5BNTA

X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to nadp from pseudomonas aeruginosa
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
368
structure length
368
Chain Sequence
b'KRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVIDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title X-ray Crystal Structure of a Aspartate-semialdehyde dehydrogenase bound to NADP from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Oxidoreductase
total genus 115
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5bntA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bntA01
1R0SA 3T7EA 1PL7A 3BMOB 4XWYA 4FFNA 4AJNA 4CM4B 3DZGA 3OJOA 3GRKA 4DRYA 1XHLA 5KKCA 1NAHA 4J16A 4BO7A 4RL6A 3DAPA 1AHIA 1BXGA 1FF9A 1GFSA 3RFVA 1U7TA 1PSDA 2ET6A 1FDTA 5CPBA 3WWZA 1T1SA 4GGPA 2P9EA 4AFNA 4CM3A 4GI2A 4WOKA 4HUJA 1J4AA 1BMDA 4XR9A 1ENOA 4GH5A 3W4IA 4BNVA 4Y6PA 1UXGA 5DCYA 5HS6A 1DIBA 1T26A 1O8CA 4WOJA 5KVQA 2DT5A 3U62A 3ZWPA 1ADFA 3ROPA 4DPMA 1HDGO 4IJUA 3C1OA 2TMGA 4H3VA 2PWZA 1ADBA 4MKXA 2LDBA 4GX5A 1MC4A 4J1QA 2C20A 3GPIA 1DBVO 5IDWA 1LA2A 4BNHA 2Z1NA 1CJCA 1KERA 3GZ4A 3KXDA 2Q4BA 2X4GA 4E5YA 4DIBA 2AMFA 4UVHA 2I9PA 2VNSA 2WJPA 1T2EA 1X14A 1L1FA 4ZGWA 3VZQA 3PWKA 2XXJA 1LI4A 5DBGA 1VL0A 1NBOA 4KQWA 4BGVA 2GN9A 3IAHA 3UGKA 3GLQA 4E6PA 3NKLA 3DBHB 3W4KA 1NP3A 3VPXA 4DLAA 1EUCA 4XKJA 1D3AA 3GAFA 3OETA 2IXAA 1PS0A 3RU7A 4W4TA 1GZ6A 1VKOA 2DTEA 4ZVVA 2EGHA 1OC2A 2BKAA 3PDJA 1NX6A 3CEAA 2C7VA 3LT4A 4RF4A 1MLDA 3KSDO 4RPGA 1SMKA 3PJEA 1UDBA 5KVCA 1WZEA 3BMQA 6LDHA 2VHWA 2VN8A 4II2A 5AQ1A 3GZNA 3HFGA 2BI7A 3K5PA 4QO7A 1VLLA 4WEOA 5HRUA 2YW9A 1YGYA 2PY6A 3EY4A 3P19A 3QJ5A 3ZHBA 1E7QA 4RCVA 1QYVA 3BYZA 1RKXA 2R2GA 1E3EA 2Y93A 3RKUA 5BSHA 5IAAA 4GLOA 5JO0A 2OZPA 4YYZA 2PZMA 5DF1A 4P4NA 3NUGA 4RVFA 3Q0EA 2ZB8A 1SB9A 5BR7A 2ZCUA 4CR6A 5CEEA 3ZDFA 2PNFA 2ZB7A 2G5CA 1D8AA 1JW9B 3OHSX 4ZQEA 1ZXBA 1EQUA 1M67A 4DXHA 3A28A 4WKGA 3I5MA 3GRPA 1YO6A 4R5MA 1ONNA 4EBFA 5TT0A 2B69A 2Q46A 1CEQA 1GCUA 4YR9A 2VWGA 4HP8A 4XYBA 2JFHA 2DBZA 4XQGA 4PVDA 3WSVA 3EVNA 3DZJA 1TXGA 5HA5A 4A7PA 4M8SA 2P2SA 4R68A 1LU9A 4I08A 5A3JA 2D5CA 2JFFA 4CODB 5CDTA 1PGPA 2UUPA 1CQIA 3GNTA 4C4OA 1SPXA 2CF6A 1V3UA 1YRLA 1EZ4A 4R41A 3ZWNA 1ML3A 4BO3A 1QKIA 2O2YA 3NDRA 4CUZA 4QX6A 1VL8A 4XYGA 4ZQBA 1U4SA 2HRZA 1ZNQO 4XYMA 3WG9A 3KV3O 1WDKA 4YT4A 3ZV3A 4BO9A 4XQCA 1ENZA 4NPCA 1TT5A 4KWHA 3JYNA 1ENPA 3Q11A 3RUDA 3ZNPA 1VSVA 2FHSA 3VPFA 1RYEA 3DZHA 3DHEA 3WLFA 4JBHA 4FJ2A 2H9IA 3H2ZA 1KY4A 2AG8A 3JQDA 4KDEA 4FD3A 1NQAO 5AVOA 4MVJP 3JTMA 2D3TA 1E1KA 3CPSA 4NBRA 9LDBA 5DULA 3ZNQA 2B36A 3RIHA 5EN4A 4KQXA 1GDHA 3JQ8B 3AWDA 4UVEA 3H9EO 4L4SA 3P5SA 2JD0A 3ZW9A 1LLDA 3QWAA 4IDFA 1G0NA 1NVGA 2OFPA 3G17A 4U0JA 4BNGA 4BKOA 5ADHA 1B14A 2X23A 4RVUA 1PWXA 1Y1PA 4JX8A 4Y98A 1C0KA 5T8KC 3C8MA 4IS3A 4XRGA 3P2YA 3U09A 4GMGA 1XLTA 3OECA 1CERA 2ZK7A 3IQDB 1I36A 3OEYA 2DTXA 3JYOA 4Z3DA 1OC4A 2PKQO 1KIFA 3PQFA 4HY3A 1JAYA 3PJFA 3QHAA 2AG5A 4B4OA 4TVOA 1HDZA 1V0JA 2ZIZA 2BELA 4OXYA 4BB5A 1QP8A 2IYPA 4ALIA 1A4UA 3DWFA 1F06A 2Z95A 3LYLA 5MDHA 1B26A 1GEGA 1HE3A 4FC7A 4ZICA 4BV9A 3A06A 1ZK4A 2DM6A 5JBIA 5CEFA 4D0RA 3VVCA 4TQGA 3BMCB 3MOGA 1BTOA 3Q9NA 3VZPA 1EUDA 4BMNA 1J5PA 4XQEA 1XIVA 4YJDA 4D0SA 2QZZA 3ZHZA 4I8XA 1Y8RB 1DIRA 1F8GA 1ZMTA 4R01A 5BT9A 4ND3A 4AJKA 4Z9XA 4CLHA 2PZJA 3GG2A 2GDZA 3O38A 3DO5A 4WNCA 1H2BA 4ZRNA 3WDSA 3TL3A 5ICSA 1ULUA 4R4JA 5AXDA 5DOZA 3RC2A 1A7KA 1IY8A 3SJ7A 1YS4A 1HSOA 4CLDA 2VHVA 2CVQA 4BO4A 2A9FA 1LBEA 1F14A 1QR6A 2OBYA 4P22A 4ONEA 1EUZA 4DPKA 5IDXA 2FPPA 3DOOA 3RU9A 4RPKA 4PLVA 2DBVO 3WX0A 4TVBA 4K1LA 5JMPA 3KBOA 1BHSA 2QX7A 2BD0A 3G1TA 4HADA 4WCFC 2NVUA 2X0NA 4E5PA 3GHYA 2CUKA 2WE8A 3AK4A 3EYWA 4PG4A 5G4LA 3QP9A 1D7OA 3I9OA 3TJRA 1HDOA 3DR3A 1LSJA 4PZDA 2NU9A 3UCFA 5JDIC 1TT7A 5L7YA 1F0YA 1O0SA 3M1LA 1YBAA 4CV3A 1GD1O 4CMHA 1AHHA 4JP2A 3GMDA 3CSDA 4KTTE 3O9ZA 4FSHA 2I99A 3H2SA 5KJFA 1V9LA 4GGOA 4J4BA 3WQSB 2FN7A 3RCBA 2J3KA 1SEPA 2B35A 2O23A 4EW6A 4IINA 4QUKA 1UXJA 3FSRA 2EWMA 1YL5A 3AY3A 1LC0A 3DHNA 2B37A 5JYAA 4IQ0A 1UZLA 3AUTA 3BHIA 3GMSA 2C59A 4RPJA 4BGEA 2PGLA 5AXCA 3ZN2A 5EPOA 2NVWA 3BTVA 1DB3A 1C14A 1PJBA 4GBJA 4CLXA 4L4XA 4I9HA 5EL0A 2I76A 3HZZA 4IUYA 4AVYA 1T24A 1Z7BA 3JD0A 1NM5A 4MVJH 4IDEA 4J7CA 2ZKLA 1V3VA 2WTBA 1U2DA 1AXEA 2BFMA 1KY5A 2C29D 1X15A 4UVGA 3ZH2A 1I01A 3JQAA 2QQ5A 4IDAA 5AXBA 4R9SA 2RIRA 4HNHA 4R51A 5G4KA 4L74A 1ISHA 1SO8A 2P5YA 3HADA 1UZNA 5IG2A 3OMLA 2VOEA 2HJSA 5C7OO 4EDFA 4ALKA 3JD2A 3LT0A 2B4TO 2O3QA 4H16A 3H7AA 1YOVB 4BL5A 5CP8A 5LDGA 4CQMB 3FNHA 3ZU4A 3WGQA 2V6BA 3ZHYA 1GPJA 3ROQA 4ZD6A 3IJRA 3ZWYA 3V5NA 2GN4A 3FD8A 3GOHA 1ZO8A 4JLWA 3D0OA 1ENYA 1HLDA 3LU1A 4K26A 1PGOA 3JYLA 4BMSA 4MO2A 4XGIA 3ZZNA 3GK3A 4L4RA 4R1TA 3BMNA 4JJGA 4U8GA 3ETDA 3M2PA 5C7IO 4DQXA 2PZKA 3D3WB 3C7DB 1HWYA 3PWZA 1GADO 4RVGA 4CV1A 1WAMA 1ORRA 2C07A 4UEKA 4FQ8A 1I8TA 2XAAA 4A5OA 1MX3A 2W98A 5G2OA 3DAGA 4Y6SA 2OUIA 5T8KA 4OH1A 2BGLA 2C2XA 1YDEA 3IJPA 2ZTMA 3GVXA 2PA3A 3ONEA 5H82A 1U8FO 1Y81A 3IC5A 4NMHA 5L4NA 5THQA 1DDOA 2WSBA 1JDJA 3F1KA 1EFLA 5EESA 1V35A 4DYDA 2GR9A 4D43A 