 4BH9A 5K0UC 1AR62 5JOWA 4Z2WA 3AP6A 4FPYA 4L8QA 1ENSA 1R092 1UZZA 1RUF2 4GA9A 4LO4B 3U07A 1RUJ2 3WHUA 2F6BA 2GH2A 3VZMA 3WV6A 4XBLA 2UWBA 1QQP2 5KBFA 4YZ1A 1RJ7A 2YGLA 2VUJA 2RJLA 3H7YA 2ZGNA 4COYA 1MS9A 2XLGA 3ZXLA 1SEFA 3CU7A 3VBOB 1SLCA 1RHI3 2FZ1A 1XE7A 2GAUA 3PNAA 1DG6A 4XMIA 3ME2A 1UPSA 3ILRA 2DYCA 4XOGA 4DB5A 1H1IA 1XNCA 2XJQA 4O9GA 3TYJA 5DZGA 3GZAA 3KB5A 3MFAA 1FMD1 3DPRA 2ZKNA 4IEUA 1RUJ1 3RYPA 1U5XA 3C3VA 4Q4V3 3M8LA 3FE5A 3ZFGC 2ZAHA 1CAUB 2JG9C 4B4PA 4BE3A 1JXNA 3MLKA 3EQEA 2HWE3 3QLQA 2ZX0A 1KQRA 1ND2B 2EXIA 1RUC3 1QMJA 4Y1ZA 3UK9A 5JOZA 5AFEA 4LUKA 4K21A 4JDNA 1G6NA 4DOUA 1X7NA 2PQQA 1LGCA 1AHSA 1KJLA 3B02A 4RS5A 4ZU5A 1MVQA 2IXCA 3H9AA 4WM7C 3VV1A 1PVC2 4NHMA 5E88A 2IZWA 5J36A 3SITA 3POYA 3WP3A 4FPGA 1CGPA 1LU1A 2RS53 1R081 4FPJA 1W6OA 1AF9A 4X6RB 3W9AA 1ENXA 5CNAA 4RA0A 3ZN6A 4LO7A 1AVBA 5L19A 2WZR2 2XL9A 1AYN2 1ZZBA 4R8HA 4JC1A 1SDWA 3OYWB 4P14A 4IV3A 2RS11 2X5IC 5IT6A 1WLWA 1EAH2 4CDUB 3D6EA 4RFT0 3WG3A 2YZ4A 2EXKA 1DGLA 5LEJA 2UYAA 3BALA 1D4M3 2WNUA 4L97A 4OLLA 2DFCA 1LTEA 4YZ2A 2C5DA 4Z8BA 2VGDA 4LR4A 1C4RA 3V65A 3WHTA 1JTZX 2PHWA 1GLHA 2CAVA 3DPRB 4L99A 1V9U2 1POV1 3R4UA 3OJBA 2XVKA 2G9GA 3ZYPA 2DF7A 2ARXA 4KWKA 4TYSA 2FMDA 4NWVA 4PBOA 2PTMA 4MH0E 5J98B 4RS5B 1XNBA 1G9FA 2R32A 3JUUA 4RQPA 1WBLA 3NKTA 4XW3A 2VNOA 1S0IA 1FOD1 1FNZA 2B45X 1XQNA 2RJKA 1N3PA 1WLTA 4QQPA 1LGBA 4FQ4A 1LU2A 1W6OB 2AR6A 4IETA 3VDDC 2WNEA 3ACLA 1ZRDA 3WUCA 4YFZA 1XYOA 3ZN6B 1WMEA 3AM2A 1AL21 4HLTA 1F5JA 4UW4A 5KXBA 3HBZA 5KHIA 1HIXA 4IV3B 1XE8A 3MIBA 3NV2A 4Q8LA 3OY8B 4FXGB 1WCDJ 2WNUB 3NVCA 2X29A 4ITCA 4YGEA 3QD6A 4PIXA 1D2QA 1KD7A 1WCKA 3VBHA 2IXIA 4KGQA 4DINB 1OHFA 4GULA 1FV2A 1ZBE3 1YFWA 2DCZA 3N7KA 2PAMA 5T5LA 2Z79A 4HSLA 2LM3A 2QE3A 2ZGLA 1GYKA 2ZCWA 4SBVA 1C5IA 2ZOEB 3LSEA 4OVEA 5HCBA 4Y24A 3ST7A 3ZSKA 4N7UA 5FRAA 1X82A 1VBB2 4QPGA 5JVVA 2WL1A 3TN93 1GZWA 1EY2A 5KHKA 4FAHA 4RQPB 1QOOA 3MIHA 2EA7A 2XLFA 5DZEA 3SNMA 3L2YA 