5BNTA

X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to nadp from pseudomonas aeruginosa
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
368
structure length
368
Chain Sequence
KRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVIDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title X-ray Crystal Structure of a Aspartate-semialdehyde dehydrogenase bound to NADP from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Oxidoreductase
total genus 115
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5bntA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bntA01
3FSRA 3GGOA 3RUCA 2LDXA 4AJ4A 4DRYA 1QXSA 4OSPA 4WOJA 4Q3EA 2PH3A 4EZBA 2CVZA 2JD2A 5KVSA 1B3RA 2B36A 1DRUA 4UREA 1UP7A 2W2KA 4YJDA 3RU9A 1ZO8A 5U9CA 4UUPA 1VM6A 5GY7A 4R1NA 4MKXA 1BWSA 2DVMA 2VN8A 3L4BA 1U8FO 4ALIA 3ZNNA 1R66A 4OSOA 4L4SA 2PD4A 5ADHA 1LDGA 3QA9A 1KS9A 4AJLA 2BFAA 3PIIA 3OHSX 3F9IA 5G0WA 4BO2A 2O50A 2VCYA 3NRCA 4XDYA 1QR6A 1T2FA 2OBNA 4C7KA 1DAPA 4GGOA 3L4BC 4IS3A 3N58A 5I7FA 1LU9A 1CQJA 2VOJA 3JQ6A 3O38A 3Q2IA 3DFZA 4OJNA 3U4CA 4R3NA 5KJCA 4YT2A 2FZWA 2VZ9A 3WGOA 3OJFA 3EMKA 4YJHA 1C14A 1NPYA 5T5QA 3WGZA 2RH4A 3BIOA 2C29D 3A4VA 1PZEA 3IS3A 3K9QO 3EAGA 5JPIA 1B7GO 3K96A 5BQFA 2JJYA 4L74A 4O5OA 2YHIA 1X14A 3RUHA 1GCUA 4DWVA 2O3UA 3ZNPA 1I2ZA 2BD0A 3I9JA 2PZLA 3WIEA 3DHEA 2NVBA 5I7EA 5T57A 3TZCA 4FBGA 5T73A 2QX7A 1WP4A 4HNGA 3CZMA 4RO0A 2UVDA 4AJ2A 1OC2A 2AEJA 2HMWA 2NVUB 3PJEA 4E31A 3RKRA 4IZHA 1E3IA 4YQZA 3RUFA 3ZWYA 1HYGA 3BA1A 2Z1NA 5I9MA 5CDSA 4N54A 4R5MA 2ZTVA 1LLDA 3RBZA 3WLFA 1MV8A 1NBOA 3TRIA 4PLVA 3HFSA 1Y9EA 2DQ4A 3AW9A 1A7KA 3NDRA 5AXDA 1ZBQA 1MG5A 4RV9A 4CPDA 3CINA 2J5RA 5H82A 1W0CA 4K26A 3JD0A 4HWKA 4K1LA 2D5CA 3B20A 3OQBA 4PLFA 1KY4A 4BGEA 5ICSA 4NNJA 3KUXA 1P0FA 4IQGA 4R3WA 2O3SA 4RVSA 3GHHA 3PFWO 2EJVA 4UAGA 1P31A 3UH1A 3JQCA 3RIHA 1DLIA 3UN1A 4NBTA 2Q49A 3U3XA 5J9GA 1LSUA 4EJMA 1B8VA 1CIVA 3GPDG 1SPXA 1C0LA 3GUCA 1GL3A 3KYCA 2WE8A 1NX6A 3JQEA 1HE2A 2O3RA 3JV7A 2GF2A 1PR3A 1MGOA 4AJJA 2DTXA 1JU9A 2NU7A 1A4IA 2WYWA 4U6SA 1IOLA 1ADBA 3TJRA 4PG5A 4MPDA 4CM5A 1LQTA 1T1SA 1HEUA 1UXHA 1N9GA 1VJTA 1I3MA 1GYQA 1Y5RA 1AXEA 1UP4A 3EHEA 4RL6A 4BNKA 1LI4A 1Z73A 3QWIA 5TC4A 3IQDB 3VPGA 1K89A 4J2OA 3GNQA 1ENYA 1OMOA 2Q1SA 2RHCA 2OGUA 1U3TA 4S3MA 5U4QA 3TZHA 3DWFA 4GI2A 4WASA 2FY8A 5A05A 4ZQEA 1AGNA 1X1TA 3BMNA 5IZ4A 3FCOA 1N7HA 5G0SA 1MFZA 1MC5A 1E1NA 4WLUA 2PKQO 1NVGA 3DZFA 5DBGA 2VNAA 1JAYA 3QWAA 5A04A 4JNKA 1GY8A 1R37A 3IDSA 2VNSA 3ZDFA 2VRBA 1XA0A 4HKTA 1YXMA 3LYLA 3DOJA 5DF1A 1YVEI 3FNEA 4Y6SA 3PLRA 3RBXA 3OJ0A 4E2WA 1CETA 1EVZA 5T8KA 3UICA 2X1HA 5T64A 4OQYA 2RHRA 3ADPA 3QVSA 2BFOA 3DFUA 2CMDA 3F5SA 3PK0A 4QFDA 4DL9A 3K30A 3HUDA 5EJ2A 3QW2A 2ZCUA 3VPFA 3QV1A 5LDHA 3GDFA 2VWHA 1YOVB 4XJSA 4AVYA 4OKNA 2V6FA 4IDDA 4ZQHA 4D44A 5FWNA 1A7AA 2EERA 3EVTA 3DONA 3KVOA 5T8KC 1ZW1A 3JTMA 4O6VA 3VTFA 1I01A 5IDWA 4IJVA 2VHYA 3NT2A 4CR8A 3VH2A 5JDCA 1PJBA 1UH5A 2SCUA 4BNTA 5KNLA 1PU2A 3S55A 3LLSA 1FF9A 4ZHSA 1C0IA 2JAHA 4Q3BA 1MFPA 4YBZA 1E3SA 3VZRA 3WQSB 2DPGA 2E82A 3AM4A 3NT5A 1EQUA 4K6FA 2VZ8A 4PG7A 3AOEA 3K2BA 1SC6A 2A94A 5JNLA 2HCTA 3PZBA 1NHWA 3E5RA 3H9GA 2VHZA 3LK7A 2EW8A 3GGPA 1MLDA 4WLFA 3RKUA 5KJFA 4CM1A 2AQIA 5JDCC 2Y1EA 1B8UA 4FR5A 4WLOA 4GX5A 4YRDA 4BO7A 4ZGWA 4L8VA 1S6YA 1H93A 1I5RA 3AOEC 4HV4A 1N92A 1C3VA 3DMTA 2ZTMA 1ZXBA 3OQ6A 3VKVA 4YR9A 5EPOA 1YWGO 1O95A 3GFBA 1I24A 2Y1FA 3BMQA 1DAOA 2CDCA 2Q99A 1ISJA 3S8MA 4AJNA 3ZHXA 1E7WA 4TZTA 5BNFA 1QYWA 1E7QA 2ZQYA 1KVUA 1XELA 2CF6A 5CDGA 4YAGA 1Q7BA 4M1QA 2HSDA 3OJLA 2WSBA 3PPIA 1KVRA 4JIGA 5IJZA 3GK3A 2B69A 3HSKA 3OA2A 1BDBA 3D4OA 3WGIA 2ZB3A 2VQ3A 4MJLA 2BRUA 3LZ6A 1EEHA 1RM4A 5TX7A 1C1DB 4XGKA 4II3A 2OP1A 2C20A 1KEVA 2EHDA 3GN2A 1X0XA 1DPGA 2YV2A 5JC8A 4D3FA 3VZPA 3KB6A 4TRMA 4DLLA 1E7SA 1EK5A 1V9LA 4OOEA 1GYRA 4BNMA 3VAZA 5AXAA 3ZWCA 2O48X 2UDPA 4O59O 2D3TA 3OIDA 1ZH8A 1PS0A 1ZEMA 3RFXA 2WJPA 3FNGA 1JDJA 2DM6A 3BMOA 3U4HA 1YQXA 3L9XA 1PQPA 4A26A 5A9SB 4J6FA 2C54A 4OYRA 2JCXA 3LF1A 4CMBA 1ZK4A 4IXWA 3RFTA 2NTNA 4RDHA 1Q0LA 2IXBA 1T2DA 3I23A 2DLDA 1M67A 4ZA2A 4CM6A 4EW6A 2W4QA 2IZ1A 4ZN6A 4OMUA 4RVGA 4R1SA 3EDMA 2GSDA 4KMSA 3PHLA 4WLVA 3Q0EA 2DTDA 2E48A 2WMDA 4K28A 5I8ZA 5EL0A 4YAEA 4IJWA 5B12A 3ZWWA 3GR6A 5IZCA 4W9NC 3IKVA 2VUSA 1CF2O 2PKRA 2NTJA 1OBFO 1WXDA 1I2BA 4ALLA 3HB4X 4NBRA 1TLTA 1LSOA 1ULSA 3PHJA 2P2SA 4MOWA 3ZV4A 2BF7A 1PGOA 2B5VA 4S1VA 3PRJA 4DMLA 4PZEA 1Y9AA 3RCBA 1A72A 1O5IA 4BO1A 3CSDA 1NPTO 3HJAA 3ZWMA 1Z7EA 2OL4A 3I9KA 2VT3A 5ER9A 3KZVA 5JE8A 3FPCA 3NV9A 4YRAA 3ZHZA 4L76A 1ZMTA 3PQDA 1IL0A 2P9CA 2DTEA 3KXDA 4CR6A 1Y8RB 1WAMA 4AICA 1UXKA 1TT5A 3SC4A 2FR0A 1ISFA 2DBVO 4CJXA 4CM4B 5JCJD 4UUNA 2NQ8A 2C7VA 5A06A 2OFPA 4YQYA 4A03A 3U5TA 2I76A 3E1KA 1EMDA 2P9GA 3G17A 4D0SA 2WM3A 4XA8A 3BMCB 4PG8A 3INRA 3FWZA 3WSWA 4WEOA 4J7CA 3K5PA 1Y8QB 3U4IA 4LCEA 4NJMA 4O1MA 5A02A 4FJ2A 3BHIA 3E82A 2DFVA 5KVQA 3SJUA 1DFHA 4N18A 3H8VA 5IXSA 4G65A 5AOVA 1LSSA 3ZGYA 3GC6A 4RCVA 2V6GA 4DA9A 3ABIA 1HLDA 1NWCA 4A73A 3UXYA 4MIYA 1LNQA 3ZI0A 2PLAA 3P2OA 5F5LA 3WLEA 5L45A 4RPHA 4XYGA 5JDIA 