3BA1A 3EGOA 1WP4A 2VTEA 1PWZA 3HG7A 5JAIA 3KSZO 3GDGA 1MG0A 4B4VA 1ZK2A 1W6UA 1ZFNA 4HV4A 4U5QA 2AQ8A 4AICA 1XU7A 4Z3KA 4RZIA 4OAQA 2O3TA 2OOSA 4CM5A 2ZCVA 1YQXA 3R0IA 3VKUA 1YKFA 2A94A 3H9JA 3I6IA 1ZK3A 4WASA 3STHA 2A92A 4QXMA 2Y1OA 3FR7A 3C7AA 4Q9NA 3GHHA 2FSSA 1E7WA 1OMOA 1UDAA 1Q7BA 4BHTA 1JKFA 4WPGA 1P77A 3MZ0A 5IXYA 3FPCA 3VH2A 1YH3A 3M6IA 4D45A 4BNIA 1P1FA 3ABIA 2WMDA 3AY7A 4B3JA 5JC8A 1T2DA 3KYBA 4RZHA 1I33A 4XJTA 1XKQA 2QIOA 1J49A 1ZK0A 1HDRA 3PQEA 1HE5A 2G1UA 2VYNA 4TZKA 3WIEA 4I5DA 2GN6A 1Q7CA 3K8ZA 1WDMA 4IIVA 5EJ2A 2QRLA 1DC3A 3HN2A 3NX4A 1T2CA 5FEUA 3PYMA 1TA4A 3QWFA 4BUCA 4RF5A 3F4LA 2YHIA 3OJFA 3JQAD 4J43A 4OGWA 4NJMA 4FN4A 1GYPA 4J9UE 2HMSA 3ROKA 1EEHA 2H63A 1J0XO 2BH9A 3KB6A 4PCVA 4UVIA 5ES3A 2D2IA 3VHRA 4E2WA 4XDYA 1QXSA 2E48A 4ZQHA 1C1DA 1KVUA 4WCFA 3ANMA 1F8FA 1GUZA 1H6CA 2NUAA 5DDIP 2EKQA 5ITVA 4DIOA 3JQBA 2DUWA 3DC2A 5C7LO 2O7QA 1E7MA 5JDIA 5EERA 3S2GA 1UH5A 4LMPA 3RFTA 3WJ7A 4JQCA 2FY8A 2P9CA 2RHCA 3PZRA 3F5QA 4JK3A 1RM0A 1VI2A 2H1SA 2PD3A 1NR1A 2VUUA 1QYCA 3VC7A 4L75A 2NLOA 1P0FA 4DMLA 2HU2A 2YJZA 1GYQA 1X7HA 5KOIA 1OFGA 2HQ1A 4TZTA 5KNLA 4DMMA 5F3RA 5I8WA 3JQ7A 4ROSA 3NYWA 2X9VA 2JAPA 2WD7A 3MWDB 5JW6A 3RUEA 1YL6A 2YZ7A 2GLXA 3W8EA 3JQ6A 4YXFA 2EG9A 1BW9B 2W2KB 3IS3A 4QFCA 1PZGA 2GZ2A 1HETA 4DYVA 3PJDA 1GR0A 3GH3A 2DBQA 3WOHA 2VHZA 3QVTA 1P44A 3U4IA 1N9GB 4NNJA 2YV1A 4XD2A 2IODA 4L8VA 2GERA 5CDUA 3RROA 2DFVA 3MEQA 4FDAA 4E5KA 2EW2A 1DFIA 5JPIA 3WQRA 3EMKA 2P9GA 5HS4A 1A27A 2GASA 3DHYA 4O6VA 1W73A 3I52A 3PFFA 3BTSA 5JFOA 1YJQA 2IDZA 2P4QA 1DRUA 4B7CA 3PLNA 5I7SA 4JXKA 1LNQA 2VZ9A 1GY8A 3UXYA 1DIAA 3LVFO 1Z73A 1ZIDA 4IJWA 2FWMX 2D59A 5J9GA 3K73O 1E3WA 1XYGA 1PX0A 2RHRA 4XYEA 3NJ8A 4MPDA 3FTPA 4YAKA 4EUFA 2Y0DA 1VPDA 5FWNA 1U2GA 2R6JA 3RUHA 3F46A 1HYGA 5DT9A 1TLTA 4E5NA 4S1VA 4Q3BA 2VYND 4FPXA 4KTVE 1O95A 3ONDA 2VT3A 2C0CA 2I3GA 4BO1A 1L7EA 2DC1A 1Z74A 2RH8A 2E4AA 3MOIA 2AXQA 3INRA 4Z6KA 5JNLA 5A03A 2Y1GA 1R4MB 5A9TA 1KVTA 3V1TC 3PYXA 1WMAA 2FP4A 2HJRA 1EVYA 4KZPA 1JWAB 4FB5A 5JY1A 1RYDA 3CMCO 3OH8A 1P74A 5FYDA 4CMIA 4E30A 3GDOA 2UV8A 3LC2O 3SJUA 1VSUA 1ZW1A 3TZCA 3DOJA 1PJ2A 1SEVA 3DB2A 1E6WA 1ONOA 4N5MA 4RVHA 4NZ9A 5DP2A 3U9LA 4FGWA 3W1VA 2FR1A 1NHGA 5TSDA 4GSKA 3L07A 3LQFA 2I3AA 1E1MA 1NWHA 2WE7A 1SC6A 4J7UA 3FWNA 2OGUA 4IIUA 4TKLA 2VWQA 3ULKA 2ZYGA 3E9NA 2ZQZA 2E6UX 3JQFC 1H5QA 4O59O 4DC1A 1KEVA 2EKLA 5L7WA 5G0UA 5KWEA 2BGKA 3CXRA 3LLSA 4CL3A 2RAFA 4XGKA 1FDWA 4MVJM 3W6ZA 5B37A 1C3VA 2DTDA 1HSZA 3AM3A 3H9UA 3IMFA 3KYCA 1PEDA 1DIGA 4R1UA 1CIVA 4XX0A 2Q1SA 1PR3A 3HB4X 3VH1A 4HFNA 1IE3A 4DTIA 1PGQA 3KO8A 5EINA 1N2SA 1LTHR 5DBIA 1DO8A 1UDCA 3JD3A 1DRWA 1RM5A 4MVJE 4GQAA 3AM5A 3DZFA 4DQUA 3MCVA 4JIGA 3WGHA 1U4OA 4E13A 3TF5A 1JWBB 3FRJA 4LSMA 3UAGA 3N74A 1K3TA 2FRDA 4IMRA 3U0BA 1JKJA 4LN1A 5JYDA 2Y99A 1I30A 1I3MA 4U6SA 2GZ3A 1I32A 4CV2A 2Q2QA 4EUHA 5CG1A 3GEGA 4YTEA 1LRKA 2JJYA 4NK5A 1H6DA 1QLJA 5CG2A 1P0CA 4A0SA 3OFSA 3L6DA 4AJPA 4QQRA 5KKAA 3DBLB 2CDCA 4R54A 3ST7A 3OQ6A 3W8DA 4B7XA 3MJSA 5EMHA 1YL7A 3KLMX 1GZ4A 1Q2XA 2O7SA 3GR6A 4TRNA 1T4BA 1EE2A 3RC7A 4YRDA 2JCVA 2BFAA 3IDSA 5AYVA 4YB8A 1E5LA 2QG4A 4AL4A 1WW8A 3ZW8A 1I10A 4Y9DA 3PHGA 3WS7A 1U7HA 1X7GA 1ISGA 5T67A 5TQVA 4J1SA 3W6UA 1MA0A 4A2CA 1E3SA 3DXFA 4MDHA 5F1KA 3AUUA 3IUSA 3ZV4A 4LRSB 2HDHA 2DBRA 3QVWA 1B8UA 7ADHA 1G1AA 2PTGA 4FC6A 4BNWA 1VE9A 1GZ3A 3F3SA 1W0CA 3C7CB 3OEWA 4I9NA 4IMPA 4LVCA 4W6ZA 5GZ3A 4W7IA 4O5OA 1JA9A 1N7GA 4YWJA 2EEZA 4CLRA 2G17A 4EEZA 1ZEMA 4W9NC 4XA8A 3WICA 2JAHA 4MVJI 3HSKA 4J0EA 4ZA2A 4OIMA 3KYDA 3FBTA 3DQPA 4Q3AA 4I1IA 3TNLA 4IS2A 4DC0A 3RI3A 3B70A 4MP6A 3UCEA 1KVSA 3DZIA 1LDBA 2DPGA 1PU2A 2Q22A 3U3XA 1R0KA 4M49A 5EIOA 1AN9A 4AG3A 1FK8A 4J1NA 3JQGB 3KUXA 5DCUA 4ZRMA 5JMWA 1P33A 1ZEJA 1KS9A 3O8QB 4YJHB 1AE1A 3FR8A 2BFOA 3QA9A 4E32A 1YB1A 4IDDA 1P1HA 4URFA 4DPLA 4Q3EA 2GD1O 5A04A 1QSGA 4A26A 3K30A 4E21A 4TRRA 4BIIA 1NFFA 4E4YA 3V2HA 3OJEA 4B4UA 3FTNA 2CVZA 4LCEA 1G0OA 3HQ4O 4RF2A 3WYBA 1I0ZA 4KUHA 4N7RA 5L4SA 4R3WA 2GN8A 3H5NA 2NSDA 1B0AA 1DAOA 4WCDA 3TOZA 1MP0A 5KVSA 5AOVA 4CMGA 4GX2A 4WK6A 3SLKA 1PJ3A 1H93A 1Y9EA 2EW8A 2RCYA 3DAFA 4J91A 5BSGA 4HFMA 3EHEA 3AFNA 1WLYA 1T25A 4GWKA 4MKRA 2B5VA 2GGSA 5JYEA 2ZB4A 5TLSA 2D0IA 4J3FA 2O3JA 2NWQA 4EITA 2IYOA 4JGBA 5TIIA 2VRBA 2HUNA 1BW9A 2X5KO 3ZHXA 1M76A 3WMXA 1GQ2A 2H5LA 4CLOA 1HDXA 3ADPA 4YJGA 3VVBA 3FBGA 4QECA 4DWVA 3E18A 1U5CA 4LVUA 4MVJF 3ONFA 3E5RA 2I66A 2QHXA 3H5RA 1T2AA 3OA0A 2Z1MA 3HNPA 3TSCA 1DOHA 1UP6A 3L0DA 2DKNA 4ZQFA 4KDFA 4PG6A 3RVDA 1Y9AA 4KUEA 3T4EA 4Q3DA 2P91A 4J7XA 3JQFA 4EGFA 1I3LA 3EC7A 4TKMA 4B7UA 3D3EA 9LDTA 5IN4A 1NWCA 1PZEA 3LDHA 5TC4A 1LLUA 3BXXA 2FMUA 1NFQA 4F6CA 1HXHA 3LF1A 3P7MA 4P38A 3RASA 1BWSA 3A14A 4YT5A 1LDMA 3DEYX 1XR3A 4CQLA 1QV7A 3E9MA 1MFPA 2CSUA 2XF8A 3MTJA 3NTRA 1EVZA 3G79A 1GYRA 1X13A 3NDIA 2J3IA 3PEFA 4CM8A 3BIOA 4Y8VA 1X1TA 2DUUA 5JO9A 3IUPA 4JROA 5CAEA 3NTQA 2AW5A 2JFGA 4G5HA 4IBOA 2VUSA 2B0JA 3D1LA 3RUCA 5K9ZA 4XR4A 1ZMOA 3Q6IA 5T57A 2IEDA 2C82A 2FR0A 4RQTA 4UAGA 4GWGA 1U3VA 2X7HA 2I67A 1U8XX 4PLPA 1JTVA 1Z7EA 4C7JA 4B3IA 1HZZA 2NQTA 1D4FA 