1CAVA 5E8AA 2DU0A 2G9FA 3DN7A 3EJKA 3Q9OA 1OOPC 1S0BA 4YM0A 4YM2A 3UV9A 1YO8A 1RUG2 5HXVA 4WVZA 3V64A 4IV1A 3ZFEC 4XFAA 4YW2A 5DDJ1 4D69A 4I02A 4I2OA 2CNAA 1YIFA 1VAVA 1BMV1 3GZTB 1IS4A 2QFEA 3FZ3A 3M2MA 1JYIA 4LLOA 4IEXA 2XVLA 1V70A 2HWD2 5GLTA 3VBRA 5T54A 3MIEA 4PLNA 4CYDA 2VOXA 4YG3A 3WUDA 4MUVA 4AWDA 4AHYA 1A3KA 2BNNA 2VNGA 3IWZA 3O0WA 4OULA 2I74A 2XB6C 4XJZA 4YVSA 4FT8A 3NAPA 2MEV3 1O5LA 4RGAA 4OI1A 1FT9A 2VULA 1DDLA 4W6YA 2BTVC 3IT8A 4QPGB 2RMU1 4HPKA 2P34A 4MZUA 1C28A 1GZWB 4N43C 4Q4W1 2NLRA 3VHOA 2HWD1 1QNYA 1ZBA2 1CAVB 1K5MA 2HWC3 2P3JA 4S2FA 3KT4A 4QD2A 5CU1A 1NCQA 4B3NA 4OI4A 4ASLA 3H0OA 4BHPA 4IV1B 5FPZA 4FSJA 4LULA 1HQWA 2I45A 5KHHA 1DIWA 4XF9A 1SLBA 5C4WC 3V56A 2HWE2 2XKOA 4ATEA 4YYOA 3TB0A 5T5JA 1RHI1 4GB33 3VBRB 2W52A 1D4VB 3G7DA 2WQZC 4F83A 4COUA 1ND3A 3FWEA 3KD4A 5JSPA 1EV13 1N3OA 2WSVA 4KL1A 4P9GA 5IK5A 1IS3A 1DZQA 4AK3A 4GMP3 4KG0A 2RS52 4Q4V1 4BQ1A 2GNBA 4R9BA 1IOAA 2PYTA 2QNKA 3AB0A 1U5ZA 4K1YA 5IK8A 3VZJA 4HPKB 4YG0A 1J1LA 1Q8OA 2DTWA 1RUC1 3WNXA 1WW5A 1DYPA 1CN1A 3TNPB 2ZZQA 4P9LA 3IM0A 1K5MB 1AR93 4GQ7A 1NCQB 5I91A 2IXHA 5T55A 5CB7A 2IXLA 3UJQA 5I0UA 4N53A 1YJLA 5JCTA 2Y0OA 3IDEA 3NWKA 2ERFA 2GSYA 2OPKA 2XH6A 5EYYA 1A78A 4IEYA 1MS4A 1CR7A 4YRDA 5JIUA 1FNYA 3IKWA 2VOKA 3NSTA 3VHPA 1DQ5A 1LB2A 2BVVA 5I8YA 1V6NA 1ND3B 4DMIA 4YM3A 4OHZA 2QQPA 4Q0SA 3UJOA 3SLIA 1D4M1 2WS93 3O5SA 4ORFA 4BMEA 3G6JB 2WQ4A 2BBVA 4OHYA 1GKBA 2R073 4ONUA 3AMPA 1NG0A 4JGYA 3AKTA 3EHKA 4AFBA 1ND2C 1XU2A 2LALA 2K2SA 4MSVA 1GBGA 3QOPA 2V73A 3VZKA 1BVVA 2HWF1 5FCCA 1E57A 4CDQA 1OPOA 1WCSA 3LAGA 4M01A 2GALA 3VUOA 3VN4A 2ES3A 2GN7A 1MS3A 1ULEA 1AX1A 4BOWA 3J26N 2OZ6A 4AHWA 3S7EA 5BNPA 4N53B 3ZYIB 1XYNA 4MGIE 3RNSA 4LO5B 5GLWA 4DNYA 1J3QA 4CDUC 1AUYA 2P2KA 1MS5A 4R52A 1Z0HA 2E51A 2QZ3A 3USSA 2YUEA 2A6WA 5FLJA 2QCSB 4HL0A 4Q4X2 3AP5A 1MACA 3ZXEA 4AFCA 4CDXA 3ZXDA 3ZSLA 3MGUA 1H4GA 2RS32 2ZBJA 1DQ0A 1JN2P 5BNNA 1TMF3 5EJ3A 4QHBA 3OD0A 