2C5EA 3O9ZA 3PQFA 2QQ5A 2NLOA 1XGKA 2OBYA 1JVBA 3ENNA 4A5OA 1DC6A 4JX8A 4WGGA 5B37A 2VYVD 4ND2A 4MP3A 3RBVA 4BUCA 4GSLA 3PGXA 1JA9A 2GLXA 3I52A 1H94A 4Z6KA 2VHWA 4ITUA 3V1YA 3JQDA 3ROKA 1WDKA 2IEBA 3UKOA 3PYLA 3AU9A 4TRNA 4E13A 3F4BA 2Y66A 1KYQA 3DQPA 3NTQA 4NU6A 4XQGA 4C7JA 3PIDA 3H9JA 1LRKA 3B1JA 1WDLA 3L77A 4IJKA 4BNFA 1K0UA 1Y7TA 2ILTA 4GAEA 4GVLA 2C7GA 3INTA 4FSHA 1KC1A 1ONOA 4PLYA 4L0QA 4J9UE 3RUIA 1GZ6A 3WBFA 3KLPX 1IB6A 2CD9A 3LT2A 2X0JA 2J5KA 3MJCA 3VZQA 5I9NA 2BGLA 3ZNOA 1ONPA 5LDGA 1OZAA 2F00A 1C1XB 4YPOA 4H3VA 4PRKA 1EUCA 5EIOA 2E37A 2E49A 3ANNA 3EGOA 3JQ8A 4LCJA 4MVJI 4ZQFA 3QWBA 4A2CA 3WNVA 5BR7A 3WMWA 4GVXA 2FN7A 3RROA 3WYEA 4CMEC 1H6DA 3I83A 4ILKA 3B1FA 4ONEA 4URFA 1DHTA 3CZRA 3EW7A 1ADGA 3VTZA 1PGJA 3PJGA 1RM3A 3GAZA 2E4AA 2O7QA 3WWZA 3WWYA 3LDHA 1ARZA 4BQPA 3JD2A 1UZMA 4HBGA 5EQFA 1XU9A 1AXGA 5ER6A 3U09A 3H6KA 4Q3NA 1U1IA 2ZYGA 3IC5A 1R4NB 3MOIA 3MJVA 5CAEA 3SLGA 2G5CA 4CQMA 3GZNB 2ZTLA 4B3JA 1DIHA 3AM5A 2OORA 3O8QA 1DEHA 1T24A 1DJNA 2VYND 3E5MA 2QIOA 4BV9A 2AA3A 1ZEJA 2X7HA 4BV8A 4RQUA 5CG1A 1MP0A 4FOOA 4J1TA 2H63A 1IULA 2CFCA 2GR9A 4IUYA 4D41A 4XB2A 1I32A 1EE9A 2HK9A 3HDJA 3MWEB 4TQGA 5K9ZA 1WLYA 3HWRA 2NU9A 5CP8A 4NFSA 5T6BA 3GVIA 3BTOA 4UVDA 1IPFA 2IZZA 1V35A 4DPMA 1ZNQO 4IQ8A 3WGTA 1SAYA 1KERA 1LQUA 4YT4A 4TROA 4XZ3A 3WGYA 3DDNA 3RQSA 3M1LA 4YVFA 3PI7A 1PJLA 1VSUA 2YFQA 4ALNA 2OZPA 2ZB7A 3JQBA 4E2YA 2OMEA 2CSUA 1HKUA 3IMFA 1H6AA 1ZXLA 3ETEA 1JTVA 3DBRB 3TQHA 1E7MA 1I3NA 1FDSA 2PA3A 3FD8A 4JN6B 4R16A 1K6XA 4QUKA 1P45A 1ZK2A 3UHAA 3S2EA 5BNTA 3AK4A 4NK4A 1F17A 1H6CA 3KEQA 1E0DA 4U5QA 2TMDA 3PFFA 3S2GA 1CWUA 5EN4A 4RGBA 4RQTA 1YDWA 2Y1CA 3TWOA 4B4VA 3KYDB 2ZK7A 1P77A 4K9DA 3DBHB 4NU5A 4ND5A 3IL2A 2OUIA 4DYVA 1QYCA 3I9NA 4XR9A 3RFVA 3ZW8A 5GZ3A 2Y99A 3HDHA 3LC2O 1U3VA 2GGSA 3QVTA 1HSZA 5IDYA 1L7DA 1FDTA 4BNJA 1P44A 3QVWA 2I66A 2J8ZA 3FN4A 2EKQA 1J6UA 1TB4A 2X0IA 4WPGA 1J4AA 4OGWA 4ROSA 2HRBA 3GDOA 2IDZA 1EVIA 1EBFA 2V6BA 1YJ8A 4NDNE 3ZN2A 1HDGO 2XAAA 5AXCA 1DLJA 3VDQA 4TKMA 3JQGA 4RZIA 1E5QA 1NVTA 2ZB4A 5J23A 3E9MA 4DLBA 1ISGA 3ZNQA 1U2GA 2YDXA 3VOSA 3NJ8A 1ZK0A 3VDRA 1RYEA 3JQAB 3JQ7A 1IYZA 3WQRA 2POQX 4BO6A 2VWPA 4AJHA 1YL5A 5GZ6A 4CM9D 2D4AA 5DCYA 3CIFA 3MJTA 4CQLA 1HSOA 2W2LA 2X5OA 2JCVA 5JC1A 1JVSA 2YV3A 1GUZA 4J49A 2Q2QA 2BI7A 3H9UA 4RPKA 4RORA 5JYDA 2CF5A 4GH5A 1W8DA 2QW8A 1HF3A 3DZHA 5JLAA 5CHEA 4P8RA 1ENOA 2R2GA 3NYWA 3Q9UA 4I5DA 4H16A 2P9EA 3ZU4A 3VPHA 2OP0A 1P9LA 1A4UA 2NNLD 3GAFA 3DZKA 4GLLA 3FNHA 4YT5A 4AJIA 5IG2A 7MDHA 4YJFB 1M76A 1I2CA 2QZZA 5DULA 4D79A 4TMFA 2WWRA 1BXZA 2X9NA 4B3IA 1P1FA 2AEMA 3H7AA 1ZMOA 2HDHA 3EY4A 4U0JA 3MWDB 4XWYA 2YQ4A 1SCUA 3ZU3A 5FI5A 5EERA 2VWGA 2AE2A 1KY5A 4WLNA 4R5HA 2HMTA 3A28A 4XYMA 1Z74A 2Z5LA 4BMNA 4OKIA 2O23A 4GKVA 4WKGA 3CH6A 1ZSYA 1ISMA 3KSDO 2XF8A 2HKIA 3AWDA 2C59A 2O4UX 3FRJA 4PG4A 3WQQA 3A14A 2FR8A 4EYEA 1I8TA 1NXQA 3GLQA 3KOUA 3L07A 1DHRA 3OBBA 1XDWA 5L95A 1HDOA 3WIDA 4AJEA 3BZUA 4ID9A 1N2SA 1ADFA 1R4MB 1QRRA 1E3EA 4CMCA 3GQVA 2Y68A 4JP2A 1KEUA 4IIVA 2D0IA 4R9SA 4XIJA 4I1IA 5KTKA 4PLHA 1NPDA 2HU2A 1CERA 5IF3A 4Z9FA 1ZK1A 4FW8A 2UUPA 4DIBA 2PKQP 1E3WB 1N5DA 2Q1UA 2D5AA 3TZ6A 4Q9NA 4BHTA 3ZWNA 1LC0A 5G2OA 4J0EA 4L75A 4Y9DA 1FDVA 3KYBA 1GCOA 1NQAO 5ICMA 5L7WA 4TZKA 3SBOA 2VUUA 3ZHBA 1JWAB 4IBOA 1PTJA 2HMUA 3VPXA 2DBRA 4JBHA 1KC3A 4OOFA 2CVOA 1SO8A 1VL6A 2RBEA 3SEFA 4Q3DA 2EIHA 1LLUA 4PLTA 1TT7A 1XWFA 2PH5A 4U7WA 1K2WA 2XXBA 2X23A 3MJSA 4FS3A 4OL9A 3E8XA 1BDMA 4JLWA 4RLSA 5JAQA 5JO0A 2ZTUA 2FSVA 1YOVA 4HP8A 4YXFA 4IIUA 1ONNA 1DFIA 4LVUA 3H5RA 3U62A 2X9VA 3UFXA 3ONDA 4BNXA 2GO1A 3WYBA 1D1TA 3T4XA 2D2IA 3O26A 4BKUA 4CV3A 4E5MA 2E6UX 4YCAA 1Q1NA 2J6IA 1FXSA 2A35A 3FI9A 1UZNA 3KRTA 3WX0A 3MJEA 9LDTA 3OQ1A 3PDJA 4B8ZA 3FTPA 2JHGA 1R0LA 1YJQA 4IDCA 4BO5A 4DREA 2PNFA 1MG0A 2B83A 1V0JA 2G1UA 5C7OO 3I5MA 1EZ4A 4D46A 1N1GA 2PD3A 2HMSA 2PFGA 3AM3A 1LC3A 4PG6A 3QWFA 4NI5A 1B8PA 4R1UA 4ZQBA 1T25A 2P4HX 4J2HA 2RH8A 4MP6A 1RPNA 3DHNA 3FBGA 3PLNA 1H0KA 2Y1GA 1AHIA 3U9LA 5L3ZA 2LDBA 4M55A 3PVZA 3H65A 4CM7A 4NK5A 1Z82A 3WR5A 3PGJA 4II2A 1GV0A 3DL2A 2EKPA 2DU8A 3WYCA 3ASVA 1BSVA 1OOEA 3VZSA 3LT4A 1O6ZA 1O8CA 1GQ2A 3Q6IA 3QY9A 3S2IA 4BO0A 4R4JA 1YQGA 4KTVE 2C82A 4BQRA 1B14A 4UUMA 1HDYA 1NQ5A 4FDAA 1WMAA 1R0SA 1TI7A 4RF2A 4W7HA 3DO5A 3EC7A 2PK3A 3IJRA 3JYNA 3QRWA 1P3DA 4CV1A 4Z9XA 5IN4A 4XRGA 3ANMA 2UYYA 4XQ9A 5COBA 3L4SO 4Q3AA 4XDZA 2IZ0A 5AVOA 2W2KB 1YL7A 1DIGA 4R68A 1K6JA 3ON5A 3C3XA 4MVJG 1LRJA 3VH4A 2GRAA 4WOKA 2JD0A 1Z6ZA 1TEHA 5A9RA 2P68A 4BMVA 1LX6A 3V2HA 4GKBA 3PJDA 2WD7A 3WJAA 5A9SA 4G81A 2J5QA 1PJ4A 4J16A 1T2AA 1QG6A 5CEFA 2EKLA 4PZCA 3HHPA 4UVIA 3WMXA 3JYLA 3V2UA 3OECA 4CUJA 1R16A 4AJOA 2RCYA 2GZ1A 2BKAA 3T4EA 4J9VA 4YAIA 3LC1O 3WBBA 2NTVA 3WG9A 3AI2A 3OEYA 4G5HA 1NP3A 2FZEA 1VLLA 5TJHA 2Q2WA 3GVXA 2EF1A 1UDCA 3DZIA 4MP8A 4Y8VA 4J1QA 5CPFA 2CNBA 5F1KA 2DC1A 3ENKA 2DPHA 4MIOA 4LW8A 5DNAA 1EUZA 4WLEA 2O4CA 5KVCA 2WYUA 3ZHYA 3PJFA 4JQCA 2NQTA 4N5LA 4M8SA 3AY6A 1IPEA 2G0TA 3L0DA 2J3HA 1GZ3A 4W7IA 5L7TA 3A9WA 4XGIA 3P2YA 4HXYA 3IIEA 2YHIB 4NBVA 5KOIA 2QG4A 1BTOA 3KBOA 3G49A 