3AUSA 4OKIA 4PRKA 3JD1A 2WWRA 3SC6A 3HDJA 4M1QA 2NVBA 3FPLA 3N7UA 2J5KA 1E1NA 3QWHA 4OOEA 5GZ1A 3F5SA 1FMCA 2CDBA 3AUAA 1C0IA 4GMFA 3LSYA 1R6DA 3A1NA 3WFIA 4MVJA 3U49A 1R12A 3S1LA 4BO8A 4LGVA 1GPDG 3DBRB 3X2EA 3D64A 3QE3A 4FW8A 3RC9A 3F9IA 2ZTUA 3ENNA 4ALJA 1X0VA 5A06A 4P4GA 3WR5A 1W4ZA 3O26A 1ONPA 5CDYA 3WGOA 2OP1A 1Q0HA 4OXNA 3LT2A 5MGBA 1Y8QA 1I2BA 1HE2A 1XQ1A 2DLDA 1Z6ZA 1U3WA 2WM3A 4YJFA 3S2FA 4PLTA 2YFHA 2O3RA 3BMOA 5I7VA 3ZV6A 4CM4A 5L40A 3ZWAA 1U9JA 5L7TA 1NQ5A 5U1PA 1DC6A 2VWHA 4TWRA 4BQRA 4WLEA 5DOVA 3WTBA 4CV0A 5I7FA 4YPOA 2X9GA 5TT1A 3WBFA 2VCYA 1HYHA 4WLNA 2SCUA 3EDMA 1PQWA 3EZLA 1C1XB 3UN1A 5HM8A 4NK4A 3TRIA 5IN5A 5L95A 2AQIA 1N1EA 4RVSA 1SZJG 3EUWA 4GX1A 4WLFA 1GQQA 1P3DA 1ISFA 2E82A 3H9GA 4UVDA 1IHXA 3S2EA 2PKQP 3VPHA 4IJKA 1LRJA 3ZWVA 3IL2A 3LC1O 4XJSA 3CIFA 4W9NA 5CEJA 3PP8A 4RGBA 4EJ6A 3BTUA 2HSDA 3K2BA 4D3SA 2QRJA 2EIHA 4ZN6A 3NRCA 4YAEA 4CM7A 2XXBA 5A5FA 2ZYAA 2P4HX 2CDAA 4JP3A 4BO0A 3PDUA 5KJ6A 4J2OA 4GVLA 1R66A 5U9CA 4UEOA 1HZJA 3MJEA 5F1PA 3B1FA 1LSUA 1CYDA 1O5IA 4FS3A 2Q1UA 2I65A 5JDCC 4EJ0A 1ISMA 3S8MA 4YEDA 4TSKA 3PIDA 2YDYA 3QQPA 3SEFA 1VC2A 3DBHA 3GVHA 4HXYA 3VTZA 4MKZA 1BXGB 3D4OA 2DQ4A 3LK7A 1CETA 3RWBA 4J4HA 1ZCJA 2EHDA 2FR8A 1TB4A 2P68A 1B3RA 1L7DA 5IDQA 3JCZA 3U5TA 3RJ5A 4WLUA 2JD1A 3RBZA 1GCOA 1HYEA 2AQHA 1K2WA 3GGOA 4BMVA 4Z9FA 3E5MA 1Q0LA 3UKOA 5HWSA 3HJAA 1BGVA 2GCGA 2X5JO 4E2ZA 3TL2A 3K96A 3HE3A 3UHAA 3I4CA 4P8RA 3GVPA 2D4AA 4GL4A 5KIAA 4L9RA 3ZNNA 4FFPA 3G3EA 1W8DA 1TEHA 1LX6A 3RC1A 3AI2A 1ARZA 1E0DA 4MVJD 2GF2A 3D4PA 1IOLA 4D7AA 1CDOA 4J2HA 3WYEA 4YCAA 3NT2A 4R1NA 4BO5A 1RWBA 5JYFA 5U4QA 2WEKA 5A9SB 4M87A 5JAQA 1EVIA 3UCXA 3H5AA 2EERA 4IY1A 1P31A 3WTCA 2I5PO 2AEJA 3ITKA 3WBBA 3U4CA 3BMQB 1UAYA 2QW8A 1M2WA 2D8AA 3A9WA 1YB5A 1DPGA 2CVOA 3SBOA 3GZNB 1T4DA 3L4BC 3SVTA 1Z75A 5IZ4A 4P4LA 4DREA 5IJZA 4ALMA 3INTA 3AFMA 4KUGA 3ZNOA 3I23A 3CTMA 4W99A 4YA6A 4NHEA 4CPDA 1QRRA 4CMCA 4ZJUA 1C0LA 3OM9A 3RAJA 5I9MA 4CMJA 5C5IA 4I9UA 1NXQA 2C2YA 4YVFA 5TNXA 1PGJA 2X22A 2X9NA 4M86A 3D5QA 4ND5A 4E12A 1JVBA 2Q99A 1N5DA 3ZWWA 5JAZA 4R16A 4DBVO 3F1LA 3QLJA 4GAEA 1H6AA 4UUPA 5C37A 1KC3A 4BV8A 4AJJA 1E7YA 1DLJA 1HRDA 3PPIA 1E3IA 2PR2A 3NEPX 4NH4A 3GVIA 2EJVA 1YE3A 2A4KA 1DIHA 2PD4A 1E3JA 1SOVA 1DEHA 3GF4A 5LDHA 3DOCA 4W7HA 3JQ8A 2GNAA 1OAAA 1QORA 3DMTC 1I2CA 1YDWA 1IUKA 4IDCA 3R1IA 3ENKA 4PLYA 1VL6A 3TQHA 1BRMA 4MOWA 1Q0QA 2BRUA 1I5RA 5ENDA 4CMAA 3L6OO 2VYVA 3BHJA 1NPYA 5JE8A 4RF3A 2Y68A 4B4WA 2AE1A 3W4JA 4K6FA 2DFDA 4DA9A 1B2LA 4MINA 2WDZA 1BSVA 3H6KA 5TGDA 3PVZA 5A05A 2Q1TA 5H83A 4BGUA 2JHFA 3ZWXA 3K31A 7MDHA 1DAPA 2VHYA 3H3JA 4E33A 1TT5B 3TFOA 1FXSA 1GV0A 1XDWA 3Q9UA 1WNTA 4PFJA 4XCVA 2JCXA 3S55A 4CMEC 4JN6B 3HHPA 1LUAA 5FI3A 2F00A 3UFXA 4A27A 2HK9A 3PGXA 3WGTA 1LXCA 1GUFA 4ND4A 3TOXA 4NJOA 3UF0A 2YFQA 3JQ9C 3GQVA 1ZK1A 4PRLA 4XEHA 3BMCA 1P1JA 3TN7A 1GQYA 3L77A 4HFRA 2EV9A 1Y8RA 4UUOA 5BNIA 4E2XA 2E49A 2C54A 4U6QA 4QEDA 3SXPA 4Q3NA 1VKNA 4NBTA 4PZEA 1WDLA 4BNKA 3QIVA 3VDRA 2HK7A 3QWIA 4BO6A 1WXDA 4ND2A 2QRKA 5DBFA 3KOUA 3NAQA 4YAGA 4BQPA 1PJSA 3ZI0A 3DDNA 3O4RA 2X86A 1WZIA 1QMGA 5F21A 1GAEO 4J0FA 3QVSA 3ZU2A 3K92A 2HAEA 4F3YA 4NBUA 2NTVA 5TJ9A 3FNFA 1PS9A 2AHRA 2BHLA 1BXKA 3GN1A 2XPCA 1A4IA 4UEJA 3RUIA 1JLLA 4BKPA 4D44A 3FCOA 4G2NA 4I5FA 4FIZA 4JJIA 3NV9A 4FJ1A 5K0ZA 5JDCA 3ROMA 1ADCA 1MUUA 3L9WA 2VTDA 2VZ8A 4BNNA 2O4CA 3MWEB 4R3NA 3I4FA 5T5QA 1NTOA 1EFKA 2PD6A 2F1KA 5M6DA 4NI5A 3E1KA 4IGEA 2UDPA 1BVUA 2ZYDA 3VDQA 3K2EA 3NDJA 1PIWA 3V2GA 1B7GO 2O50A 5IZCC 3GFBA 2HLPA 3L9XA 4D42A 5I9LA 4OQYA 1KYQA 5I8ZA 3G1UA 3TPCA 1MFZA 5F5NA 4O0LA 3BZUA 4RDIA 4WE3A 4B8ZA 4K9DA 5G0SA 3I9KA 4ESOA 5BNFA 2W2LA 3OBBA 3RSHA 1A5ZA 3P2OA 1KC1A 2HMVA 1KEWA 1FDVA 5JLAA 4LISA 4BS9A 3UOGA 4KOAA 1U5AA 3RKRA 1M66A 3WSWA 4X54A 3HFSA 4CM6A 4LMRA 4MIYA 3OA2A 2YY7A 5JCXA 3RFXA 1JKIA 1I24A 1YVEI 2VYVD 4H7PA 1XEAA 1R16A 2HKIA 1JAXA 3OIDA 3LC7O 4PG8A 2NU6A 4TRJA 3NT5A 4RQUA 4YACA 1EDZA 1LLCA 1T2FA 1KBZA 1FDUA 4AJEA 4YT8A 2R00C 1PGNA 3SLGA 3E82A 3B20A 2NVUB 4F6LA 1KOLA 4PVCA 3PHHA 5TS3A 1DXYA 1EMDA 2W4QA 3KZVA 2OL4A 4N5LA 4CM1A 2EXXA 2Y1FA 1K0UA 1VJ1A 4AJHA 3JSAA 2X0JA 1SBYA 5T64A 1NPDA 3PZBA 1BVRA 1YONA 1XU9A 4FOOA 5L51A 3L4BA 3CH6A 4II3A 4BVAA 5EQDA 3V1UA 2PFGA 4YQYA 3INGA 5HBRA 1NAIA 3D4NA 2JKVA 2ZTVA 5TF4A 3ZWMA 4OKNA 1LJ8A 1A72A 1R4NB 1YOVA 5THKA 4CR8A 5F5LA 4CQMA 2CD9A 3JD4A 4PLCA 4YRAA 2DU8A 1V3TA 5A02A 1PJLA 4E2YA 4LCJA 4LW8A 3QW2A 4B79A 3T7CA 1PQUA 1EK5A 3HUDA 4R69A 4N54A 2IEBA 5KJEA 4BNZA 6ADHA 3EK2A 3F4BA 4CJXA 3KRTA 1RM4A 3M1AA 4QO8A 3QV1A 4EUEA 3PFWO 5JCJA 1J6UA 1M6WA 1VM6A 1UXHA 2TMDA 3OJLA 3QWBA 3B1JA 4XDZA 4Y67A 4KWIA 3LT1A 1D1TA 5ER6A 2V7PA 1DJNA 3PYLA 3Q2IA 4M89A 2B4RO 3WGIA 3D5TA 3EZYA 5COQA 4YQZA 3A4VA 2QZ9A 1S7CA 3DMTA 3PHJA 3SC4A 1OOEA 4J90A 3D3WA 1A71A 2IZZA 4OMUA 2YUTA 1LRLA 3PIIA 1ZJYA 3JQAB 2X58A 2Q1WA 2BMAA 1Z45A 2GPTA 1N8KA 5G4KB 5JAMA 3ETEA 4CMBA 4OOFA 2HMWA 2NV6A 3ICCA 3JYQA 4HNGA 3WNQA 2IZ0A 1R15A 3RD5A 2GSDA 4PIVA 3GEMA 4A10A 1NASA 5H81A 1Y5MA 2W2LD 2V6MA 4YAJA 4D3FA 3CKYA 3GGPA 4RLHA 2VHXA 5A9SA 3H9QA 1SNYA 2Q2VA 