1QJX3 2HEWF 2CL2A 2BQPA 2FBEA 1ZBE1 2R063 3OBTA 4BLIA 4E4SA 5LK7B 2CGPA 4DY3A 4DY5A 2D97A 3E5UA 3N36A 1RGSA 3LB9A 4NHKA 3M3IA 5JAXA 4LEJA 2CAUA 3AJZA 4CDQB 4U36A 1RUOA 1HV0A 1DGWA 1M4WA 1PMIA 3M3QA 3PLQA 3TN91 1BJQA 4XPVA 5FDBA 5JSRA 3KCXA 2JE7A 4FTSA 3S30A 3OPZA 5BNPB 3P3NA 1HV1A 1WLDA 1BXHA 3CLPA 2D44A 4ISQA 2A6XA 2BVBA 1O4ZA 3AZYA 4MX3A 1D0HA 3T1MA 1WMDA 2D5HA 1NCRA 3K48A 2VQAA 1HKDA 1KDKA 4CDXB 2JICA 4YW4A 3URFA 1VRH3 2ZTNA 4KH9A 4MVTA 3AZXA 3HMYA 2HWC2 4Q1PA 5BNNB 1X36A 2QDNA 1CPMA 3N4MA 4EJRA 2VMGA 5CADA 1J59A 4LTAA 1RB8G 1EP0A 1UX6A 1UPIA 1AXKA 4B4QA 1X33A 4QQOA 1KJRA 4S2DA 5FOJB 3VKMA 2B7YA 5B2GB 1UU4A 2MEV1 4HETA 5HCAA 4RQPC 1VALA 1N1YA 1WD3A 1Z78A 1AZDA 2D6PA 1AJKA 4WVWA 4Q29A 1AL0G 4ZU4A 1POV3 2ZGUA 3P3PA 5ABJC 1QWRA 2DUQA 4GB32 4Z92B 4YVWA 2HWC1 3PJQA 4OFGA 4W65A 4AQSA 4Y22B 1VBA3 3JBG1 2D6NA 4AVCA 4XZPA 2YGMA 3KM5A 3EO6A 5F6LB 1VBD2 3HIFA 1Q5OA 4YLZA 1OI6A 5BNOA 1NCRB 1RUI3 3B3QE 3O0VA 1AR71 1KS5A 4RR3A 1RMU1 5D8AC 1H0BA 1HDKA 1R1A1 4FOVA 3ILNA 4K8FA 4E2GA 4GB31 5HBAA 1O3RA 1RUE3 3GF6A 4RHV3 3ZSEA 1AR92 1EV11 2WWSA 5DG2A 4TZDA 4JQRA 3E5XA 2XVGA 3WW3A 4Q27A 5CFDA 1RTVA 4M0NA 4GMP1 3VZLA 1RC6A 1WUVA 2IFWA 2ZGKA 3THPA 5EFUA 1PO13 1Q3EA 2IXKA 1AJOA 4D7SA 1AYM2 4RL7A 2D3RA 3R6SA 4BCUA 2CY6A 2C0ZA 3JZVA 1H1MA 1UU6A 1PK6A 3D0JA 4BLJA 4I01A 5KXEA 1KS4A 1J3PA 1SQ4A 1WBFA 3MIFA 3GYDA 1COV3 4JRAA 3CL1A 1A8DA 2JG8B 1V6LA 1AR91 3PJYA 3AFKA 2WS92 1VAKA 1PM7A 1LENA 1WW6A 2R072 4M3CA 1L3JA 2B39A 2WKKA 3FBMA 2W68A 1VR3A 4C90A 2WLPA 5BNOB 2VH9A 3B69A 3ZO0B 3ZXKA 3H1MA 4IEWA 4RR3B 1VB2A 1S55A 4QMAA 3MPPG 4HBNA 1KFXL 1ZREA 3RPQA 1VBC2 1S0DA 4YW5A 2FHRA 5DDJ3 1W2UA 2EXHA 4BWOA 2ZX1A 2WS91 4IERA 1H9PA 3N3HA 2WNVA 4JDMA 3C2UA 3JU9A 4FP2A 2B9UA 1WMFA 4OZXA 3ES1A 3AYEA 5CFDB 2ZKLA 4EN9B 4HKWA 1ZRFA 4Y1UA 4KWJA 1MEC1 1C3HA 1K5MC 2V5YA 5LRSA 2DV9A 1YRZA 3ZX7A 1J58A 4HANA 4QQ2A 3SCFA 5GM0A 1PK6B 2R30A 4BIFA 4DFSA 3WY6A 2PAEA 3OGJA 4LBOA 5JPMB