4PGFA 1H6BA 4M54A 4BNYA 3WOHA 2GERA 5TSDA 1HDXA 2R00A 4HFJA 4INAA 1VRWA 4YWJA 1EDZA 4L73A 4I9HA 1FDWA 4DC0A 1YS4A 2Y67A 4I8XA 4D45A 1HE5A 2B35A 5BNIA 6ADHA 1XYGA 2QYSA 4FFLA 3ZV5A 4P38A 2JHFA 1Y8RA 3R3JA 5KJ6A 1G0OA 3WTBA 2PWZA 2R00C 4JJFA 2EW2A 1V3VA 3GVPA 5HBRA 2W98A 2EG9A 4BKPA 1FMCA 2HMVA 3D4NA 1HZZA 1HDCA 3BMCA 2ZYDA 1M75A 3MJ4A 2J3IA 3VH1A 3D5QA 4W99A 4MVJD 3DMYA 3U4DA 3K73O 5IN5A 4XR4A 4E5PA 3UUWA 4R9RA 3WNQA 1QKIA 3UCEA 3OMLA 3IUPA 1K5HA 4HY3A 5H83A 1D3AA 1XSEA 2NWQA 2W8ZA 1PIWA 1BXGA 2X58A 4RVDA 3KYCB 4RPGA 3H3JA 1UJMA 2ZKLA 1QLJA 2FP4A 2O3JA 4NQZA 3GOHA 3DZBA 4LVCA 1GPDG 1IZ0A 2C0CA 2VWQA 1Q0HA 1BGVA 5ENDA 2FWMX 4MVJP 1D7OA 1E3LA 4D3DA 3TZKA 3R3SA 3SJ7A 3ORFA 1ZJYA 4XIYA 4AL4A 4TVBA 2V7PA 1U4SA 3MTGA 3IJPA 5DOVA 2JFFA 4W9NA 5JYEA 1NR7A 4BGUA 2AMFA 3GH3A 1ADCA 1PEDA 2IODA 1O94A 1DBVO 2H9IA 2QHXA 4DYDA 4J4TA 1P1RA 3QQPA 1BHSA 4IDAA 1YB1A 4LRSB 3OJEA 1C1XA 2B4TO 2OXIA 1GEGA 1BG6A 4PZDA 4GGPA 2CVQA 4Q39A 2D8AA 5DBFA 1E92A 2C2YA 5F21A 4ZD6A 1CRWG 4Z3DA 4QQRA 1HYEA 1LJ8A 3EYWA 4YYZA 2WEKA 2YDYA 4XB1A 1B2LA 1GV1A 1F8FA 2A9FA 1NVMB 2FRDA 4RDIA 3ROQA 3WXBA 1SOWA 4CODB 4BKQA 3ONEA 5GMOA 1YRLA 3H5NA 4BNWA 3R1IA 3H5AA 3I6QA 2PGDA 4XYEA 3HE3A 3TF5A 1ZSNA 3LLVA 5IFLA 1I33A 2B37A 4RVHA 2BGMA 4CM3A 3EK2A 4ALMA 2DUWA 4HFNA 7ADHA 4Z0TA 3OSUA 4IDEA 4KQWA 1ID1A 3GZNA 4BO9A 1YB4A 1A27A 2EP5A 2IRWA 4OM8A 3TOZA 4R51A 4RPLA 4R69A 2YY7A 3JQAD 4E4YA 2EEZA 3GZ4A 2X8LA 5BT9A 1ENPA 3C7DB 1ZIDA 4UEJA 5JAZA 4F46A 5IAAA 1KEWA 3L6DA 4FFRA 1GQYA 1IY8A 4CMIB 3W4IA 2YV1A 3GEMA 5KKAA 1LDYA 1N7GA 3TOXA 2NSDA 1P1JA 1DIBA 3I1JA 3KTDA 5COAA 4AG3A 2PGJA 4ZRMA 3GRKA 3P19A 3KLMX 5HTOA 4TVOA 3SVTA 4NBUA 3OP4A 3ZU5A 3I4CA 3ITKA 4PIVA 4ALKA 4CLRB 1HE4A 1A9ZA 1HYHA 4CMKA 3KETA 4PCVA 4A7PA 4FJ0A 4KUEA 1R12A 5U1PA 4DBVO 4BO4A 3U0BA 3C24A 1WPQA 3WFJA 2DKNA 4IMRA 5IDQA 1J49A 1Q0QA 3JSAA 4YA6A 5G4KA 2VT2A 4NMHA 3VHRA 1PS8A 1KIFA 1LLCA 3DAFA 2JKVA 4YJGA 1HTBA 3GFGA 1OFGA 5CG2A 4CV2A 1WZEA 1Y81A 4L4RA 4JBIA 2A92A 4D7AA 1BMDA 2ZJ1A 3TNLA 2AQHA 5K6AC 2RIRA 1KETA 1CJCA 2X22A 1QP8A 3C7AA 1GR0A 4KUGA 4CM8B 3GA0A 3I9OA 4CMEA 4H15A 5BSFA 4BIIA 1U7TA 1WZIA 4B7CA 4HFRA 5JBIA 3F3SA 6LDHA 1JLLA 4FCCA 1MC4A 5COQA 2P5UA 3OF2A 1PJ3A 3PWKA 1YGYA 3ICCA 1OC4A 1X1EA 3MEQA 2C07A 2I5PO 4E32A 5FEUA 3OM9A 4CMHA 1MUUA 4EUFA 2FSSA 2Q3EA 5DCWA 3C85A 5DP1A 2X4GA 4BGIA 2BH9A 4DQXA 2B4QA 1I3LA 4NJOA 3ZZNA 3NX4A 1Q7GA 3ZWXA 5JCJA 4F45A 1P1KA 3TDKA 3TPCA 4DGSA 2B4RO 4ND4A 1QV7A 4I5GA 5BSEA 2AQKA 4IDFA 2X0RA 4DXHA 4YT8A 2VZ0A 2ET6A 1UAYA 4CMJA 3PYXA 3VVBA 4EI2A 4TSKA 3IP1A 4A0SA 3PDUA 3ZH2A 4ZU3A 4GPD1 4Z0HO 3PZRA 1RWBA 4YJFA 1Y1PA 2VRCD 1VKOA 4C4OA 5T67A 1HE3A 4KP7A 2F1KA 4LN1A 5LC1A 3A1NA 5HA5A 4Z9YA 1NHGA 3ETDA 2VYVA 3GMSA 4QO8A 1NASA 3O4RA 1GUYA 4LMRA 1TVEA 3RUEA 3GG9A 2NM0A 4U0KA 4WCFC 1QORA 4I5FA 2AXQA 1X7DA 4OAQA 4PLGA 2C2XA 3P7MA 1PJSA 4GMGA 4UVGA 4DIOA 1VJ1A 2EWMA 1GADO 1TT5B 1YKFA 2NU8A 5TLSA 3GNSA 1W6UA 5CPBA 3AU8A 2G17A 2PY6A 2P91A 3BHJA 4J7UA 3Q2KA 3F46A 2AQ8A 5G0TA 3Q1LA 3H2SA 3K31A 4EDFA 3MOGA 4PN3A 1PWXA 1U3WA 1ZUD1 4NJMB 3BTVA 1E3WA 5B1YA 5HS4A 4PVDA 1C0KA 4CLEA 1UXGA 3I9LA 3ICPA 4PVCA 3FWNA 5TIIA 1V6AA 2FPPA 1CQIA 1K3TA 2OOSA 2AG5A 5AQ1A 1NAHA 4IGEA 1M6WA 1SB8A 3ZWVA 4ESOA 1OI7A 3OICA 2Q45A 3SC6A 5JW6A 9LDBA 4UEKA 1D4FA 2H1SA 2GNAA 4QSMA 4BO3A 3C1TA 3OIFA 3N74A 3OEWA 1BW9B 3FBTA 4AJKA 3D5TA 2Z95A 3COSA 5F5NA 4QO7A 2NUAA 4E33A 3ST7A 2Q4BA 3DTTA 3VKUA 1GQQA 3DZGA 1ZCJA 3ETGA 3QVXA 3HADA 1HL3A 3EUWA 3JYQA 1PSDA 5AXBA 1F12A 1SEPA 2NVUA 3AY7A 4MINA 3DOCA 2NVWA 5KJEA 1P33A 2Z1MA 3G1UA 4KOAA 4FC6A 3HQ4O 1UP6A 3F5QA 3JD4A 1S7CA 4J43A 4H7PA 4FGWA 3Q3CA 8LDHA 2VYNA 2J3KA 2O7SA 1XLTA 5JMPA 5HWSA 2QYTA 4NH4A 2AG8A 1VPDA 3RI3A 4DBZA 3HDQA 2HK7A 3RAJA 3GNTA 1H2BA 1J5PA 1M66A 4O63O 4Z0PA 5MGBA 2XPCA 4CLDA 3KO8A 4QXMA 4QEDA 1HZJA 3V1UA 4AJPA 1CYDA 4LISA 1XKQA 3FF4A 5L4LA 2GASA 3ZV3A 2ZB8A 1DC3A 1LBEA 5A1TA 3WB9A 3K6JA 3KHUA 1R0KA 3UCXA 3VVCA 1GPJA 3FPLA 1M2WA 3NUGA 1PJCA 3TSCA 2B5WA 3JQ8B 3ADOA 1RM0A 5L9AA 1DXYA 1ZJZA 3JQ9C 2Q4EA 3H9QA 2X5KO 1V8BA 3RD5A 3TL2A 2IYOA 4M87A 4WUVA 5I7SA 3EZYA 3H4VA 3K2EA 1IE3A 1K6IA 1U9JA 3GGGA 1M6HA 5K0ZA 2XOXA 1ULUA 3AOGA 5HM8A 2ZIZA 3OA0A 4WCFB 1AUPA 1BRMA 5AYVA 5G0UA 3MTJA 3W4KA 1V3TA 3R6DA 3RJ5A 5C37A 3LT1A 2Y0CA 1IHXA 1EFLA 2YYYA 3HN2A 1PQUA 1KEPA 4CLOB 5THQA 2HUNA 1YBVA 2EXXA 1U5AA 3CMMA 4CQMB 3JQFC 4BNIA 2QRLA 3NJ4A 4BGVA 3I4FA 2IE0A 1E3JA 3DAGA 3Q11A 4E21A 4R41A 4D0RA 5ITVA 3DBLB 3OIGA 4Y98A 1GZ4A 4CUZA 3GUYA 4EUEA 2BI8A 1XQ1A 2X6TA 2Y1DA 3AUSA 1HLPA 3SXPA 4JP3A 3PYMA 1B3BA 1PR9A 3F1LA 2FR1A 1PZGA 2YFHA 2D1YA 3NAQA 4MKRA 1HRDA 4NZ9A 4MVJF 4BNGA 4W4TA 4BOYA 4E2XA 4ALJA 1QYDA 1X0VA 2A4KA 2PGLA 3QJ5A 3ROMA 3V8BA 4A10A 5JY6A 1MA0A 2Y0DA 2BELA 2FPIA 2I67A 4MVJH 1NM5A 1NTOA 4K6CA 1C0PA 3DR3A 1KVSA 4XKJA 2FMUA 3CMCO 1EFKA 4CM9A 3BTSA 4L9RA 2NU6A 4B8WA 3PWZA 2YZ7A 2OHXA 3OETA 4WEQA 1MB4A 1JKJA 4JJGA 1DSSG 3NDIA 4EITA 5F3RA 3ROPA 1FDUA 4IINA 4PFJA 3DXFA 4P22A 4ZQGA 5JCXA 5DCUA 1DC5A 4TRRA 2PTGA 3O03A 1WNTA 4DQVA 5M6DA 3BYZA 4PLPA 4TWRA 5C5IA 1NFFA 1PS9A 4LK3A 4J1SA 4JK3A 