2IRWA 2IXBA 1NQTA 5LCXA 3VTFA 3FHLA 4CMEA 5COAA 3WGGA 1UZMA 2FPIA 3NJ4A 2X0IA 1R37A 3HDQA 4NU5A 4E5MA 1UJMA 5A4DA 2C5EA 4YDRA 3GA0A 3FI9A 5BNTA 3JQ9A 3OQBA 4HX5A 3I9JA 3BMNB 3GDFA 3OJ0A 1IL0A 1Q1NA 2AEMA 4AJ2A 1P1KA 4WNIA 2YYYA 3JQCA 1TI7A 2Q2WA 5G0VA 3PHIA 4Z0TA 2AQKA 3TDKA 2FOIA 4RVDA 1Q7GA 3HWRA 1PR9A 5JS6A 5COBA 2CF5A 4Y6RA 4BNYA 4JBIA 1WWKA 4EYEA 2YV2A 3DZKA 3CZRA 4DGSA 1JQBA 1MV8A 4CLEA 2X1HA 4PN3A 2E37A 4H15A 1O6ZA 1NFRA 2Y0EA 3DL2A 4KMSA 3RBVA 3OIGA 4PLHA 1E7RA 2YQ5A 4OYRA 1UXKA 1T1RA 4KP7A 4UUNA 1XG5A 1BDBA 1HEUA 2D1YA 2ZJ0A 1FDSA 3GAZA 5TX7A 4L73A 4OL9A 3U4HA 1WVGA 4AJIA 5A5EA 3F6YA 1K6XA 3HN7A 4XIJA 5L3ZA 5A1TA 1ZVMA 4YBZA 1YWGO 2BGMA 1DHRA 1GTMA 1LDNA 4MVJG 2A35A 2EKPA 1ZZEA 4GLLA 2NNLD 4CQMD 1KVQA 3ZU3A 1AUPA 3IP3A 3GT0A 3PXXA 1G6KA 2O3UA 4AJ1A 2NM0A 5T6BA 5IZCA 5JY6A 4FFMA 1BXZA 3Q2KA 3F47A 4FJ0A 5JCJD 3KM0A 2HK8A 2OBNA 1SOWA 5IF3A 2DPHA 3ZWBA 4ZHSA 4CM9A 4XB2A 3TZKA 2FPGA 1LLQA 2LDXA 1E3LA 1Y7TA 1YBVA 4YAIA 4GKBA 3TZ6A 1QLHA 3AOEC 5KJCA 1DC4A 1DFHA 5L53A 1NHWA 3V8BA 4U0KA 2Q49A 4R5HA 3EW7A 4IQGA 1JU9A 5B4TA 5CPFA 1PJQA 2YHIB 4M54A 1Y6JA 4G65A 3IKVA 3JYPA 1MB4A 2ZTLA 1UP7A 4NJMB 5AXAA 3PQDA 1PL6A 2I6TA 1OZAA 2W2KA 1WMBA 1SCUA 2BI8A 5JC1A 4WGGA 2V65A 3KHUA 4OXKA 1C1DB 3WLEA 2R00A 1EVJA 4WCFB 3GVCA 4IZIA 1PQPA 3ON5A 4D41A 5KTKA 1X7DA 1B8VA 3M2TA 3C85A 1N9GA 1ZSNA 2AA3A 1EBFA 1E6UA 5KJ1A 1IB6A 3CMMA 2NTJA 3MTGA 3ZV5A 2H6EA 3AOGA 1RM3A 4LRTB 1UUFA 3C1AA 2POQX 1DHTA 1N92A 1K5HA 1NPTO 3RBXA 3C1TA 3BHMA 3VKVA 2PK3A 3EVTA 2G82A 5TRTA 2P5UA 5B12A 3JQ7B 2WD7B 4XQ9A 4AJOA 2GZ1A 4WLVA 4NIMA 4QTZA 3WWYA 1B8PA 3K9QO 3OIFA 1B16A 1SB8A 4OSOA 3OICA 2EP5A 4FOSA 4O63O 2Y1CA 4ND1A 4XIYA 4CL8A 4J6FA 1U28A 1NVTA 1DC5A 1MXFA 2X5OA 3GY0A 4NG5A 4WEQA 1JVSA 1A7AA 3ZGYA 3H4VA 2RBEA 1D1SA 5ICMA 1XQ6A 2Q50A 4YRBA 1E7SA 1EE9A 1NYTA 4HFJA 3VZSA 3GEDA 3GN2A 1LDEA 4JBGA 4XGNA 1UP4A 4BNMA 3G0OA 1YQDA 2UYYA 4INAA 3BTOA 1R4MA 5I9NA 2QYSA 1UAGA 1NR7A 2NTNA 1H9AA 1MXHA 2W90A 3C24A 3ZWOA 4FR5A 5DCWA 3I1JA 3NTOA 2IZ1A 2X6TA 3AY6A 2UUOA 2D5AA 1XA0A 3VPGA 3ETGA 3TZQA 1HDYA 4B3HA 3UW3A 1E3WB 3CUKA 5CHEA 3KSUA 1V6AA 1CQJA 3B6ZA 1NVMB 3C3XA 3E03A 4GX0A 3QY9A 1VJ0A 3I9NA 2CFCA 4G81A 1PJCA 4K6CA 3GPDG 4HBGA 2AE2A 4CM9D 4TROA 3S2IA 2Q45A 2YV3A 4RLSA 2OHXA 3ANNA 4L76A 4Z0HO 1B15A 4O1MA 2C7GA 2EF1A 3JQBC 5CDSA 1U1IA 2CZCA 3ZU5A 1GU7A 3HDHA 4WUVA 1CWUA 3E6AA 3WGYA 1IZ9A 1I2ZA 1PTJA 3FF4A 3G49A 4UUMA 3V2UA 1N1GA 3DBVO 5DP1A 3RUFA 3DTTA 1R0LA 1E77A 1UR5A 3KEQA 4IPTA 2Y1DA 1S6YA 1A9YA 3I9MA 3E8XA 2VUTA 2DAPA 3ASVA 4NR0A 4QSMA 4CMIB 3NT4A 1R4NA 4PLZA 4OHUA 1LSOA 2GO1A 2PGJA 5GMOA 3WQQA 2VRCA 4C7KA 2EJWA 3BAZA 4JJFA 5J23A 1HT0A 1H6BA 1MC5A 3LLVA 4L0QA 2UVDA 1K6IA 2J6IA 4CMKA 2JD2A 4JCOA 2QYTA 4PG7A 3IP1A 1HL3A 4FFLA 3K6JA 1IYZA 2OXIA 4RJTA 2CMDA 2VWPA 2GYYA 1AXGA 5C3MA 3DTYA 2C5AA 4ZU3A 4OQZA 4OJNA 4BNJA 4E3ZA 1EDOA 4UREA 1C0PA 1HDCA 5L4LA 3AI1A 4NFYA 2OMEA 1M75A 2Y05A 5KVVA 1U3UA 1K6JA 3AU8A 4IXTA 3WJAA 1IULA 1ZUD1 4FFOA 4MIOA 3HDYA 2X0RA 3B1KA 3CZMA 5G0TA 4BNUA 3PTZA 4IQ8A 2G0TA 5A9RA 2HCTA 1LDYA 5FF9A 5K6AC 1ZSYA 4W82A 1KEPA 2NACA 2W8ZA 1KEUA 4J9VA 4BO2A 4HWKA 4HKTA 5HTOA 1NNUA 3DBLA 4PLGA 2CNBA 1A9ZA 1XWFA 3FNEA 4MP3A 3RJ9A 3KYCB 3KEOA 4B8WA 4IDGA 2FZEA 1HLPA 5ILGA 1Y5RA 3AOEA 4GPD1 2JCYA 2Q4EA 1LEHA 3WIDA 4OO3A 1Z82A 4DL9A 3N58A 4LSWA 4ALLA 1IPEA 3VZRA 1LSSA 3H65A 4FFRA 4OSPA 1E6EA 3X2FA 3OSUA 4UULA 2Q3EA 3AJRA 1ULSA 3FN4A 4NQZA 2NU8A 4EI2A 1VJTA 3GC6A 1HKUA 1V8BA 1UXIA 3R6DA 4J1TA 3UVEA 1PJ4A 3WNVA 4J4TA 3PGJA 4Z9YA 5BQFA 1XSEA 2BLLA 5A3VA 2PZLA 1IZ0A 4E31A 3KLPX 3ORFA 2HRBA 1YB4A 3GFGA 5ITWA 5L45A 1HF3A 1H94A 1ISIA 3DFUA 3OP4A 2PLAA 4AJLA 3VPSA 1EQ2A 2XOXA 3IOYA 3GNSA 3ASUA 3ADOA 3WGZA 1F12A 4PLWA 4XRRA 1KVRA 2Y0CA 3PWSA 1GV1A 1ZXLA 2WYUA 1PJTA 3Q3CA 4IXWA 3GNQA 1SAYA 5IFLA 3Q1LA 4PGFA 4RO0A 4EEXA 2V6FA 2PGDA 2J3JA 4Q3CA 3CE6A 1B3BA 3E48A 1P9LA 1E1LA 3OF2A 2O48X 3GGGA 4EZBA 1H2HA 1HTBA 3UUWA 3MJVA 5TJHA 3L6EA 3CINA 5I7EA 3UH1A 2Y1EA 4M55A 1GEEA 2O3SA 4NU6A 3FWZA 5IXSA 3WB9A 3JQGA 3V1YA 2X8LA 3DMYA 3AI3A 3LZ6A 3O8QA 3I83A 4YJHA 5GZ6A 2B5WA 1TVEA 2VRCD 2EGGA 2VT2A 2ZB3A 2ZJ1A 1RJWA 4IDBA 2B83A 3I6QA 4DQVA 5JSFA 2PV7A 1XELA 1VRWA 4FBGA 8ADHA 4K28A 3PK0A 4MP8A 4RV9A 4YT2A 1MGOA 4A03A 2RH4A 4TMFA 3COSA 4RPLA 5F1OA 5ILOA 4J49A 2VZ0A 1PS8A 4JNKA 4BB6A 3IIEA 4CLRB 2Y67A 3ICPA 4BGIA 4D46A 1X1EA 1LQUA 2AEFA 1DSSG 3SX2A 2B4QA 2FSVA 4WLOA 1LDGA 8LDHA 2J3HA 3GG9A 1ZBQA 1OBFO 1N7HA 3KYDB 2PH5A 4RDHA 2G76A 2J5RA 3MJCA 3R3SA 2PKRA 3ZWCA 4U7WA 2O2SA 4E0BA 4D3DA 1JN0A 4CUKA 3VAZA 4QFDA 5ER9A 4MIEA 5CFZA 1YXMA 1ZJZA 1YBMA 4BKQA 4WJZA 1ZH8A 1DJQA 3VOSA 1P1RA 3HB5X 4I5GA 4S3MA 5DZSA 1YQGA 5G0WA 4D79A 1QYWA 4OM8A 4PG5A 1CF2O 4BNTA 2WD8A 4FCCA 4N5NA 1MG5A 2WYWA 3JV7A 3NGLA 2UAGA 4BKRA 1I3NA 1PL8A 3AW9A 4Z0PA 3PJGA 3KETA 1LC3A 3WYCA 3JQEA 1EBUA 1GUYA 5IDYA 4DLBA 1CRWG 3QVOA 1ZKMA 2HO5A 3ITDA 1YJ8A 2DVMA 2VQ3A 3TWOA 2GUGA 1E92A 3ZCXA 2Y66A 1GL3A 4BNXA 1M6HA 1O94A 3QSGA 1ZSVA 4F45A 1OI7A 5B1YA 5CDGA 4A73A 3OQ1A 3TZHA 1XGKA 4AJ4A 4ID9A 4LK3A 5FI5A 5DNAA 4TRMA 3DFZA 3QVXA 2FZWA 1ADGA 4MJLA 