4A27A 3S2FA 4GX0A 1A71A 5TJ9A 3F47A 3FR7A 3RC1A 2PZKA 3NTRA 1EBUA 3EVNA 1PL6A 1U4OA 3WGHA 2VUTA 3HZZA 1SEVA 3SLKA 3W8EA 1JKFA 1LEHA 1SBYA 3GEGA 1IHYA 4QECA 1XEAA 4DMMA 4MVJM 4NBWA 1B16A 2GPTA 1B26A 5EMHA 5L53A 1AE1A 4OO3A 1QSGA 1LSJA 2W90A 4LSWA 2G82A 4MVJE 4GLOA 1GTMA 3JQGB 4NFYA 4ZVVA 4LRTB 1IUKA 4JXKA 4LMPA 1E1MA 4RVUA 3QSGA 2X5JO 4F3YA 2I3GA 4BB6A 2NACA 3WDSA 2X0NA 2UAGA 5JYAA 3JQ7B 1X7HA 1PL8A 4FD3A 3OJOA 3RC7A 4DQUA 1GD1O 4CLXA 4D42A 5HS6A 4CQLB 3GY0A 2O2YA 3LU1A 3ITDA 3NTOA 1JW9B 1HWYA 2BFMA 4DC1A 2JFHA 4FJ1A 1IZ9A 4FN4A 4GWGA 4UEOA 1WDMA 3LT0A 3UCFA 1XHLA 3PEFA 3RJ9A 1QLHA 4OQZA 3F1KA 4QTZA 4DPLA 3DHYA 4N5NA 3D3WB 4IZIA 4UULA 4O0LA 3JCZA 2NADA 1GDHA 3F4LA 4XD2A 4HNHA 1W4ZA 2FHSA 3BXXA 4ND1A 1C1DA 5I9LA 2C5AA 2IXAA 4W82A 4J3FA 3IKTA 1FK8A 1L7EA 3C8MA 3CKYA 3ZCXA 4RVFA 5FYDA 1N1EA 1E7YA 4BMSA 1V3UA 1O0SA 4JROA 4DVJA 1H2HA 1T4DA 3CPSA 3M6IA 2HJRA 1EUDA 1UXIA 1F0YA 2GN9A 4UUOA 4YACA 1XR3A 1LTHR 4Y67A 2X86A 1SNYA 2WD8A 3U49A 5GZ1A 4XYBA 2VTDA 2I3AA 3C1AA 2VHXA 5CEJA 1PJQA 2HO5A 2H5LA 4EGFA 4HX5A 5C7LO 1Q7CA 1A9YA 4IJUA 4B4UA 1E7RA 4MKZA 1JKIA 1YONA 4E3ZA 4NPCA 4BB5A 5CFZA 4YTEA 1PZFA 4OHUA 2WTBA 4E6PA 1XQ6A 1ORRA 4R01A 2IEDA 5A3VA 1GU7A 3KM0A 4KZPA 5TGDA 3DBVO 3AI1A 4J7XA 4DPKA 4R54A 5ENVA 3ZWAA 4IGFA 4CMAA 5CDUA 4J4HA 2EJWA 4EEXA 4BO8A 3CTMA 1ZFNA 5L4SA 4CV0A 4YJHB 2ZQZA 1O89A 4RF3A 1AN9A 2R6JA 2EV9A 3G0OA 3GPIA 4TRJA 1L1FA 4XQCA 4KDEA 1F06A 3AJRA 3L6OO 3QIVA 4YRBA 4BNZA 1NR1A 3BTUA 1WW8A 3GDGA 1GYPA 3FTNA 3WFIA 5DP2A 2FOIA 2BHLA 4EJ0A 1T2EA 3K8ZA 4IDBA 1LA2A 1U2DA 4JJIA 1SZJG 5IDXA 3M2TA 1YQDA 4B4OA 3AFNA 4RZHA 1EE2A 5B4UA 3PHIA 2YJZA 2GUGA 1I30A 1EVJA 4BVAA 1LXCA 3TN7A 4B7XA 2BMAA 4FFPA 3FR8A 4AJ1A 4IXTA 4CM4A 4IMPA 4Y6RA 1LLQA 4OXNA 3C1OA 4PLZA 1O9BA 4CMIA 4CUKA 1U28A 2H6EA 1NQTA 2RAFA 4FFOA 4DLAA 3AI3A 1G0NA 1Y5MA 2PD6A 1UDBA 3GG2A 3V5NA 1Y8QA 4PRLA 2O3TA 4BNLA 4WJZA 1KOLA 1YL6A 1DDOA 2CY0A 3JYPA 1I10A 5A4DA 3SX2A 2HQ1A 3A06A 5TS3A 1DFGA 4CLRA 2WDZA 2ZCVA 4FQ8A 3IOYA 3PXXA 4ND3A 5TF4A 2GN4A 3L9WA 5TT1A 4F6LA 3KSZO 3TL3A 3ZV6A 4XJTA 3W8DA 4IY1A 3M1AA 3GF4A 4PLCA 2EGGA 3V2GA 3STHA 1T1RA 1EVYA 4ZICA 2Q2VA 3KV3O 2DT5A 3B70A 4YDRA 3D3EA 3ASUA 5TQVA 1DOHA 1KVTA 4D3SA 1SB9A 1OAAA 3PTZA 3HNPA 2O3QA 4HUJA 4XRRA 4L4XA 3DMTC 3WICA 3DAPA 5KWEA 4IS2A 5G0VA 1DO8A 4CL8A 3PP8A 3ZWOA 4RLHA 2JD1A 1NFRA 1N9GB 4Y6PA 2I65A 3MCVA 4E5YA 4HADA 3PHGA 4EJ6A 1PGPA 1CDOA 3HN7A 3BAZA 3MZ0A 1F8GA 3K92A 4FOSA 3TFOA 5EQDA 4CM8A 2D59A 1UZLA 5EESA 3ZWPA 2GCGA 5B4TA 1AHHA 1YBAA 2Y1OA 3E18A 3BMNB 3D4PA 3GEDA 3I9MA 2EP7A 4U8GA 3UF0A 4XYLA 1PX0A 1ZZEA 1E77A 1N8KA 3QHAA 5ES3A 5KJ1A 5JXWA 3OH8A 2GD1O 3B1KA 3W4JA 1T26A 3WGQA 1TXGA 4E5KA 1T4BA 3CXRA 4TKLA 4KWHA 4B4WA 2WD7B 4JBGA 4M89A 1QYVA 4IDGA 5F1PA 1VJ0A 1D1SA 3LSYA 3W8FA 3GMDA 1I3KA 3VH3A 1HDRA 3RSHA 2GN8A 4OIMA 4UVHA 4JCOA 3AUTA 1DIRA 4BKOA 3NGLA 1I0ZA 3UOGA 3FHLA 5A03A 1NNUA 1MXHA 4OH1A 4FPXA 3E9QA 3T7EA 3H9EO 3N7UA 1FJHA 1LUAA 1R4NA 4MVJA 5KIAA 2JAPA 3VPSA 2V6MA 4IQ0A 5TRTA 4XX0A 2O2SA 4G2NA 3PWSA 1LDEA 1A5ZA 5CDTA 3QLJA 2Y05A 5FF9A 5JY1A 2VHVA 1YH3A 5THKA 1Y6JA 3X2EA 1DRWA 3DZJA 5EINA 3L6EA 5DBIA 4FC7A 5CDYA 3RWBA 3DB2A 2EGHA 5IZCC 4J91A 1PGQA 2X9GA 3E6AA 3LF2A 1E1LA 1Q2XA 1TA4A 2QZ9A 3JD1A 4CR7A 2QRKA 4QFCA 3ZWBA 4FGSA 5FI3A 4EEZA 1QYXA 1YDEA 3GRPA 4YB8A 1LDNA 2Y93A 4EBFA 4KTTE 3JD3A 4MIEA 1X15A 1JN0A 4CLHA 1E1KA 5L51A 3M2PA 1PGNA 4YEDA 4UVEA 4OXKA 3E9NA 3QP9A 4RPJA 5JO9A 4N5MA 4NIMA 1DB3A 3BMQB 2Q22A 3DBRA 5MDHA 4P4NA 4DUPA 1ZKMA 1VSVA 2YHUA 1G6KA 2DAPA 4BNHA 2YUTA 3NT4A 1X13A 3WTCA 5KKCA 1JWBB 1DRVA 4ZRNA 3KEOA 5K6AA 3W6ZA 4WE3A 3KYDA 2I99A 2QRJA 3RUDA 4CQMD 3DBHA 3G3EA 3AUUA 4CL3A 5A3JA 4Z3KA 4MDHA 3AUAA 1P1IA 1ISIA 3EZLA 1E6WA 3R0IA 4GX2A 5DOZA 1H9AA 1BVRA 1ZSVA 4BNVA 3PQEA 2DBZA 5TT0A 8ADHA 1EDOA 1BW9A 1BXGB 4AFNA 1NFQA 2CDBA 1BXKA 3QVOA 4F6CA 1LDMA 1R15A 1XCBA 1YBMA 3B6ZA 3UW3A 4P4LA 3TZQA 4X54A 2PV7A 3RU7A 4GQAA 1EQ2A 4XGNA 3ULKA 2Q46A 3BMOB 1X7GA 3FNFA 3NKLA 4WECA 2BGKA 4KWIA 5B4VA 4RJTA 5JDIC 4FB5A 1NAIA 3H3FA 4CMGA 3CEAA 1KVQA 4GX1A 1U8XX 3JQAA 2P5YA 4PLWA 4GBJA 5DN9A 2PZJA 3BHMA 4NFHA 5ITWA 1RJWA 1HDZA 3DTYA 4DIFA 4IM7A 1UR5A 2G76A 1NWHA 5A5EA 4LSMA 1UAGA 2JFGA 5ILOA 3NGXA 4DTIA 4HFMA 1KBZA 1PWZA 1VE9A 2Q1WA 3AY3A 2PR2A 3JYOA 4NR0A 3W1VA 1WWKA 2AEFA 2DBQA 1Z75A 4N7RA 2B0JA 4GWKA 5JS6A 4RF5A 1GAEO 5I7VA 4FFMA 2DUUA 1MX3A 3CUKA 3W6UA 3GVCA 1DIAA 1BVUA 1PQWA 1W73A 5F1OA 2JCYA 3HB5X 2ZJ0A 5DZSA 5JAIA 2GN6A 3RC2A 1B15A 2ZATA 1VC2A 4KUHA 3VC7A 3HDYA 2VTEA 5JMWA 4U6QA 1JQBA 1HT0A 1DJQA 4EUHA 5JAMA 3GVHA 5G4LA 4B7UA 1H9BA 5ILGA 4WCFA 3HG7A 2PZMA 1GFSA 4I5EA 5L7YA 4GMFA 1G1AA 3DOOA 4WK6A 3T7CA 5C3MA 1E6UA 1Z7BA 3D1LA 4E30A 3PHHA 3S1LA 2I9PA 2WE7A 4XCVA 3LVFO 4I9NA 2AE1A 3G1TA 2P4QA 4CLOA 4FIZA 4E0BA 1U5CA 3I6IA 3IP3A 5IXYA 2Q1TA 1PJTA 1GEEA 1U3UA 4E12A 1EK6A 3CE6A 3IUSA 2HJSA 5C7IO 3ANLA 1J0XO 1ZK3A 4MO2A 1P74A 3WJ7A 3WSVA 4ZJUA 2HK8A 1H5QA 3UVEA 3GN1A 3RVDA 1UDAA 3DBLA 1XG5A 3TFQA 1VL0A 1PZHA 4XQEA 4KQXA 3LQFA 3NDJA 2W2LD 4LGVA 1RM5A 4GSKA 4I9UA 1R4MA 3UAGA 2CUKA 2CZCA 1UXJA 1I36A 1YE3A 1QV6A 3QWHA 1VKNA 4WNCA 2NV6A 2I6TA 2VOEA 4J90A 4BNNA 3WGGA 4YAJA 3UGKA 1ENZA 2WYVA 1GUFA 1U7HA 4GL4A 3F6YA 4J0FA 4BKRA 3DC2A 1LRLA 1ISHA 3H2ZA 3D0OA 4J4BA 5A9TA 3C7CB 3E03A 3ONFA 5KVVA 3AFMA 1UUFA 3WS7A 5DT9A 3E48A 2XXJA 3X2FA 2Y0EA 1RKXA 1LDBA 3DEYX 4JGBA 1F14A 1R6DA 5H81A 3V1TC 3ZU2A 3GHYA 5LCXA 4YAKA 3IAHA 4RF4A 3OFSA 2ZYAA 2GYYA 1T2CA 3JQBC 1JAXA 1HXHA 2HAEA 3NEPX 4W6ZA 5G4KB 1NQOA 5BSGA 4QX6A 1D8AA 4R1TA 4YJGB 2HLPA 3G79A 4KDFA 1HETA 2YQ5A 2BLLA 4B79A 1YO6A 4QT0A 2IYPA 3KSUA 3RUAA 4B3HA 5KCZA 1VI2A 2V65A 2GZ3A 1PJ2A 1YB5A 2Q50A 5DDIP 2VRCA 3JQ9A 4FFNA 3ZW9A 3LC7O 1XIVA 1E6EA 2JL1A 2YW9A 1RYDA 2DFDA 3Q9NA 3P5SA 2FPGA 4M86A 1DC4A 4NG5A 5BSHA 1E5LA 1B0AA 2UUOA 3GT0A 1Z45A 4XEHA 2UV8A 3QE3A 2CDAA 5L4NA 4P4GA 5A5FA 1SMKA 1P1HA 2GDZA 1CEQA 2TMGA 1P0CA 1QMGA 5L40A 5JYFA 1NYTA 1SOVA 4OXYA 4D43A 3JQFA 1ZVMA 2OO5A 4I08A 5FFFA 5JSFA 3D64A 4Q3CA 5HRUA 2GZ2A 5CEEA 4NHEA 2BFPA 2J3JA 4WCDA 2AHRA 1ML3A 3HFGA 5JFOA 3I3OA 1WVGA 1VL8A 4J1NA 4E5NA 1WMBA 3D3WA 4BNUA 5I8WA 4BL5A 4BS9A 4WNIA 1PL7A 4IPTA 3D7LA 1MXFA 2HRZA 1XU7A 3RC9A 5TNXA 3RASA 2AW5A 3O8QB 4E2ZA 4M49A 3INGA
chains in the Genus database with same CATH superfamily
4LWQA 5EUCA 3TTUA 3QUSA 5EJMA 4DUGA 4EF4A 4UDOA 2IU0A 2LDXA 4DRYA 3QXHA 1PDVA 1QRUA 2IS1A 1QO0D 4BFVA 5FOVA 2RGUA 5GOZA 4PFSA 3V2IA 1FVOA 2JD2A 3KS9A 3TLJA 5C1BA 1UP7A 4UU0A 3RW9A 3VR2D 2GVZC 5K8JB 4HWPA 3NHBA 3QKRB 2L42A 3D8RA 3RU9A 5CX1B 1SZDA 4LHWA 4TV9B 2COUA 3MCAA 5F9MA 4RTKA 3QLUC 2BFNA 3OIYA 1VM6A 5ALIA 4M60A 4R98A 3EDRA 4MKXA 4KL8S 3WP1B 3NNDA 5KSYA 5E2BA 3CEHA 4I4TA 5ALJA 3VC2A 3ZK8A 2G1AA 3D1JA 4GPEA 4HQOA 2Z2IA 4NCJA 3X1WA 5ADHA 3QA9A 4R2JA 3EPAB 1H2FA 1KS9A 2ZRDA 2HBRA 1WZ2A 1AA9A 1YS6A 2BFAA 3OHSX 3F6CA 1REQA 1UOQA 1XF9A 5JAOA 2OUKA 1ZLYA 3IVCA 1RRPA 5FNVB 4X20B 4KR7A 3OZXA 5J58A 4H1HA 3LP5A 5DM70 3GUHA 1YHNA 3L4BC 1TM3E 2JFOA 2HU7A 1SULA 3LDFA 3N58A 4IS3A 3X1JA 4FTWA 1V5EA 4PFQA 2ZWIA 2V8OA 2JH8A 3MYYA 1SCAA 4QDOA 3U4MA 1VGRA 5KTOA 4R3NA 2OKCA 5KJCA 3LK6A 4YT2A 1FXWF 3A1WA 5B3AA 3EMKA 4YJHA 3SICE 3WVNA 4DYHA 3V1MA 1NT4A 2YJ3A 3LKVA 4MNTA 3WGZA 4OFWA 1NLFA 1SCDA 3EXEA 4BN0A 3KTFA 1BE0A 1NJFA 2IY9A 3EIEA 4JOBA 3K96A 2HA0A 1GRNA 1ZGAA 2WAMA 4K8OA 1GTRA 1WY7A 1NDUA 3DCYA 3W5VA 1GCUA 2XVAA 2RB4A 3SEQA 2DY1A 2GPBA 1I2ZA 2VK4A 2ZWOA 3I9JA 4IQFA 4O3FA 3S5UA 1EGAA 1EH5A 3CF4A 3RT9A 1F2UA 3QVLA 5T57A 4FBGA 1J07A 3ZY5A 3JARA 5T73A 2FJ0A 2QX7A 4FEYA 2IPLA 3UBTA 1IBMB 4Z4FA 2YN4A 4UKDA 2AFHB 1AGRA 4HS9A 2OXFA 4LG1A 1VE6A 3PJEA 4V02A 1QK5A 2OB1A 3ACBA 4G86A 4YQZA 3RUFA 1E8MA 1PNOA 1E32A 3R0VA 3CV3A 5AKKA 2ZT8A 2WKQA 3SYMA 4LDQA 1C30B 3ZWYA 2EF0A 2O2JA 3GFVA 3WFZA 2C42A 1QGAA 2QPOA 2Z1NA 1XZLA 5I9MA 3VX3A 4Q4AB 3V8VA 4R5MA 1CZRA 2KQUA 2W2QA 2GA9A 3AEKA 3ZJTA 1MIOB 1N5IA 1SVKA 1MV8A 4GOMD 4DCCA 3R44A 2GS9A 5E6RB 4LFBB 2O6LA 1L5YA 1E1CB 2AMYA 4JQOA 4BFCA 1M8GA 2DQ4A 1T9KA 3C6ZA 1WPXA 2BFFA 1N9KA 3OZDA 4HH4A 5ALKA 4EY8A 5CLFA 5DYYA 3FMGA 1KEEB 4RK5A 3CINA 2FFBA 1E4YA 5H82A 3DCNA 2QF7A 3P97A 3IVMA 1B93A 1SZPA 1Y1RA 4JB3A 2IP4A 4AIIA 4AZVA 3CH5A 5F51A 3JVIA 3OQBA 3EEQA 3U19A 1BOOA 1KY4A 1CS4C 3E9CA 1Q2UA 4NNJA 1KMIY 1UM9B 4IQGA 4LQLA 3W9YA 3GHHA 5BMOA 2HJGA 1THMA 4DGQA 2EJVA 4M1YA 3QLVA 5HMLA 1MJNA 3JQCA 5BW8A 3KNZA 4U39A 5K4GA 3UN1A 3EUEA 2Q49A 2ZAIA 4KVZA 4NBTA 3CNOA 3AVPA 6CHYA 2DUMA 1KMMA 3P26A 1GFWA 2QTVA 4K9RA 1SPXA 4IMIB 4O4JF 2IS2A 2ZBEA 2G0AA 3RKSA 3TTXA 5K0TA 1NX6A 3R09A 1SCUB 1SUPA 1E2KA 1BCRA 1NVEA 3PXBA 5JCOA 2FXIA 1CNMA 3CF2A 4ZC8A 1KKMA 4WVFA 2DTXA 3B9BA 3KJIA 3ZCRA 4AMBA 1A4IA 2WYWA 3S1SA 1IOLA 4XM2A 1YC5A 1WU7A 4EVSA 5A62A 2D7DA 5KMGB 1T1SA 1TECE 1N9GA 1VJTA 1WEHA 2QU7A 5JALA 3GFRA 4NONA 1Y5RA 2A0YA 2I4NA 1UP4A 1J5XA 3TTYA 2GN2A 3SEZA 4YJKA 2ALJA 2HPHA 2A9KA 3VPGA 3OF5A 4J2OA 1E79A 5CXUA 1ENYA 2JJ1D 2XY4A 3FLAA 1HO3A 1U3TA 3DCIA 2QRUA 2BGIA 3DWFA 4WASA 4FFWA 4Q37A 3OCUA 4OK5A 4DW8A 2JIZA 4IXMA 2D00A 1N7HA 4KQCA 4ZARA 2CXRA 2O54A 3MELA 1B0PA 3DJYA 5JNWA 5DGDA 3UXHA 4WLUA 3PU6A 2JLYA 4BJHB 3HBAA 4LDPA 5DBGA 4NICA 1T4MA 2VNAA 2PNJA 3T8YA 1JAYA 1FNNA 2YWHA 3NANA 4GWLA 2P9HA 1LD3A 3LMKA 4DQLA 3ZDFA 2QXUA 4ZJYA 2H0AA 1RJ9A 2FPIB 4Y6QA 1XA0A 5AKIA 1OU4A 4EO7A 2GBLA 3DOJA 5AVWA 4TZ6A 4LDAA 3DTVD 2CXTA 1YVEI 4GEGA 3IEMA 3Q8LA 1HKHA 1CETA 3AHHA 3UICA 4Z99A 2D5LA 5T64A 1VCMA 2AK2A 3SU8A 3QVSA 3DFUA 4RVCA 1E9EA 5K8TA 3K30A 4KN5A 5D3QA 5EJ2A 3QW2A 1A50B 4J16C 3A10A 2VHEA 2PRZA 4RA9B 2QRPA 3DTNA 2ONKA 2VQDA 3V1NA 2Q5JA 1A5BB 3QUAA 4RBNA 4F4CA 2VUIB 1W85A 1M54A 3EARA 4XJSA 1KDOA 3RC8A 4L5BA 4ZQHA 1A7AA 3KVOA 3DVAB 3HCNA 5D3MA 1QYRA 4CEIB 5KNLA 1PU2A 1QTNA 2PKXA 3IFSA 3V46A 3RYHA 1MFPA 6Q21A 1E3SA 5DLDA 5A5VA 1JWLA 2EL7A 3VMMA 1W46A 1JQJC 3UXMA 3A9SA 5CITA 1O94D 2A94A 4WQMA 5BWLA 2HCTA 2PL1A 2ZAMA 3LIIA 2QTTA 4NP6A 2Q5CA 4XW2A 3LK7A 1G8GA 3OEHA 2EW8A 4FILA 5EJIA 5ADWA 5TGZA 5KC9A 3EXIA 1U9CA 2IIPA 1F8UA 2OZKA 2RDMA 2VLIA 2VYQA 3I12A 4Y9SA 4FWTA 1B8UA 3HFRA 4OMCA 2ONJA 2HIGA 1QFYA 3BXGA 4L72A 5DK4A 4BO7A 3AKZA 3SQMA 4L8VA 1R0XA 3SNKA 1S6YA 1G16A 1E9SA 1TO6A 4NCKA 2BKVA 2NT4A 2GEUA 3OHMA 2GN0A 3U6BA 2NZ2A 3NASA 2H1FA 4PINA 3ZIUA 4IJQA 1M2FA 