3PI7A 4BNFA 1EK6A 3AM4A 2YQ4A 5FFFA 1WPQA 3W8FA 1P1IA 4IGFA 3DZBA 3ANLA 4CLOB 3VH3A 4YJGB 3D7LA 1PZFA 3EAGA 2OO5A 3VH4A 1K89A 2CY0A 3H8VA 4GVXA 4XZ3A 4BOYA 4I5EA 5KCZA 2ZATA 4PLFA 2J5QA 5T73A 2Z5LA 5ENVA 4NDNE 5JXWA 3H3FA 4GSLA 4IZHA 1IHYA 1PZHA 1QG6A 1P45A 2EP7A 1ISJA 2O4UX 4Q39A 4R9RA 5K6AA 4R1SA 5EQFA 1HE4A 1E5QA 3RQSA 5DN9A 4CR7A 1BDMA 2NQ8A 4XYLA 3L4SO 2OP0A 3MJTA 2YDXA 3MJ4A 3NGXA 2YHUA 4CQLB 4NBWA 3DBRA 1O89A 2JL1A 2V6GA 4DVJA 4CM8B 4BNLA 4DLLA 4XB1A 4FGSA 1KETA 1RPNA 5B4UA 3RUAA 2VOJA 3I3OA 4RORA 3T4XA 1ID1A 4N18A 1LQTA 1O9BA 2NADA 4IM7A 3TFQA 3WMWA 3R3JA 4RPHA 3KTDA 1X0XA 2ZQYA 4CUJA 5B4VA 3O03A 2ILTA 3LF2A 1QYDA 3IKTA 4NFSA 3UICA 4DBZA 1AGNA 2BF7A 2OORA 4ITUA 3U4DA 1BG6A 2GRAA 2J8ZA 4ALNA 1H0KA 3WFJA 1C1XA 3QRWA 3PLRA 2HMTA 2BFPA 3GUCA 2HMUA 1F17A 3FNGA 3PHLA 1I3KA 1QV6A 4DUPA 4F46A 4QT0A 4IJVA 1FJHA 3I9LA 4WECA 4ZQGA 4ILKA 3GUYA 1DFGA 3WXBA 1XCBA 4NFHA 2PH3A 3AU9A 3DONA 5L9AA 2IE0A 2WYVA 3E9QA 1IPFA 5BSEA 4PZCA 5LC1A 1NQOA 4GKVA 4BKUA 4DIFA 2VNAA 1DRVA 3KVOA 5GY7A 2NU7A 1H9BA 4NBVA 1U3TA 1Y8QB 3PRJA 1DLIA 5BSFA 1QYXA 4YJFB 2JHGA 4EJMA
chains in the Genus database with same CATH superfamily
5J2TB 1CUCA 3DQQA 4L28A 4UU1A 2AJ8A 1RWWA 4XWYA 3EEFA 5JSQA 4CM4B 3DZGA 5FDFA 3GRKA 1CUIA 3NALA 4DRYA 3IMGA 4J16A 1UBGA 4F8YA 1AIPA 4RL6A 3FDIA 3T95A 1YZVA 3UMJA 2ZJ4A 5IPFA 4FMDF 1AS0A 2OAGA 4GBMA 5ALDA 1JEAA 3E84A 2ET6A 1FDTA 2SCUB 5CPBA 3SQOA 4GGPA 4MV8A 1I51A 5C5DA 4XFJA 1X7XB 2PFKA 4TKUB 2VXYA 3ZS8A 5CXSA 2RCNA 1BMDA 1RZVA 1US8B 1YCFA 2ODPA 1E32A 4MYUA 1JQJC 3L8DA 4KI7A 5DCYA 1GSIA 3QFFA 5ALZA 4UBIA 5KVQA 2DT5A 3E15A 2RHOA 4IL5A 4MW2A 1ADFA 3IPRA 3RHFA 3ZWPA 3W79A 3HHEA 4DPMA 1NBMA 1TQHA 1T13A 2PMCA 4C0BA 4H3VA 4KXNA 5AESA 4MKXA 4KXVA 1EBBA 3D0KA 3Q88A 1GZHB 4UCQA 1LA2A 3FKSA 4BNHA 2R65A 3ZYCA 5LLDA 3RYIA 2REBA 3GZ4A 3KXDA 2XZTA 4JOQA 2AMFA 3PXEA 2I9PA 4NECA 2JFVA 1C9KA 2D2EA 3KYIB 1TYDE 2ZRAA 1T2EA 1E0JA 4MCJA 3ZZTA 4ZGWA 2V6JA 1ORHA 1D9ZA 3TAHA 2VQDA 1B23P 5DBGA 3X43A 1NBOA 3TNJA 3KOZA 3JSXA 4BGVA 3B5EA 5M04A 4UDYX 5I5EA 2AMYA 3IAHA 5DHRA 2IA5A 4HJRA 3W4KA 3VPXA 1M1XB 2BGGA 2RH9B 3IKLA 2OD2A 3FHJA 1ZD9A 2IXAA 2OBLA 4K9PA 5EFOA 5A3SA 2R6DA 1CVRA 3UAOA 3KTAA 2R3SA 4QYMA 1U7WA 2EGHA 2G8NA 4R2XA 4R1MA 1DKMA 3G5TA 3SHVA 2G4CA 2WT4A 4EZIA 4EA9A 4EG7A 2UYQA 2C9BA 2PX4A 4LDRA 4O4JB 4PV7A 1WHTA 2GEBA 5ALSA 4GOJA 4A6DA 1KU6A 3PJEA 4C0HA 3I72A 4YRTA 2GBCA 3QE4A 1X92A 5AQ1A 4LSGA 4QU5A 2P1DA 2YMQA 3WV4A 3HFGA 3NHJA 2VTBA 3A04A 4EKEA 2BI7A 2YWRA 1VJGA 4RVOA 3DVLA 4WEOA 1PCXA 4IQFA 2G6BA 3WAKA 3EWNA 1UYJA 3QKRA 2I55A 3KR2A 2XQGA 4RK6A 4RCVA 1QDUA 3MMPA 1IZZA 1RKXA 4KRYA 2Y93A 4G07A 4OAPA 2IYZA 4OUDA 1R0ZA 4DV4B 1EWQA 2LKDA 4RMJA 4HXGA 2PZMA 5KYTA 2VJDA 4JL5A 1QFXA 5KYUB 5B1HA 1IXZA 2YW2A 4KXXA 4AROA 1E9FA 2RAUA 2CUZA 2PNFA 2XYRA 2ZB7A 3JW8A 3OQIA 3PQ8A 3HXLA 1IDN1 4LXGA 1IJFA 5FWAA 2QM8A 1T10A 1GKLA 5D2CA 4KEAA 1ZXBA 3CZPA 1V8ZA 3HNRA 3S7ZA 1FSSA 3NETA 2EATA 2ZITA 2JBAB 5TT0A 3PLAE 3IUQA 1O1YA 1P2FA 3UJDA 1QG4A 3KPUA 1DAEA 4UARA 5ALXA 1LPPA 1JHZA 1E2KA 1GCUA 2VWGA 3NHLA 3WGNA 4W5WA 4PR0A 3CNOA 3T3DA 1YJBA 3K2IA 3WSVA 121PA 3ZDQA 3NTLA 2A30A 3DZJA 3O2JA 3Q10A 4R68A 1NW5A 3VU9B 4UM8B 4ZVNA 1LU9A 3OC0A 2Q21A 3DA8A 2V7QD 5A3JA 1WE2A 5CDTA 2UUPA 3ZWQA 3OESA 1BJTA 2ONKA 2CF6A 2I3ZA 1LBSA 1EZ4A 4R41A 3ZWNA 4DKJA 1KF0A 4IIHA 1MZVA 1KP9A 3I92A 4L5IA 3NDRA 2XWSA 2SKCA 1VL8A 2VSOA 2X4IA 1EKXA 1U0SY 3MBKA 3NAMA 3ROGA 4CW7A 5JADA 3RADC 1ZNQO 1CR2A 2F1OA 1VIYA 3D0QA 1WDKA 3NHZA 4XYMA 4OI4A 3V8PA 3BGIA 4BO9A 4WXHA 4WOBA 1KO4A 1ENZA 1IBRA 3VNRA 4ACAA 2G9ZA 4ML3A 4Z51A 4TYYA 4RHYA 3M82A 1FNDA 3SPXA 2VJMB 1VSVA 3TLAA 2FHSA 2XIJA 4ZEXA 3UJHA 3VPFA 4DCJA 1XAIA 2IV3A 4RTKA 5JUWA 4JBHA 3ZBQA 4Y2XA 4L6CA 2PKYX 1KY4A 1ECGA 1R6UA 1SU6A 1Z29A 1G21B 1SVKA 2JW5A 2Q0HA 4GECA 4UKDA 3JQDA 1X7WA 3M7IA 3B3FA 3UK0A 1YE5A 5AMXA 4BMCA 4AY6A 2NX2A 1QOPB 3JTMA 2I6SA 1CQZA 1EM8B 4HH0A 3FYUC 1Q0ZA 1ABFA 2BJHA 4MNTA 4Q4JA 3VR5H 3GU3A 1T3HA 4GICA 3ZNQA 2O8EA 3TBHA 4KWTA 3NHMA 1GDHA 3JQ8B 4D9MA 1R6XA 4JOCA 4UVEA 1K7SN 5D7NA 3S6JA 3I04A 5B58C 3T7TA 1LLDA 2Q3FA 2WHXA 1WBBA 4IDFA 2OFPA 2FMKA 4U0JA 3KVRA 4E5SA 3H1AA 2DFTA 1B14A 4RVUA 4Z8XA 5ALQA 2JEOA 4L85A 2FFAA 1Y1PA 1C0KA 4M76B 3SF8B 3OKFA 3ZBTA 3MUFA 1M1YE 4CU5A 2HYIC 1I36A 2K4MA 2VDWA 3WQBA 5E3IA 2BUCA 3V4RA 1TYEB 4JB8A 1PR6A 4RA6A 5JJIA 5TY0A 1G291 2PKQO 4B2LA 3G7NA 3AGQA 1S0UA 3PQFA 5JSZA 1QS0B 4HY3A 1E1CA 1XZPA 1JAYA 2AG5A 4HVTA 4MAFA 4OQMA 1S01A 4OXYA 1QP8A 3KB2A 1A4UA 1RABA 5B3KA 3ORHA 1F06A 2G72A 2Z95A 3LYLA 4Q6BA 3RTAA 1B26A 3ZE7A 4ZICA 3HCPA 2H1CA 4BVHA 4MS3B 4FCWA 3ZGOA 4CTKA 3VO8A 1ZK4A 5TVOB 1NVXQ 3SE7A 1C3EA 3OM0A 2PHZA 2X76A 3KVNA 3O4FA 3QVGB 1OYVA 5HCUA 3V7WA 3WVNA 4D0RA 2C57A 3O9MA 3THOA 1P0QA 3QPVA 4B3MB 3BMCB 1DAKA 2QD2A 4JT2A 3UWMA 1YIOA 2A0XA 4YJDA 4EI9A 4KMMA 1H0SA 1EJ6A 1XWIA 1Y8RB 3DZ4B 3WJ1A 3BE6A 3ZHZA 4AJKA 4V0MA 2FKNA 3GG2A 4RKQA 3SQDA 2GDZA 1H1LB 4P31A 5E0KB 4KK4A 3QBTA 4YMUA 3FUCA 3RVMA 1LB1B 5DOZA 1RXVA 3NO4A 1LFAA 5JD3A 1Z18A 3FYDA 3PNVA 2R6FA 1OKKA 2QLMA 3SJ7A 3ER8A 5LJLA 3U56A 3HYLA 4CKXA 2ILVA 1R8XA 