4F06A 3DMTA 2ZTMA 4YR9A 1Z38A 4MS1A 2J6BA 2UVPB 3CN7A 3Q6MA 2VJBA 3UENA 1I1HA 1BX3A 2ERYA 3I37X 5E1DA 2I1QA 2IA5A 3PEWA 4Z4QA 4PS1A 2ZB2A 1ISJA 4CFYA 1R6BX 3ZHXA 2P69A 4TZTA 5BNFA 3MHTA 1QYWA 3QBEA 2BSAA 2RBKA 1I4EB 4C07A 2ZVQX 5IUJC 4M1QA 3R5FA 5DWVA 3V9PA 1T6YA 2XQFA 4OQPA 2Z6VA 3WI7A 2OVFA 3L92A 4QFBA 5IJZA 2AD1A 2PMDA 4HH0A 3FHTA 1Q12A 5A2GA 1AH2A 1IM2A 2ZB3A 2VQ3A 3L7KA 2G1PA 4X61A 2XWQA 1C1DB 2I7TA 1BC5A 3OCCA 4QLBA 2OP1A 4MRRA 3WGVA 1HZZC 3DPSA 5JC8A 2DHEA 1KFKB 4HOYA 3KB6A 4KLCA 4DB2A 2R8BA 5DNVA 4TRMA 2BEWA 3KJEA 1FE8A 1R2QA 1V9LA 3O2QB 1T9GS 3WK4A 1FCJA 4BNMA 3VAZA 2NN3C 2ZIAA 4GIBA 3RRXA 1FSZA 5KVAA 3H04A 4O59O 3KTOA 2G5GX 3SSNA 3B38A 3VSAA 4RGQA 2FPKA 3S81A 2H2FA 3N0TA 3MW8A 1XXHE 5TGTA 1UWCA 1ZH8A 2VQEB 5C8YA 5T4HA 4C0HA 3HJFA 1TAUA 2WJPA 5KWJA 4BZWA 3AR4A 1JDJA 4H7HA 4DSZA 3QYFA 1KFCB 1QB7A 1SUEA 4OATA 3OF3A 1N2OA 2BGRA 1MABA 3G5MA 3U4HA 4E4RA 4BECA 3IB3A 3QPBA 4FD2A 2QXYA 4NCXA 4AF6A 4D8VA 4KQKA 2C54A 2JAUA 4GP7A 1G60A 4IXWA 3RFTA 4RDHA 2IXBA 2V03A 3GP8A 5JWHA 4DDKA 1KEZA 3JWHA 1Z5PA 3PNMA 5DM2A 1QH9A 1OBHA 2ZU0C 4EW6A 3FCAA 1HNZB 2VTVA 3TUXA 1TU4A 2QNIA 4OMUA 1XRNA 4RVGA 3Q3IA 4UBKA 3CJQA 4R1SA 4QOSA 1OBOA 2BL4A 4HPXB 2F43A 4MV9A 4KMSA 1ESMA 2ONCA 4WZ6A 2WMDA 3NOVA 4K28A 4C0SA 1SFRA 1L8XA 2CW5A 2GHQA 2J85A 3MS4A 4IRMA 4NNOA 5CCXA 5HZHA 2ZIEA 3ZWWA 3DL7A 3PDCA 3AVWA 1DJPA 1MW9X 1L3BA 1CF2O 3HKEA 1P9OA 3UTCA 1I7PA 2O8DA 1YOBA 2PUBA 1I2BA 3QOYA 4ALLA 2JKZA 1WKCA 1ZMRA 2JJ2D 2H3HA 4EY4A 3FYCA 3IDZA 5L3QB 1LSOA 1ULSA 4OLFA 2OPHA 2J5BA 3HACA 4YR7A 4IFEA 1NVVR 3PL1A 1PGOA 1JHDA 5K1ZA 3GLTA 1EJ6A 4O4HF 4B6PA 4QGHA 1NGSA 2DPMA 1KYTA 4V0MA 5BMVB 1JG1A 5IPFA 3OZSA 1YS1X 3HJAA 2C4HA 1LVHA 5BPFA 5K0LA 3HV2A 2FRDC 2ZBFA 2OL4A 3LHDA 4QFMA 4RHXA 2MDTA 4CXMA 2VZLA 4EB6A 3F5DA 1O1YA 4YRAA 2GTIA 3K0AB 4N0DA 4XUEA 4DEYA 4L76A 3PQDA 1NU8A 3ZU6A 1IL0A 4CFZA 3KXDA 3KXKA 5FOTA 1Y1SA 1UXKA 4DILA 5AKHA 4FMCB 4MVYA 2FR0A 5DSTA 1IY1A 2A9RA 3VBCA 2G4CA 4HDOB 3PX7A 1QIGA 3F96A 4N49A 4TYNA 2CHGA 5K0FA 4TT3D 2OFPA 1NQWA 2R3SA 3KFVA 4JJ7A 3P0RA 4RK4A 4KRYA 3U5TA 2DLCX 3RODA 4GQBA 5K99A 4FDUA 4EHDA 3E1KA 3I2YX 4CKEB 1XRRA 4MV8A 1UBJS 2BM1A 3LXRA 4D1YA 4JI7B 1ACJA 1NN3A 2XCIA 2R8YA 4AX4A 3FWZA 3M3HA 4YBRA 3WKEA 3O2JA 4M6WB 5EZ5A 3GCGA 4MGHA 1J0CA 3H2HA 4IR7A 4MRMA 3FMPB 4RAQA 1AKWA 4RJLA 2GI4A 3SJUA 1NJ2A 4N18A 1N6PA 4M98A 3RH0A 1BO6A 3CNQS 2PTHA 3AVOA 3HLTA 3EC1A 5AJUA 3P9XA 4RCVA 2JFVA 3RANA 2EYQA 5FOWA 1NWCA 3K8OE 4A73A 4X6XA 4MIYA 3ZI0A 4S0ZA 2PLAA 2N9UA 3DDWA 4UMFA 5E7JA 5F5LA 2YC4C 2ZRJA 5K5EA 3P27A 4RPHA 1Z68A 1BROA 2J1LA 3O9ZA 2JZCA 2AJLI 3CZ4A 4LAFA 1DCKA 1U2QA 2NLOA 3F8SA 1JVBA 1V9CA 1E64A 3IDFA 1DC6A 1DAFA 1ILWA 2Q41A 3PTLA 4CTKA 4E1BA 5I4BA 3IALA 4BUCA 8MHTA 2A3RA 4B0PA 4RCYA 2PEYA 4HN4B 3ANSA 3IAEA 1GT91 2YNMA 5IXJA 5HEKA 2WSYB 1JR3D 2I4MA 3HBNA 3E5NA 3JQDA 2WPNA 1WEKA 2WVJA 5AR1A 5KSWB 2FPNA 2Y66A 3DQPA 3FOWA 4Z8XA 5EA2A 5K4HA 3K71B 3PIDA 3H9JA 3L77A 4IJKA 5EKTA 1RHMA 1DEOA 1EX9A 4K1XA 4UXJA 5EIBD 3SF8B 3TCNA 4V1CB 2VDNB 3INTA 4KRXA 4A9AA 2XDYA 3LIPA 2FZVA 2WJVA 2F8MA 1GZ6A 1J8QA 3SD7A 4XVUA 2JVIA 4G0ZA 3WBFA 1FUEA 1NI4B 1XZJA 4PZ0A 2OZLA 3ZVLA 1X80B 3G68A 3EVEA 5A71A 3PNVA 4BBJA 1OAOC 3EIOA 3LT2A 3CRZA 3SF0A 1L5MA 3IAFA 1JUDA 1H8HA 1N4AA 2HA5A 2FUNB 1C81A 2IX9A 3KKQA 4BIMA 2DWUA 1ONPA 1RHUA 1OZAA 1BHO1 1XNRB 3ISVA 1CUUA 1KI7A 3EGOA 3JQ8A 4LCJA 2ZJ2A 1G42A 4IKOA 5C5CA 3EP4B 3WNVA 1P0IA 3WYDA 3DZ2B 2JIOA 3RROA 1UKBA 4ONEA 2QRQA 4MS3B 4Q4LA 4URFA 1I7SB 1RZUA 3HYNA 2HWYA 5IEBA 3EW7A 3TKAA 5D51S 2CL6X 3E3AA 1ADGA 4ZXFA 1FFSA 3LPAA 1A9RA 4LKRA 1DX9A 1D7AA 2WUEA 3GAZA 3OLCX 3K1JA 1SY7A 1XD2B 4J3NA 3WWYA 3RDPA 1YCDA 5A4JA 5EQFA 2OCGA 1MHMB 3FIUA 4J03A 4R31A 1AXGA 2OCXA 2I4RA 5ER6A 2RC5A 5CTJA 1QR2A 4KQMA 3ZHCA 2QN3A 1R8JA 4ZIRA 1EZZA 4L8GA 1R4NB 1SHTX 4D5GA 1D0SA 3TTTA 1N2EA 2FSIA 2G5CA 1ZD5A 3QVJA 4FQ7A 2Z58A 2ZTLA 4Q1CA 5F78A 3AM5A 3GFPA 3ESYA 2F6RA 5EE1A 1BA2A 5KNDH 1GARA 3THYA 3SDBA 2CZQA 1O58A 2X7HA 4BV9A 4BV8A 3FOFC 4RQUA 5DHUA 3OFVA 2CFCA 1RMYA 1X8KA 1V95A 2G4LA 2IYEA 3AETB 3HDJA 5H3HA 2MCFA 2JFNA 1Y5IA 5BUCA 4AULA 3L1JA 5CP8A 5H70A 5JADA 3V4RA 2Z2KA 1XQ9A 1OH8A 4FHZA 1QX3A 3VAAA 3HRIA 1S8AA 4O4IA 1A76A 3BTOA 3QKRA 4XVCA 3K09A 3PLAE 2HA3A 4FZ3A 4NAHA 3FPBA 5CX1A 3W7BA 4TV9A 4C5AA 5ICEA 1N33B 4DPMA 2CEKA 4F91B 1ZNQO 2YVAA 2QN6A 4RTMA 3T35A 4J1TC 5I9SA 5ELMA 5PGMA 2PUCA 4YT4A 1RCUA 2A5FA 1S2DA 5EKSA 5GOTA 4L7QA 4XZ3A 3WGYA 4OTZA 2OO7A 3RTBA 3DDNA 1PVDA 2V7TA 3M1LA 2H8KA 3B5IA 3TQOA 2YFQA 3N2KB 2OMEA 1AQ6A 2HFJA 1E89A 1QIKA 1RQ2A 4K6KA 4OQXA 1ZXLA 1G8SA 5FNVA 3K32A 1OFVA 1L5VA 1BHJA 1G20E 1FDSA 2I4LA 3E70C 4TYMA 3TQHA 3FD8A 4JN6B 4R16A 4Q19A 1K6XA 1BN7A 5IWAB 5BXYA 1BE6A 2IUUA 3KEQA 3CO5A 4PHCA 5IT5A 1CWUA 2R7KA 4RQTA 5DHSA 5BT8A 4B4VA 2QMZA 3GXBA 3K0HA 4ZOQI 2C7RA 2ZK7A 2V45A 1UK6A 5HBGA 3WWEA 4ND5A 4RHCA 4DYVA 3PEYA 2ZULA 2QN2A 3I9NA 5E95A 2ZI5A 1GPMA 4DKXA 5IBCA 1I3CA 1V9SA 1OX6A 3GWGA 4GBMA 1M8PA 2HA2A 4JODA 5D01A 2GGSA 4N1AA 3QVTA 2ZGVA 3BEDA 4X8MA 4JJ8A 3H84A 3VOAA 2WA1A 1P44A 4IJMA 3QVWA 3R7FA 2H2HA 1WABA 2I66A 5BOVA 3FSGA 4QDTA 2QZSA 