4HLUA 4BQQA 1LV8A 3HVRA 3KKPA 4ZCMA 1U2PA 1QR6A 1F14A 1OA1A 1OFUX 1TD9A 2YH2A 1W30A 5C8YA 5REQA 4ONEA 1CK4A 4QOFA 4D26A 2HGSA 2PN1A 3GRUA 4ISBA 4W9MC 5IDXA 1ZDMA 5KBYA 3MNFA 4RPKA 1CW2B 2M98A 4X1YB 4G84A 5JSUA 2GK3A 4K1LA 5JMPA 1BHSA 1C1HA 1LBHA 2AR7A 3CUEF 3R7AA 1HI9A 3O1HB 3OD1A 2VI5A 3N2ZB 3NBUA 1PEYA 2NVUA 4DAOA 2APJA 4ENUA 4WBNF 1AQYA 1V1RA 2RGCA 2CUKA 2WE8A 2H08A 4R1LA 5L3RA 4PG4A 5G4LA 3QP9A 3ZJTA 3I9OA 3WHPA 3TJRA 3E2MA 3E8SA 4UNSA 2EKBA 2C2WA 3THXB 1YBAA 5FQOA 4DUYB 1WA5A 4V0KA 4TTSA 4CMHA 3IBGA 3M89A 4G0NA 3GJXC 4JP2A 4UE6A 4F4CA 4BE4A 1MTZA 3DT6A 2Z2YA 3PF8A 2FUKA 3ZQJA 1TVMA 2HU7A 2GJ9A 2YC4C 3H2SA 1DIOB 1GRQA 3Q41A 4GGOA 3WV5A 2V58A 3ELUA 4IUDS 4RK7A 3L7JA 2J3KA 4QICA 3RIYA 1SEPA 2Z2ZA 3T9CA 5JQWA 2Y71A 1O7JA 1U7UA 5HIAA 1VJRA 1P7PA 1M2KA 1SUDA 1T3LA 2B92A 3E70C 2P77A 3FSRA 4IINA 4KW7A 1YL5A 3AY3A 4JT8A 4O3MA 4X8LA 3DHNA 4P93A 4BQNA 3FYHA 2QN9A 1R7RA 2CHFA 4J3NA 3U37A 2WM8A 3BHIA 5FL7D 4DV0B 1YFJA 2FYTA 1EHCA 3G89A 3IPXA 3TLGA 4RPJA 4BGEA 5AXCA 4H4CA 2E4ZA 1IVYA 4W7SA 4BQOA 2RHLA 4QUDA 2BR4A 3HWWA 5KQPA 4WACA 5T7BA 4O5AA 3BK7A 3GD7A 1P4SA 1Z7BA 2PE5A 1JDPA 2R8RA 2A78A 3MINA 1N2CA 5KTMA 5JJBA 5AK0A 3MGGA 4DR1B 1A50B 1LPSA 2D5BA 2ZAGA 3E7PA 3OZDA 5DISB 2VAVA 2XYQA 3LBHA 4MRAA 1K98A 2XB8A 3KQMA 1K5PA 2NZYA 2NV2B 1Y1SA 1UC8A 2PUAA 1WXWA 1AQIA 3I2HA 2VF2A 4JVLA 4QDUA 3ZH2A 2G09A 3TRFA 1S3IA 5AXBA 5I9BA 2RIRA 2PRJA 4RTOA 4R51A 1P1CA 3QQ5A 1PUXA 5AJTA 1KI6A 4UTNA 2QY9A 5AI6A 3AUKA 3WGLA 2LPMA 2P2YA 1FS6A 2FMHA 1T5OA 2R6HA 3HADA 2C0PA 4CIXA 5HJEA 5K0EA 4EDFA 1F5NA 4QNNA 1QC5B 3E5HA 4UE3S 4KR2A 2O3QA 2V5AA 2Y76A 3H7AA 3O0DA 3LM8A 4GXTA 1YOVB 4YMWA 4BL5A 1F1BA 1N6RA 4CQMB 3HXKA 2GTPA 4COOA 3ZU4A 5BSUA 3WLMA 3ZHYA 1ST2A 1GPJA 3B3QA 3FJYA 1Q0SA 1PT8A 2I2XB 3GOHA 1O95C 5HF5A 4ZCRA 5F12A 3K70C 5GADl 1P17A 3RSSA 1XXHE 2Q6OA 3JZFA 4YH1A 5LP6C 1PJ8A 1ENYA 1OWLA 1XEXB 2C1XA 3D1JA 3K1AA 3MTIA 4RS3A 2GZDA 5ECDA 1IEXA 5MFPA 3JYLA 3CZ5A 2C7PA 3DV0B 3FWHA 3JXEA 3MGCA 1UJ2A 3K7EA 3OZTA 2UZ4A 1ZHOA 3X0DA 3I42A 3GK3A 4L4RA 1AD2A 1Z0KA 3ESDA 1MC1A 4IAOA 4U8GA 4DMRA 2KQUA 5C7IO 3KWMA 2PZKA 3AF1A 2C92A 4PCUA 1WCYA 3MBIA 4R9VA 3SM9A 5BUQA 3A1EA 1HWYA 3C7DB 1GADO 3FWPA 5FNZA 4CV1A 1WAMA 4LXXA 3JVUA 2C8JA 1CUSA 4RY8A 2H4XA 4FQ8A 1I8TA 4G5YA 2XAAA 2YVAA 4A5OA 2W98A 2ZULA 3AQIA 2E1RA 4KFCA 3ICVA 3TUTA 1CP2A 4Y6SA 2OUIA 3AEKA 3GDWA 4HXEB 4OH1A 4Q9JA 3RVNA 4A8JC 4BWGA 4DLYA 3L43A 5DRYA 1YDEA 1OZFA 4KBFA 3IC5A 2HLDD 2HHHB 5THQA 1DDOA 1QIIA 3AETB 4KRFA 4DJ5X 3F1KA 1EFLA 4KV7A 3RG2A 2FAXA 1OXUA 1RAAA 4GF5A 5JAIA 3LCRA 5AI0A 4B6SA 3IOCA 2XSZA 1ZK2A 2ODEA 1ZFNA 2C3YA 1FFYA 1N3YA 2AQ8A 1XU7A 3NOVA 3W5AA 1QGED 1XRNA 1B42A 3NH6A 3UPDA 4ES6A 3LZDA 2JLBA 4HAUA 2CGEA 2BBSA 3U4AA 1JENB 1ND6A 2VTKA 3P8ZA 5E9JA 3RUPA 2PXAA 1RACA 4MV4A 3BD7A 4IEEA 3G8YA 4GXQA 4QJ4A 4LKRA 2VS1A 4E4RA 3FMFA 4QXMA 1T9AA 1MOQA 3R0ZA 5G1OA 3HJGA 3F5MA 3C7AA 3S4YA 1E4VA 2XNCA 4ZV7A 3VPAA 1V11A 4BHTA 4QDXA 3B52X 3PG5A 1JKFA 1KP2A 4I99A 4BFSA 2QI9C 1A98A 3WP0A 1OAOC 1JT9A 4AO8A 3LFHA 3DMNA 4B46A 4D45A 1P1FA 2GZHA 2WMDA 5JC8A 1HNNA 1GJRA 1XVUA 3SEAA 3G0IA 2Z8XA 2OV2A 4XJTA 1CEEA 1XKQA 3DVRX 4JUDX 1QTIA 1HDRA 2O2XA 3PQEA 3D6TB 2O5EA 3SMQA 2QR2A 3VI4B 4I5DA 3FLEA 5FTNA 3K8ZA 4IIVA 3W2EA 1DC3A 1PDOA 1T1JA 2PSJA 2WRZA 5CA1B 1OQAA 2BCGY 1ZGZA 3G9TA 1T2CA 2C5HA 3PSAA 1TA4A 2X14A 3GLVA 3I0NA 3QTTA 4R9NA 2RHGB 9ATCA 3F4LA 3OJFA 1YTUA 2BDEA 4HGYA 3JQAD 2QX4A 1CC1S 4J43A 4BUCA 4OGWA 2O8BB 2VH1A 3FPGA 1M0WA 4RIFA 2I29A 4J9UE 4HNUA 4UVIA 3HKBB 1J0XO 4YUAA 3O8LA 4LC0A 5F9FA 3MW8A 5LNK6 3W9BA 3SE0A 4ZQHA 1IM2A 1R0CA 2FEOA 3F5DA 4MIKA 4WCFA 3KQVA 4IO0A 1HO3A 1U6JA 4OQNA 3TQTA 5JROA 1UOQA 5DDIP 1KMQA 3QX7A 5DEOA 1W52X 5FBHA 3JQBA 2DUWA 3DC2A 2HQSA 5C7LO 1ZI8A 3WY9A 4X85A 2BAGA 2OT3B 2FWRA 5EERA 2Z98A 4FSDA 3GLRA 4E70A 1Q1ZA 4XLLA 2O9JA 3UMRA 1C4KA 1TECE 2AN3A 2P9CA 4C0XA 4MLDA 1J5XA 5ALRA 1KY3A 5H80A 3LXRA 3V8VA 5E6SB 2UYHA 1CBUA 3HB1A 1RM0A 2G77B 1NR1A 3HZRA 1QYCA 1XMOB 1NMEA 4QDKA 4L75A 1P0FA 2YJZA 4WK2B 3TGLA 2MSEB 1KGDA 2VBIA 2X6RA 3IUMA 1G20A 2HQ1A 2QJTA 4TZTA 5A71A 4ZMSA 5BWLA 4RJLA 1DQSA 4DMMA 4RXTA 2FQXA 3W5DA 5DN6A 1S8OA 1YDMA 4ROSA 3NYWA 3EZ6A 2JAPA 2WD7A 4H4EA 1PW7A 4R31A 1YL6A 4X6XA 5K01A 3R9WA 2GLXA 2CKMA 2ODTX 2RBGA 2EG9A 3P9XA 5KREA 5A0TA 1JA0A 4CIDA 1BW9B 5KNDH 4NYMR 1SXGA 3FYCA 4QOGA 4QFCA 3NCHA 4EB8A 1XMJA 1SCUB 2WTNA 2FW8A 3IT3A 4KL8S 4TT3A 3PC3A 3L4JA 1EX9A 1SCKA 4HVLA 5KQGA 3EASA 4PO3X 3EF0A 3GH3A 3WZLA 5JZVA 1I5EA 4IO1A 4JJ6A 2DBQA 2I1LA 4EYGA 2BFNA 3DXYA 3MVEA 3IR5A 1P44A 5JVDB 4CRWB 1PV4A 2YV1A 4NMLA 2IODA 3ENZA 5K8CA 4ER5A 5CDUA 3GPLA 4KBYA 1O3YA 3KJXA 2RKWA 2VAWA 2ZAMA 2PM8A 3MEQA 3KSRA 1AQUA 1TQDA 3I1YA 3ONWA 4TQAA 4W5JA 1CZLA 1SM4A 2EW2A 2HI0A 2C2GA 3LHFA 4I1RA 3MAJA 3N2KA 1K1EA 2C7BA 1A9PA 2OQ2A 3JR3A 5K3AA 1A27A 1YMQA 2GPNA 5IJ9B 3K0KA 3PFFA 2W2XA 2WLTA 5DIZA 5CX1A 2BE7A 2P4QA 3PI6A 3CNNA 4NX2A 4NXMB 2FOXA 3PLNA 4M88A 1T5IA 4JXKA 4MQ4A 1LNQA 3C5VA 1GY8A 4CG2A 2BV3A 3VX4A 4IJWA 3K73O 1O6CA 1Y3AA 2CYAA 4IX9A 1XTQA 3STTA 1MX5A 2VPIA 1EWVA 1UBUS 2A9KA 2XQKA 3SYMA 3I34X 3Q5EA 2RAPA 