2ONYA 3T3EA 1VE3A 2VF7A 3QU4A 3WIOA 4JY7A 3M0EA 2IXEA 2E89A 2X0IA 1EKXA 4LTNA 1XPUA 1J4AA 1NE2A 3VXKA 4ROSA 1F1BA 2G04A 2AFHA 4ZOBA 1EBFA 3HU3A 4NDNE 3UA3A 1YIOA 4BXOB 4PXSA 1FSFA 3IKJA 4Q01A 3C0KA 2B7LA 1C30A 1FJ2A 3PG5A 3BCUA 1UJ2A 2ZB4A 1EJ0A 1UJ4A 3Q0IA 5B58C 3K8YA 2WIFA 1TYEB 2YDXA 4GP9A 4Q4AA 4YRCA 2R60A 1ZK0A 4GR5A 4BKMA 5GJVC 3RV4A 3SVZA 2P7IA 1MIOA 5C7YA 1IYZA 2II6A 5DM0A 5GZ6A 5TPWB 5E6RA 4XCXA 1E1CA 2FQ1A 4UHKA 1Z5UA 3QH4A 2X5OA 4CQLA 1SCKA 3DMFA 4FB4A 2UXDB 2C2WA 1PV4A 4J49A 2BMFA 1KEEA 5KOJA 1Y8ZA 1I1NA 2JBWA 1L7OA 3QKIA 4XCQA 4ZI7B 2BI7A 4IIEA 5ADVA 3C8UA 2GHIA 3AR9A 5AI0A 1YUBA 4G5RA 5JYDA 3NIDB 4L5AA 4OP3A 2DKFA 1SQ6A 1W8DA 1XLTC 2NVOA 1HF3A 1CUIA 1ZGHA 2P9BA 4P3PA 5JLAA 4N9QA 4P8RA 4WH0A 2R2GA 1UM9A 4EJSC 1D1QA 1WHSA 4GR9A 4W8OA 1XDZA 1WX1A 3GAFA 1B76A 1ZN8A 4L02A 2ZYHA 1J24A 5IG2A 2H1WA 4JLNA 3STYA 1U3GA 3BSSA 4PYOA 4S1TA 4ZVUA 2IXGA 3LO8A 3WB1A 4BBAA 2XUDA 3QE9Y 3T99A 1H1DA 2UUAB 1W35A 1OXKB 1P1FA 1WUTA 3G88A 2QJWA 1IOVA 1EHCA 5DEIA 3EY4A 1FX0A 2FG5A 4XWYA 1SCUA 3SQNA 5KYYB 5J2UF 2HYIC 3I2HA 1KY5A 1CIPA 4D74A 4XJXA 1T6ZA 2HMTA 3LZDA 4XYMA 2Z5LA 4CKXA 4Q00A 2O23A 1QQAA 3CH6A 5E7IA 4JP1A 5KMGA 1JJAA 3KSDO 2J3LA 2XUIA 3AWDA 2IXFA 2EJCA 2MYNA 4X1IB 5DNCA 1D09A 4TTTS 2C59A 1QRDA 3FRJA 4RA6B 1L8OA 2FR8A 3E9ZA 3LWZA 1Z0FA 5LIPA 2G71A 4KVFA 3BD7A 1PRYA 1DHRA 3MFQA 4FMDB 2NU8B 1NW9B 3QE4A 1XDWA 3WDKA 4DCUA 3WIDA 2IQIA 3LC0A 3FUWA 4ID9A 1N2SA 1R4MB 2F4NA 1QRRA 4I2VA 5EZYF 1IHPA 2CLCX 1JH8A 3GQVA 4F92B 3U40A 2ATVA 3VHQA 4R9SA 5KSZA 1YRYE 4TSFD 1NPDA 2HU2A 4ZZ1A 3IJEB 3TNDA 5BWBA 1EPUA 4QQNA 4GYYA 4ARAA 3H13A 4QJIA 4BTVA 1E3WB 3AW8A 3NWJA 1JFFB 5JLJA 2Q1UA 1NW8A 3TZ6A 2D5AA 2PXAA 4Q9NA 3T5PA 1LC0A 2HQBA 4HB4A 2PSEA 4J0EA 1THTA 3ZZ0A 3SJAA 1T1IA 4PZCA 1KP3A 3SC2B 1CRZA 3QOXA 3P1JA 3ZHBA 5EXTA 4ZAGA 4PGHA 4BVJA 1MF7A 4L8YA 3VPXA 2QW0X 2FPXA 3FHCB 3EOBI 4JBHA 1L5WA 3LCRA 4B81A 3AVXA 2XKAA 2JI8A 4D6PA 1UMCB 1LLUA 1Z62A 2EIHA 2PN1A 2VTKA 4CETA 1Z0IA 2A5YB 1XWFA 3JWPA 2BLNA 5GV8A 4XIGS 4ABTA 4FS3A 3MJSA 4PWYA 1S7GA 4RA9A 1RI1A 5JAQA 1JNXX 1XA3A 3HO8A 3HTXA 1TZCA 1CR4A 2E5WA 3MMXA 3WK7A 4V24A 3O5AA 4DV7B 4OMDA 2OHVA 4KIGA 1E2UA 2Y1XA 3MB8A 2GO1A 4H7JA 2V0NA 3EODA 5AVKA 1TQHA 2D2IA 2ZFUA 1E2QA 3QW4B 3EFEA 3O26A 4WY5A 3LL7A 2ZDHA 4E5MA 2JF0A 4LXUA 1GPAA 2E6UX 2EOAA 3CVOA 4O2RA 5DASA 1Q1NA 1NMSA 2HD4A 2W6JA 3QQ5A 1UJNA 1UZNA 2ZJ8A 1H05A 3H0KA 2H9AA 3Q7PA 5BSVA 2W11A 4BQFA 4MV7A 3RGWS 3I45A 3PDJA 2XHZA 3FTPA 4KQGA 3UJ8A 1XD9A 4M3NA 4DHEA 3DOUA 1S8FA 2XDAA 4E2FA 1CEYA 1XC7A 1XAHA 3CLSC 5BUSA 1I6KA 2O1XA 3UK1A 1PNRA 5BO5A 2UYOA 1JZQA 1Z15A 2PD3A 2AZTA 2V54A 5JRZA 4ZT2A 3BDAA 2ZUSA 4PG6A 3AR2A 1C9EA 4G5YA 4ODIA 4OIFA 4V38A 4R1UA 4ZQBA 1T25A 2BPOA 2RH8A 1S5PA 4XJVA 1DT3A 3FBGA 1H0KA 2UVPA 2O1WA 1VGQA 2F1JA 3DP7A 3FW1A 1RIIA 3FRIA 5JI2E 2XCTB 1M1ZA 3QVUA 2GKOA 4RIIA 4H1UA 2EJBA 3K2IA 4YRQA 1PLJA 2PJDA 3QTTA 3AXTA 3O4FA 3PGJA 2VDUE 4KKVA 1SCBA 1R9JA 3PFKA 4U2GA 4WK0B 3NJRA 2FUG6 4JR0A 3WYCA 3BWBA 1BSVA 1CT9A 1RAGA 4R1MA 4YMVA 1KZ6A 1EINA 1R8YA 2RH5A 4Q7LA 3U26A 4NZOA 4DLKA 4N03A 1AUXA 2IDJA 3CZCA 4ZJPA 1QE0A 1SN7A 4G0VA 3CCCA 3L7DA 3HHEA 4LNUB 4WKOA 4DRXA 1B14A 2WTEA 2IH4A 1HDYA 4KPYA 4FDAA 2HGSA 2RGCA 1R0SA 1SWVA 1TI7A 1UKYA 2HLNA 3TTVA 4DLSA 1RRGA 3JYNA 1ZLXA 4KLNA 4Y9TA 5EP1A 1VG9B 3X1XA 5BSTA 2F1IA 2UYYA 3FDJA 2WWWA 3KJFA 3KPUA 4H31A 4GKKB 5COBA 1NW5A 2HU8A 1M5TA 2IZ0A 4A16A 2FZCA 3T5TA 4BFLA 5TPZD 1T36B 4N3NA 5ALGA 1K97A 3FLBA 3ON5A 4MGEA 4OQ4A 4X41A 3CJRA 2HADA 2JAQA 3EGEA 5AM4A 3HUUA 2LGJA 4WOKA 1ZU4A 4BNDA 2WFZA 1JR4A 4BQNA 3IVRA 1TEHA 3PRHA 4JLKA 2YVLA 2HSWA 3V2HA 4GZMA 1P3Y1 3PF9A 2P7HA 2J5QA 1PJ4A 4AMUA 4O0MA 1E2BA 3BWMA 4CKYA 2EKLA 3A1CA 5EEHA 3CYFA 5FUXA 5JQGB 4UVIA 4Y1FA 3RVKA 5LKAA 4P7KA 3UIEA 1R16A 2ST1A 3WK5A 3SMQA 1KOGA 4RGYA 2BKAA 5B30A 4G26A 2VDRB 2I2CA 2WOOA 1PWEA 1SM4A 3AI2A 2IP1A 2FUCA 3BSFA 4MV4A 1T13A 2OD9A 1VLLA 1JIJA 1WMEA 1D8TA 2EKDA 2Q2WA 3A25A 4MP8A 1UDCA 4NWIA 4L1KA 1L7VC 4B2YA 2CNBA 3COWA 3R7DA 3RIGA 3NUZA 1RIFA 3ENKA 4HUTA 2C8LA 5DNAA 2HQSA 4WLEA 1EYZA 1H2EA 4IOKA 2ZE8A 4JQCA 2NQTA 4MI1A 2EVWX 1Y80A 3EXHC 3EP5B 3K20A 4M8SA 1IPEA 4N5LA 3U7RA 4JYBA 5L3QA 4ARIA 2J3HA 1NY6A 1GZ3A 1LBTA 1FYDA 2PX0A 3A9WA 2BEVA 1BDJA 2Q6IA 3KELA 1WUJS 4NBVA 3R75A 3UT0A 4NEGA 2H16A 1XCPA 1Z3CA 2CL7X 3IESA 4KB5A 1MB3A 4JVMA 1BTOA 3GLIB 3KBOA 1LWOA 4ZMBA 1WQ4A 2GSWA 4MS4B 3FGZA 3T0GA 3VNSA 4MA4A 4O8ZA 1NOJA 1EFTA 4D6XA 3RJTA 2QUIA 5BMVA 1ZUNB 4FN5A 2JJ8A 2BSQA 2QLNA 3OTQA 2C4WA 4INAA 5LFAA 3HC7A 2VHUA 1SVLA 3TEMA 4NS4A 3OAAD 4MKGA 3S4YA 4I8XA 3SI7A 4D45A 1HE5A 1FNCA 4OU4A 3V3KA 4HEQA 5BNIA 4KZKA 3K0AA 4OL0A 1FQKA 1GKYA 4FFLA 1Z6PA 4U6NA 2JHFA 3QX9A 1JAHA 4OU5A 4TN1A 4NYIQ 1ZAYA 4IF4A 4P3XA 3AESA 3IUYA 4DCPA 4FS8A 1MMFB 3FDIA 4K9PA 1G5PA 2YIVX 3WB2A 1AHNA 2PWZA 5ICCA 3OMXA 2EW2A 3H8WA 3GVPA 5LD2B 2QNRA 1DQSA 4U00A 2Q5IA 2XUOA 4Z7JA 5K2MA 4PHTA 1XJQA 4RL4A 3KQTA 5TPZA 4BB0A 4CKEA 5KQMA 4RH0A 4ARZA 1HDCA 2ZYDA 1DMRA 2FSGA 2O2CA 2QD2A 5ECWA 1M2GA 1OILA 2J3IA 3D5QA 3K9CA 2UZ4A 4ESEA 4AKTA 2IWHA 3W06A 3U7JA 1FTNA 3BJRA 3NW9A 3L7YA 2D8MA 