3FTPA 4BBPA 4YAKA 1U2ZA 3NHYA 2Q5FA 2YCBA 5GONA 2IHUA 2R6JA 4UCFA 3GA5A 1OXSC 1WY7A 1S3FA 2NSJA 5G53C 2B21A 2QXYA 3GYBA 1LD3A 5DT9A 3RTCA 3TX6A 721PA 4DR7B 1TCVA 4E5NA 2YIVX 3AKDA 4J76A 4Z1OA 3AJEA 4JEHA 3ZX4A 3WRWA 3OZRA 1RYYA 4KTVE 3OTQA 5GM2A 3L1JA 5CJPA 2YHSA 1ZLXA 3A4LA 3ONDA 4Q9DA 3VPBA 5GINE 1XVAA 2HB6A 5BRNA 2VAXA 1OX6A 5EKTA 4DV6B 1NMZA 3IPAA 4NY1A 3A8TA 3UWKA 1Z74A 2QE7A 4L2IA 3PS9A 4Q82A 3ROZA 2E4AA 3ELYA 1KZHA 3LYHA 3WNBA 5BOSA 5EIXA 1UWLA 5KTRA 1QE5A 1P1BA 3NAZA 2Y1GA 4TV8F 3P96A 2GBLA 3AP2A 1SXQA 1JKXA 3UATA 2NUPA 4PPNA 1AO0A 1WCXA 2HJRA 1RYMA 3KU1A 1OB2A 2PS9A 3DDUA 4D56A 5BN4B 1GT91 4XEUA 1WMEA 1TO1E 1RYDA 1QPGA 3HLTA 4XIIA 3OH8A 3RRMA 2ZPAA 1AKNA 5F52A 4E30A 2ONJA 4MHOA 3M5PA 3GJ6A 3JATA 4OG2A 2UV8A 1SBIA 5TQJA 3LC2O 2A6PA 2FH5B 1CQJB 1VSUA 4ZTBA 1TUEA 4HNVA 3KQWA 3R5KA 1D04A 3K15A 4IH9A 3W2IA 4LCBA 1J9EA 3QLUA 3DB2A 1O6BA 3GDHA 4G89A 4RVHA 1KXZA 5DP2A 3U9LA 4FGWA 5AKYA 4GSKA 5JI2E 1TTPB 1DTWA 4K9LA 4OQFA 1JQLB 4UNQA 3QE9Y 3ABSB 4P7BA 5EWMA 5DV9A 2JGEA 5CVCA 4B3RB 1SUSA 4J7UA 4K5QA 3CEHA 3MILA 1QBKC 4TKLA 2ZYGA 3GLHB 2GH1A 3AL0C 4C7OA 1WCIA 3JQFC 5L7WA 1KEVA 2EKLA 3PPWA 5LOVA 3K8OE 1G8KA 5KWEA 5ERYA 4X60A 1QVAA 1G98A 1U9ZA 5CFMA 1ZJ6A 1BS2A 3N2GB 1OX4A 1ZOPA 3G68A 4KE8A 3RUFA 1FPMA 4HK4A 4AY5A 1QWSA 2VHTA 4O8JA 4O89A 4XGQA 5B37A 2DTDA 4AXXA 3H9UA 4QPNA 3TMAA 3QFHA 2P6MA 1RTTA 1DIGA 1FX0B 3LS2A 3S40A 1FVFA 3SR0A 1CIVA 4AC9A 5KQLA 2Q1SA 1PR3A 2VNIA 2JFWA 3I8SA 4D4IA 2X41A 3G59A 2NGRA 3TD9A 1IJEA 4F4UA 1OXTA 3CPJB 3CWZA 3H0CA 2O7RA 4HFNA 1T34A 1IXSB 1EFPA 4AZTA 4W5HA 5EINA 5JDIA 1LTHR 4ID3A 1RQNA 4RZ3A 1UDCA 2PRSA 2HCJB 1JZQA 3O2QB 1DRWA 4JLPA 4MVJE 1S2IA 4GM0A 3NTUA 5AJHA 1FNNA 2ZRJA 5AW8A 1GUBA 1ODCA 1AB5A 5HJ2A 1HZZC 1J07A 1EUQA 5AM5A 3UAGA 4BWYA 1J09A 1T9HA 2IXEA 1K3TA 3O83A 3U0BA 1KMMA 4LDPA 1EGMB 1SELA 5ESRA 2IYSA 1Z63A 4O02B 4B3FX 1I30A 4JT9A 4U6SA 4B4DA 1GGJA 2GZ3A 1I32A 3IULA 2F48A 2Q2QA 3OHPA 5G3ZA 5JBQA 4IDPA 4EUHA 3JAMA 4QM6A 2WT9A 1DOZA 1YD7A 1RR6A 3GEGA 3NC0C 3U0VA 2OCDA 1LRKA 3ZGVA 4H3KB 4NK5A 1VKRA 1H6DA 1JLKA 1O95D 3K70D 5CG2A 1RMTA 3EZ9A 3OFSA 2C98A 3ZIDA 2B1RA 1QZUA 3AP1A 3TOSA 4TPKA 2NSYA 4HAOA 3HRIA 1G7RA 4MI6A 1MB3A 1XZNA 3AONB 3HA7A 4YI3A 4EY5A 3MYYA 2BDUA 1YL7A 2NO9A 3WKAA 3B9PA 1OYWA 2CFOA 3KOXA 4M4SA 3ILSA 3EB9A 2LCFA 5D6OA 2V9CA 2AWNA 1FS5A 2QG4A 3IJEB 2G7ZA 4AP5A 4AL4A 3DTVD 5A7GA 2CJFA 4QXQA 3ZW8A 3M6LA 3PHGA 4HEA1 1VLMA 1X7GA 2ZPUA 1ISGA 3G0DA 3QYPA 3TXXA 3WS7A 4EFDA 4XVCA 5KX5B 2XLCA 1XDGA 4M3NA 1H8HD 1JJAA 3OCYA 1SCIA 4TS3A 2PKWA 4A2CA 4MDHA 5F1KA 1P81A 1Z0SA 2FG7C 2C3MA 2XNSA 2IP2A 4G41A 3DCIA 2XB4A 4NDAA 4U9UA 3AUUA 3ZV4A 4LRSB 5NLLA 2DLNA 3QW4B 3ETHA 2KBEA 2KMLA 4LBYA 2EOAA 4LYHA 2BDTA 1T43A 1W76A 3KUUA 1AT1A 1Y4AE 4WJLA 1VE9A 3IUBA 1QHFA 3F3SA 4LDNA 3A6ZA 1Y5LA 4LQCA 3CEPB 4I9NA 1Z56C 4W6ZA 1F8YA 1R88A 5EP2A 4G5OA 5FV7A 4W7IA 1JA9A 3ADKA 2R1ZA 4YWJA 4OP1A 1H2YA 4QSHA 6YASA 3FBWA 1TM3E 3SC3A 1HV8A 1ZEMA 2PRYA 4GU5A 4XA8A 1JDBC 2DPXA 3HSKA 1W0KD 3H2IA 4XWAA 3HMKA 4C0SA 1QQTA 3Q12A 4ZKEA 4KE9A 1W36B 3KELA 1RBZA 3TNLA 1KQNA 2F3RA 4DC0A 2QN3A 3SVLA 3BWXA 4G5QA 3TE6A 2XBLA 1MJGM 1GKIA 1KVSA 1BE1A 1LDBA 3DZIA 4DCGA 3H2JA 1PU2A 2Q22A 1NP7A 3U3XA 1R0KA 4M49A 5EIOA 1GTJ1 8GPBA 1K27A 4J1NA 3TG8A 5A4IS 3JQGB 5DCUA 4C3ZA 2EX1A 2RGDA 4JI2B 5CIQA 5CLGA 1IXRC 1J97A 1KS9A 1AE1A 1V5WA 1PYOA 2BFOA 3QA9A 4IIJB 1U3DA 2XNDA 1I7NA 2IUSA 4DPLA 1Z8FA 3ZKWB 3DBOB 1QIDA 3G0CA 5ALTA 4F4HA 1NFFA 4BTLA 3V2HA 2FWNA 2GHQA 2RK6A 4KRGA 2DHCA 5BURA 5JZOA 2Y1XA 1ECLA 1VIDA 3LL7A 1D1QA 4RF2A 4R7GA 5EQJB 1I0ZA 1W4BA 2G67A 4XTCS 2NSDA 4ZVSA 3GP8A 3HYCA 1CIJA 5KVSA 3I76A 3IA7A 4GX2A 1H93A 3QXXA 1Y9EA 3R9XA 2ZVDA 3QX8A 4JI4B 3EHEA 2IOYA 3E0XA 1UBCA 3TTSA 3S1AA 4F8EA 1HNZB 2IBSA 1N2HA 5AUNB 4RUKA 4GWKA 2B5VA 3V1KA 5TQ2B 2D0IA 4TLEA 3FCSB 3HBAA 4GC9A 5FTWA 3ZXSA 5CCEA 3FVRA 2W2PA 5JSKA 1X1CA 1BW9A 1EG2A 1A9XA 3DUWA 3NHBA 3WMXA 1GQ2A 2OVFA 1HDXA 4Z7NB 2ENUA 4IG4A 2DZDA 1CJKC 4ITRC 3KYJB 1EWKA 2H0RA 4L15A 3C5HA 4NICA 4QUAA 4LVUA 3HKEA 3ZJVA 2WA1A 2BEUB 1G63A 3GYGA 3H5RA 2I03A 3ED5A 1T2AA 1YA8A 3AM1A 3OA0A 2QQGA 1G60A 5C5EA 2Z1MA 3HNPA 4C6TA 3MWFA 3B1YA 3L0DA 5DYIA 4XM1A 4KDFA 4PG6A 1EPUA 1Y4DE 1Y9AA 5AKEA 4QLBA 4PRYA 3T4EA 3FDZB 1RRFA 2QX9A 5J1TB 3EC7A 1UWKA 5LQAA 4TL9A 3FRIA 4TKMA 1ORDA 4B7UA 1U9IA 3D4BA 9LDTA 2CXNA 4PXSA 4XFDA 5B3JA 5CITA 4IHAA 5DGTA 1LLUA 1BU8A 1T4CB 1XZIA 2ZEJA 3UOWA 2GPJA 2HF8A 3H1GA 3B82A 4P38A 3RASA 1BWSA 4F4DA 1GUDA 4F6CA 3H75A 2BKVA 4CQLA 1QV7A 1TD1A 3O47A 3E9MA 4KO3S 4R6XA 5DMHA 1RYNA 3LBFA 5ALMA 2I3BA 1K3FA 3PEFA 1GYRA 2F9FA 2J3IA 4Q9KA 2P6RA 2X40A 3PFIA 3CGWA 4AJ9A 1V4BA 5JO9A 4EENA 2DUUA 5LXTA 1JEJA 1CU1A 1ADYA 3RYFA 5HKOA 2AW5A 4BXOA 1K8RA 2J5XA 2MT9A 4G5HA 4C0KA 3O2NA 4G1VA 3RUCA 5E6UA 4XR4A 4M9CA 1ZMOA 2IEDA 1BHJA 2JH9A 2C82A 2AVDA 3IQZA 4LPKA 4DEXA 5E7IA 3LCVB 1QIKA 2OB1A 4C3OB 3OFNA 3R9IA 1TYBE 2X7HA 4WWHA 2P5SA 2VPXA 2RIPA 2PJUA 3OZUA 2IX9A 4FOLA 3H9BA 4ND7A 2OCXA 5FHQA 3BL8A 2PH7A 4AY3A 1LGYA 2KPOA 4P7FA 4TLDA 3GRCA 2CUTA 2Q5JA 2J87A 2EZUA 4OATA 3SC6A 3SHTA 4D0LB 1CQXA 3D7MA 1L6RA 3N6XA 1YS9A 1JLHA 2BF4A 2H1WA 1Y37A 1NONA 2PX5A 3V7UA 2GEJA 2EWVA 2AKYA 5LA6F 3LO5A 2J5KA 1E1NA 3BIWA 2AFVA 4TWBA 1J7KA 1FFAA 1TTQB 2QOEA 2DT8A 5B3AA 2AYXA 3DCJA 3QEJA 4C7BA 3A37A 3B78A 1J0EA 1Y42X 1YB7A 1SHUX 1FFBA 4D4HA 1R12A 1Q0TA 1T8TA 2P2DA 1GPDG 4JLUA 1G6OA 4Q6WA 3D64A 3AHEA 3BJMA 5TMDA 4C03A 2GPYA 4ALJA 4PHCA 4P4GA 1N75A 3TIFA 3ZE6A 2LXNA 4AS2A 3O26A 1ONPA 2W8BA 3AP3A 1Z4PX 2P27A 3BDVA 1Q0HA 4F86A 2OMKA 1RI3A 1A4RA 2A5YB 1FFEA 1SA0A 1XQ1A 4DDKA 2XRZA 1U3WA 2WM3A 2IOQA 2L69A 5DHUA 4GC5A 1JFSA 5KYYB 1EXVA 2YFHA 4WKOA 3CCCA 2J09A 3BMOA 4RKRA 5I7VA 5KTOA 3A05A 3F49S 4ZCLA 1NQ5A 4KQJA 1E59A 4TWRA 4YV0A 4U2CA 4D98A 1L1QA 1FLVA 1VXRA 3PNBA 4HDQB 3T7IA 4DUGD 4EF5A 3DE0X 2IYXA 1DT5A 4WLNA 1T0HB 5AM1A 3EIWA 2BZGA 1PQWA 2O8DB 3UN1A 5HM8A 3ITEA 4RHCA 3QFTA 4OBWA 5FORA 1M8PA 5A0VA 3QOYA 3T3NA 1SWWA 2AZDA 4K2HA 1J9GA 3EZFA 4NZNA 1GQQA 4BZPA 1QGYA 3UWDA 2YMLA 3S5JA 3SC2A 3M6AA 2PKQP 1FP7A 4MV9A 4IJKA 3A3NA 3ZWVA 2Q5HA 5K3FA 3LUPA 4ZZ1A 4IFTA 1JH9A 4XJSA 1PNTA 3FDJA 2JI4A 1USGA 3V8NA 5IJXA 3WLAA 2HSJA 1FSGA 2YYAA 2ZUWA 3HO8A 4EJ6A 2HSDA 3DDCA 1IN5A 1NV8A 2QEQA 1JKMA 1VMDA 3NRCA 4JKIA 1F9EA 2DEUA 1UKZA 2ZYAA 1IMJA 2P4HX 2QVYX 3OC6A 2D7CA 4AQYB 4J2OA 3WDMA 3FG9A 1A2QA 1NJ6A 2LZ0A 5U9CA 3MJEA 3X2SA 1Y9ZA 4HWOA 5IFKA 4Y2YA 1O5IA 3NEYA 2J9RA 4WBNA 1WEHA 1LK7A 3EBLA 3SHQA 1XEWX 2Q4RA 3QKSB 4TSKA 1J20A 3TTXA 3ICQB 1V6SA 3QQPA 1VC2A 3DBHA 3GGSA 2PG3A 3MCTA 4P2BA 3E53A 4GPZA 3VTZA 4F5DA 3E9RA 1BXGB 1NDHA 4QU8A 5ITZA 1DPFA 4J0HA 5FLKA 5FTJA 4E1AA 4CF4A 4BEVA 1CETA 2CNNA 1AURA 1RSZA 1RIIA 4RTQA 3LIIA 4DJAA 2PBZA 1NRWA 5JT1A 1TKAA 1V6CA 5KMGB 1TB4A 1ZL2A 4LOIA 3S8YA 3GP3A 1L7DA 3EP5B 1GAJA 3IXQA 1GCOA 2X7XA 1HYEA 2WG0A 3MRXA 4O2LA 4NENA 4IICA 5F78A 3GGOA 4MZDA 2WTUA 4BMVA 2JKYA 2H0QA 2B99A 4Z9FA 2RHWA 3O73A 3UKOA 4AKGA 1RZ3A 3E22A 1GNPA 4FUTA 4DM4A 1ZMRA 4ER0A 2C99A 3AB7A 1Q3KA 2GEFA 2QVCA 4L9WA 1YJAA 3WFZA 2ZWOA 4Z0NA 3TGPA 3EXIB 1BKSB 3RJMA 4L9RA 3ZNNA 2XJ4A 2C8VA 3RYCA 1U63A 1TEHA 3EDRA 4OHYA 4L4YA 4ATNA 1MT3A 1G8HA 2ZTSA 1XMPA 2EG5A 2GF2A 4MVJD 1Q17A 4UM7A 5C35A 1TLFA 4GQBA 4PQFA 5HK9A 1S89A 1EUCB 1VKHA 2H1LA 1SGWA 4MULA 3TNFA 1JJFA 5JYFA 3BFKA 2AF4C 3OD5A 4FE7A 5U4QA 3RGGA 1GU0A 3PNYA 4M87A 5LUBA 5A9SB 1XD9A 1RPJA 2IE8A 3QJGA 4PQRA 1KJIA 1F4VA 1OYYA 2WF9A 1E5XA 3VR6A 2VBCA 5E9QA 1AH2A 3SZMA 1KDPA 2QUBA 1VRVA 3BIJA 4MR7B 4BZQA 4C5BA 1R2QA 5BVGB 5EJ8A 2JDIA 3N53A 3L1UA 3TSYA 2L18A 3IYLW 3OBIA 1SXJA 4YASA 4XLTA 1ZOOA 5AI8A 2CLCX 1SHKA 1DPGA 1IRXA 1FXWF 1XK7A 3GZNB 2ZIAA 3AVUA 1OTYA 4BE9A 4E2WA 1JDNA 3N2IA 4EW3A 2PRZA 3IESA 3MLEA 2I6GA 1TLLA 4J8PA 2NSLA 1DNPA 2C00A 2QTGA 2BKEA 4ALMA 1OASA 5JD4A 3DLCA 1XX6A 3O7WA 1WABA 3MRVA 3EGCA 4KYUA 4PC1A 4XCXA 3A0RB 2ATXA 1UT6A 1ORTA 4COKA 3H2GA 4CPDA 3MIIA 3AR9A 4MW1A 4D4JA 3C3PA 2HV9A 3FVTA 4MS1A 1U0HC 3U44A 4I9UA 2C2YA 2HSZA 4YVFA 5TNXA 5EIFA 3DGFC 5H3LA 1NOKA 1GVHA 4G5GA 4WJKB 4NPAA 1FNBA 3R3VA 4E11A 4ND5A 4KRXA 4E12A 1JVBA 1IAQA 5F77A 2OAQ1 2ZBVA 4U9HS 1MR3F 2FSUA 4RGYA 3F1LA 4GAEA 1WS6A 1H6AA 1CQPA 3P5BA 2FVXA 1DKPA 1HRDA 3F7OA 1GPYA 3SX4A 1OSNA 2P9ZA 1EFUA 3PPIA 1E3IA 3NEPX 4FYXA 1K9VF 3W2GA 3L5OA 3ND6A 1Y9JA 2A4KA 4EHIA 1MVNA 2QIPA 1SOVA 1PUIA 4P2GA 4H08A 2Z09A 5LDHA 1O0CA 2GNAA 2G0NA 4K9NA 1OAAA 3B7WA 3STYA 4LGCA 2KWIA 2QLLA 2PAFA 4W1PA 5CHYA 4CG3A 3R1IA 2QXUA 5CYPA 2CXUA 4RHTA 4EKDA 1NVEA 2X8AA 1M33A 2JI8A 3UYLA 3KQTA 4ZI5A 5KI6A 1X77A 2Q41A 4A9AA 1XV5A 2ZANA 3PRYA 4ZOCA 4DLZA 4RD0A 3O0TA 2AN5A 3W4JA 2OCAA 3EP9B 5ESWA 1O2DA 3OAAD 1YS2X 2WUGA 4A2WA 1E18A 4MLZA 3BWEA 2FMFA 5DSTA 2ZRKA 4NEQA 3H6KA 5AW6A 1DCTA 5H83A 4BGUA 2JHFA 3KWLA 3ZWXA 2WR8A 4LOAA 4JU9A 4DDVA 1VP9A 2VHYA 2EBHX 3BEDA 1YAHA 3D6AA 4NCNA 1RFGE 3ACBA 1DUVG 3UC9A 1IY1A 4ZOQI 1XDWA 1ZOIA 2A8YA 2G9VA 4QGFA 4N7MA 2R5WA 4MRVA 1CY6A 1KAHA 2BUBA 4PYMA 2C61A 2JCXA 1RWVA 4HDNB 3WO1A 1AN0A 4JN6B 1JAHA 1LUAA 5CVEA 3PEYA 4KYVA 2WFLA 1AY0A 2CXXA 4X90A 1RLOA 1SUAA 4IZ6A 3FPFA 4QBGB 3O8OB 4YCJA 4TS4A 1WVIA 2HK9A 2O2JA 3OLQA 3P2KA 3PGXA 3DE6X 5ILQA 3EBOA 1SBNE 5K3BA 4X8HA 2XCQA 3UF0A 3WGTA 2WWYA 3GZJA 4RTRA 5F9HA 1TAUA 3JQ9C 1KZ7B 3BN3A 1GR1A 4WFKA 4ZO8A 1B73A 1VL2A 3ORQA 4HFRA 4NOKA 4B33A 4DEYA 2QN2A 2Z4TA 2PWPA 3OQVA 5EWLB 3ZHCA 1XN1A 2QN8A 3RRYA 1CVLA 2HBZA 1WDLA 3BKXA 3V80A 4EO7A 2ZAIA 3VDRA 5DYGA 2HK7A 4CKWB 3QWIA 5J2UB 2Z5GA 1OCEA 1W4AA 4ND2A 3KOUA 2XOKD 2NO6A 5CJ2A 2GCOB 3ZGNA 3O4RA 3DFIA 4EAQA 4HN4B 3UK6A 1WZIA 1DJOA 2PUFA 1PE0A 1Y3DE 1GO2A 4KC0A 3ZU2A 4MKHA 2QRHA 1AUVA 3BXEA 2DBYA 1YA4A 5AKGA 2NTVA 2BHLA 1BXKA 1SD1A 2PSEA 1Z4QA 1A4IA 3LCCA 4HRAA 5J63A 4BEBA 3GQBA 1Y5IA 4WFQA 3IVMA 3Q3IA 4ZIRA 4FIZA 5BORA 1OXKB 3GV0A 5JPCA 3VC2A 1CFZA 1I2DA 4I4TF 2W0MA 3FUWA 5BN3B 3THYB 4BJHB 3OKAA 4D99A 5AP9A 1Q95A 3TSWA 2O4CA 4R3NA 2XY4A 3HV2A 3U3OA 3OE1A 1NTOA 2IVZA 2Z9DA 1EFKA 2ZDQA 3DUFB 4HAZA 1HL7A 4PN7A 1KYTA 3EXFB 2H51A 3TDMA 5EA2A 1V2GA 3MTQA 3GOQA 4IGEA 4U2EA 4YX9A 2ZYDA 1QZXA 3I2GA 4CEIA 2HPZA 3IQIX 3X1KA 1ST3A 2C3UA 5EZ6B 4D9HA 3NBKA 2E9SA 1ZXXA 1P0MA 4JP5A 3GFBA 1HURA 4DJDC 4ZWNA 1F2TA 2BTOA 5DLDA 4D42A 2OECA 4YECA 4URZR 3U19A 1B4DA 4X6YA 4MWBA 5F5NA 3BZUA 4QTX