3FFAA 3O6VA 3I53A 4E5PA 2AGVA 3ZLUA 4H27A 4R9RA 3C97A 4B1FA 3OT4A 3CZ5A 3PPYA 3T7SA 3OMLA 3REFA 2OSVA 4MUNA 1K5HA 3PC8A 1CUVA 1DG3A 4GW3A 4WACA 4DXAA 1SUIA 1O3YA 1VE1A 2NWQA 4IICA 5HJEA 2W8ZA 1ADYA 5LJLA 3DE1X 2BC9A 5HIJA 1MAAA 2X58A 3CS3A 4Q4JA 4CGYA 3CWZA 5LD2C 2N0SA 1AK1A 4P5PA 4KAXA 1EFVB 1W7AA 1Y33E 3H3JA 4ITRC 2ZKLA 2FEOA 1QLJA 2HIHA 2ZI3A 2EIXA 4GMXA 2JI9A 1AUOA 4RIFA 4UE6A 1NJ6A 3G6WA 4QC2A 1SUWA 1XQWA 3DZBA 4ZEWA 2XZOA 2CK3D 2P27A 4PZAA 1GVNB 2YIJA 4H3HB 1B42A 2JK1A 2XGOA 2DFLA 1P2UA 2QMEA 2R96A 2R9VA 4MQFB 2RC6A 1HQYE 2ZSIA 4JI6B 4PGAA 2E1RA 3SF8A 4M0LA 4V1CA 1N78A 4OQNA 3IAM1 4AL4A 4TVBA 3MT7A 2P4SA 1GL9B 4QODA 1AMUA 2WY2D 3G89A 1X80A 3GH3A 2GFQA 3T5AA 5JSUA 5CVUA 2JLZA 4AY5A 2Y92A 3OY7A 2QHXA 4J4TA 2RHHA 3TIGA 4P4TA 4R8LA 2QR5A 5B64A 1YB1A 4LRSB 3K5IA 4BQIA 1L7AA 2QORA 3IAS1 1VA4A 3VISA 4AS2A 4F6RB 2OXIA 1YUNA 5FB3A 1BG6A 1XOIA 1A9PA 3AR5A 3MTAA 4KLZA 4Q39A 5TQJA 4C7OB 2FWBA 1IJFA 1J70A 4S1OA 5LZ8A 4DF3A 4ZD6A 2K7FA 1H4VB 3EYWA 2WIBA 4KQIA 2ZRCA 4MS3A 3UANA 4F8JA 3L4KA 1MJHA 1B2LA 3PXDA 5F35A 3ROQA 3WXBA 4RDIA 4DQDA 3HVRA 1NONA 1TYDE 1G21E 1S01A 3IV6A 3ONEA 1IDOA 1JI3A 5AUNB 1S3FA 1XD2A 3PE3A 2DXIA 2BFEA 1S2LA 3I62A 2PGDA 2ZTHA 5KX5F 2VYCA 4EA7A 3E3MA 4PZYA 1ZSNA 3UMJA 3G5LA 4EO9A 4ZKDA 5IFLA 4CQJA 1I33A 4QQ8A 5FTWA 7ADHA 2AOTB 4HFNA 1KIMA 1PUIA 4KQWA 2KLBA 3QJYA 4WN9B 5JS8A 2XRFA 2W4IA 1TKCA 3JWGA 1FBTA 1ZRSA 1VLMA 2IRWA 4OM8A 3TOZA 4N3BA 5J47A 5KHAA 3BFVA 1QNLA 4ZEMA 3PEUA 2VAPA 4I7EA 2ABWA 2YX1A 1H1LB 3RYCB 4WZBE 4E4YA 1UJBA 4JJEA 3UQZA 2HL6A 4KXLA 3QMWA 4F96A 3AETA 3Q3JB 1HR0B 2I3BA 4HXEB 3HZRA 4RD6A 4YRFA 4FYKA 5JAZA 1TCBA 2D2FA 3RSCA 4PN7A 3HYTA 3L6DA 1SU8A 5FD8A 1IY8A 4IVRA 2JASA 3ACDA 1T5LA 4I1YA 4JH0A 5CYOA 3E9YA 3E35A 3GEMA 2VLBA 1DDGA 3OCWA 3LX6A 5KKAA 1LDYA 2HI0A 4F1WA 2YZGA 1N7GA 1Y4AE 5DYNA 1P1JA 4Q7MB 3S5JA 4URUR 5BQ3A 1DV2A 1P2SA 4DSUA 1WVIA 1Q21A 2IS6A 4LCBA 4R8MA 4MLPA 4ZCSA 4CDRA 1ZRMA 3KLMX 4DBLC 4N41A 2EARA 1YZFA 2DWOA 5EKUA 3BF8A 3L05A 4N40A 1VI6A 1LNSA 2DULA 2QNBA 4IOLA 4TLMB 2IYYA 1TL7C 3N2KA 1VL1A 2XYRA 2Q7XA 3KHSA 5SICE 2PSSA 2O59A 3AEXA 1XNJA 2VXYA 4A7PA 4A8PA 4PHHA 2Q6KA 4FJ0A 5KNCA 2C7PA 5U1PA 1P4JA 3SHFA 5I4KA 3D5EA 4LY3A 1R7RA 3C24A 1ZVVA 5BN4B 1TKRA 3O8BA 1CY4A 2DH5A 3NONA 2A5LA 2QUZA 1AKVA 2QMYA 1FRQA 1Q0QA 2GYWA 1NNSA 1DOZA 2MYTA 2GCOB 2WZDA 2VK1A 4YA6A 1M1XB 3UZUA 3B51X 3ZHUA 1ISPA 1Y4UA 1R6TA 2GCPA 2VSQA 3CR3C 5E1BA 3VHRA 3RADC 1DC7A 1LLCA 4PXYA 2JKVA 2WSMA 2QZJA 3R23A 2ZSFA 3GFGA 4QEKA 4BN5A 1M8FA 1QZ3A 2WU4A 2ZKIA 1EB8A 3DUWA 2EKBA 3L8ZA 4FYPA 4GT1A 5FOSA 1Z7WA 2ACKA 4EHIA 3QEAZ 2F55A 4O02B 3O91A 1KYVA 1KF0A 1XQYA 6ABPA 2M6KA 2ZE6A 5CW1A 4RD2A 2CE7A 4C3OB 3Q7IA 4YI3A 1CC1S 4TMWA 3W79A 5BV1A 2WJHA 1U6IA 2MMGA 4FQ5A 1ETUA 2I7DA 3EW9A 1YZNA 1RTTA 4KUGA 4L6CA 1D2NA 2FPSA 4D6YA 3EZGA 2D5BA 4OPMA 4P53A 4H15A 5JTTA 1JB9A 1J2JA 5FEMA 1XD8A 1U7TA 1YMVA 4BIIA 1IXKA 1GFZA 3O47A 2DQSA 1QKKA 2H7CA 5CJ2A 4A6DA 3GBSA 5IKXA 4BXOA 1GLVA 3OF2A 2P30A 4NBNA 1GA4A 1Y7IA 1YGYA 4IP0A 1X1EA 2E87A 3A4MA 5KNBA 5EY5B 4IHJB 4PC1A 2QGNA 4GOKA 3QMPA 4FEGA 4UTRA 3R24A 4C29A 2H2GA 1MUUA 1RJEA 4EUFA 5DH9A 1RP1A 3ELYA 3HUTA 3OZGA 5TPWA 2XMPA 3K70C 4DQXA 2BH9A 2AIRA 4BMPB 3IOCA 1I3LA 2DCMA 4NJOA 4P32A 4ENTA 1Q7GA 1Q19A 5JCJA 4WT7A 1Z8FA 1P1KA 3TW3A 1J1ZA 1EDDA 1ZGBA 4M38A 4Q9LA 4DGSA 5E7QA 3TW8A 2RHMA 4ZI7A 4K6MA 4I5GA 3HNOA 2FPRA 5ALEA 1TCAA 2VPYA 3MCWA 2VZ0A 1S96A 3DT8A 1UAYA 1NVFA 4ZDKA 2XUQA 3BWVA 4C3VA 5LBUA 4Y1RB 4I8DA 3QI2A 4L8FA 4MI6A 4C6TB 5LLDA 1RTKA 1VCOA 4TSKA 4DUYB 3KG2A 2JFQA 3HBMA 4GPD1 2P6RA 1OA0A 2E4XA 4R2HA 1FFYA 1N57A 4RTNA 4RSMA 5HDBB 4C20A 3IBCA 4WCVA 5T67A 2G9RA 3EH1A 4YH1A 1DRJA 1LTKA 3DXZA 4P34A 3TTSA 5JQWA 5SY6A 3LECA 5LQAA 4NG4A 4LECA 1OFHA 3CBGA 2M32A 3O2SB 4HVAA 4BBPA 3KKNA 1CR6A 3KQOA 4I99A 1SK8A 1RRMA 3LW8A 4Z9YA 4DFDA 5GVSA 2RJOA 3ETDA 4UNPA 3RHSA 2G83A 1D2CA 2P35A 2FOLA 4QO8A 3A0RB 3G59A 3EZ9A 3TM5A 4MZXA 3HCCA 4B31A 1GRVA 5E4TA 3NPAA 3SHQA 2Q3FA 2Q5EA 2WT4A 4UHCA 5ALSA 1L0BA 4Z7OB 4I5FA 4W1PA 5C46F 4RA6A 2VIIA 3NM5A 1Y1LA 2GJ4A 2Q6LA 2YYZA 4YAUA 5DLQC 1VJ1A 3L4EA 2NU8A 1YKFA 3NEYA 1L7XA 2H3EA 2Q3JA 2R7AA 5H4HA 5BRNA 4RTOA 3LLMA 4RFSB 1QH1B 1RCTE 3KKPA 4EARA 5DB4A 1KJIA 4J7UA 3KALA 3F46A 1USVA 2AQ8A 2YY6A 3G9XA 1Z2PX 3GFTA 3OCVA 5CURA 3VVMA 2FI1A 4TZ0A 4NDAA 5AM1A 4KN8A 3EQ7A 4WESB 4K40A 5ALWA 1ZUD1 1BDIA 3WAKA 2Z8YM 3ZE2B 3DV0A 1E3WA 1GTJ1 1XXHA 2I8LA 2CD7A 3M49A 1UXGA 4F5EA 4YCSA 2PGXA 2NO0A 2G36A 4I9FA 5LM3A 5KNDD 2DFKB 2AXNA 3I73A 1LQ2A 1OYWA 621PA 1FUUA 1Z6QA 1NAHA 1M6WA 4LOJA 3SR3A 2YL2A 2JGFA 5F1YA 1RZVA 5JW6A 9LDBA 1DV1A 1W6RA 1HDEA 4QSMA 2BE9A 2YINC 2XX3A 5FV4A 1DBSA 3OIFA 4PIMA 4C14A 3N74A 1JJ7A 2HC9A 3FBTA 4ED9A 3RPEA 4DV3B 1UMCA 3M5WA 3PKIA 1RLJA 1VLHA 3KBBA 4LHXA 2W0MA 1XRQA 3G1WA 4TTPA 3QEBZ 2JH3A 3VKUA 1YR7A 4B3RB 3SZ3A 3ETGA 4RHYA 1PBNA 4G0MA 2QAJA 5H4GA 3MF4A 5I7WA 5J1SB 3HXMA 1SEPA 2E18A 4FFVA 4Q16A 4MINA 2Y2UA 1I6LA 4MPPA 4G4GA 4X5OA 5E3HA 1P33A 5HGXA 2C84A 3R9XB 1Z4KA 3ROEA 3HQ4O 3C5EA 3JD4A 4LYHA 1JS1X 4PO8A 1AO0A 4IV8A 2A86A 4H7PA 4C2BA 1JZTA 2J3KA 2O7SA 3DMRA