5BNTA

X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to nadp from pseudomonas aeruginosa
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
368
structure length
368
Chain Sequence
b'KRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVIDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
publication title X-ray Crystal Structure of a Aspartate-semialdehyde dehydrogenase bound to NADP from Pseudomonas aeruginosa
rcsb
total genus 115
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5bntA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bntA01
4JJIA 4AJEA 2JHFA 2DBQA 1JA9A 2G17A 5EERA 2JFFA 4HFJA 3GDOA 4CUZA 2EKQA 1PS8A 4XGNA 1XG5A 4CQLA 4OMUA 1F0YA 3JQAD 3GNSA 1YVEI 5A04A 2OZPA 5A5EA 3QVSA 5I7FA 1J49A 4CQMB 3HN2A 2ZB8A 4LRTB 3ZWXA 4GX0A 1TXGA 3A28A 1MG5A 2V6MA 4NK4A 4JP3A 5U1PA 3G79A 4H15A 2AG5A 3QQPA 5DN9A 2HQ1A 5FI3A 2EHDA 3OIDA 1UZLA 3ETGA 2P4HX 4BV9A 4YJFA 2P91A 4XX0A 3KYDA 1CETA 2J5KA 4NDNE 4YA6A 4NFHA 3ULKA 2OO5A 1L1FA 2C0CA 3H9QA 4WKGA 1YXMA 4NJMA 5CEJA 2ZTVA 5HA5A 3HB4X 4XYBA 1Y9AA 3H5NA 3A06A 5BNFA 3VPHA 2B5WA 3MJCA 2GZ3A 4KWIA 5JY1A 1TT7A 3JQBC 2EG9A 1GQ2A 2AMFA 2AQ8A 2O3QA 6ADHA 3JQGA 3D4PA 1BTOA 4MVJI 2VYVA 3GNTA 5TSDA 4RF5A 3I83A 3WQSB 4H3VA 1QP8A 3BHIA 2P9EA 3ADPA 1HETA 1B26A 2ZJ1A 4UVEA 3WQRA 3WSWA 3ZNQA 4AJJA 1D8AA 4K1LA 4B3HA 1ZK0A 3PK0A 1HT0A 2X4GA 2VYND 1DLIA 1BXKA 2YQ4A 4A27A 5KJCA 1A5ZA 3WYCA 2Z1MA 4URFA 3VH2A 2EGGA 1WXDA 1M75A 4E32A 1GZ4A 1U3TA 2RAFA 3GN1A 4MO2A 3GZ4A 4ALIA 4D79A 4EZBA 3DOJA 5BSFA 2P5YA 4RPKA 4PFJA 5JCJA 3SEFA 3GQVA 5JBIA 1GDHA 3DMTC 4OXNA 4JXKA 4XQ9A 4BB5A 3DOOA 3EVNA 5TNXA 4BO4A 1VL8A 1ISJA 2NSDA 2YY7A 4UREA 2J3JA 4F45A 4R01A 2PGLA 2OFPA 1N1GA 4L4XA 5K6AC 2X86A 4NFYA 1LSSA 4U8GA 2YV1A 3MJ4A 4AVYA 4DRYA 2CF5A 2W8ZA 1QYXA 5IZCC 4CL8A 2PKRA 1R15A 3OHSX 1GUZA 3I9JA 3O03A 5DOZA 2WM3A 2VT2A 4DGSA 3AFMA 3AM4A 1O0SA 3W8DA 1Y1PA 3ZNNA 3E18A 1E3WB 2PKQO 3IIEA 3DEYX 3N74A 1JWAB 1O94A 3UGKA 1ADBA 2YV2A 3LF1A 1GUFA 3ZWOA 2AXQA 2NU7A 5EN4A 1MB4A 1MLDA 1P0CA 3JQ9C 4BNUA 2D59A 2DFDA 3DTYA 1LX6A 3RKRA 3EZYA 1N9GA 3IS3A 4HFMA 1I01A 1DIRA 3AJRA 4BO0A 4II3A 3PJGA 3U09A 2QG4A 1ISFA 1YBMA 4DYDA 5TIIA 3AWDA 1DIAA 4RCVA 1K6XA 2G0TA 2I3AA 3VPXA 2GF2A 3FCOA 5T5QA 1EZ4A 1FDVA 2O3TA 2PK3A 3RKUA 2XF8A 4CQMA 4J4BA 2H6EA 5EIOA 4B7XA 5T67A 2F1KA 4HX5A 4LISA 4CLRB 4IDDA 1OBFO 1A71A 1PS0A 4CMJA 1PQWA 1VKNA 2PLAA 5AXDA 3JQ7A 4P4GA 3HDHA 3PFWO 2WTBA 1I10A 3RASA 3JQCA 3TRIA 3TZKA 4L76A 4YJFB 4AFNA 4GL4A 2NU9A 1SNYA 4RZHA 1E3WA 3HN7A 3MWEB 4BNFA 4FGWA 3VZRA 1EFLA 1N7HA 2C54A 2OOSA 2BFMA 2Y68A 5EQDA 2WD8A 3U4IA 3JV7A 3JYOA 4KQXA 1E6WA 3LT1A 4CMIB 4BNXA 1ONOA 1YL5A 4GH5A 2JD2A 4FC6A 4I9HA 2PZKA 3MOIA 5DBFA 2I3GA 1C1DA 1U3WA 2D3TA 4BNIA 3P19A 1K0UA 1TLTA 3CZMA 2BMAA 5LDGA 5KVCA 3QRWA 1PZHA 5K0ZA 1P1KA 3FD8A 1XIVA 2Q99A 2X0IA 4MVJG 3VH3A 1OFGA 4GMFA 4YT8A 5KJEA 4QSMA 1GAEO 2WD7B 4D0SA 3W8FA 3I9MA 1C1XA 3UCEA 3WGYA 3EVTA 2VZ0A 3MJTA 4AJIA 1CWUA 2PD4A 4ALJA 1UXGA 2WYVA 4FD3A 3K2BA 2Q1TA 4B3JA 3OH8A 4JJGA 2OP1A 1VSVA 4XIJA 3D3WA 3ANLA 4E5NA 2PZJA 3UHAA 5JO0A 3PYLA 1CIVA 3GZNA 5CPFA 1PGQA 4TRRA 5B37A 1E7MA 4K6FA 2GZ2A 3JQ8B 1EE9A 3I1JA 2GZ1A 2A94A 4BO7A 4DC0A 2H63A 4GQAA 1BDMA 5GZ6A 2Z1NA 1XU9A 2PZLA 2V6GA 1BW9B 4YAIA 3INRA 2NNLD 2Q50A 4OXYA 4WCFB 5L45A 4AJKA 1J5PA 1YRLA 3DBHA 4U6QA 1HDXA 4B3IA 4QUKA 1SBYA 4INAA 1T24A 3KB6A 4MOWA 1DPGA 1IPEA 5EL0A 3K92A 1GFSA 5CP8A 1ADCA 2YYYA 4M55A 5CDTA 1VJ1A 1HYHA 3ZZNA 3B70A 3PZBA 1AE1A 2HLPA 4UEJA 3ROPA 1DIGA 4BGEA 1B8PA 4JNKA 1KVTA 2OHXA 1BG6A 4XDYA 3UCXA 3JCZA 3ROMA 3ZWBA 5T73A 2R6JA 1YJ8A 1H0KA 4GWKA 2GUGA 3D0OA 5G0TA 3ZWAA 2YW9A 3D3WB 2VZ8A 4PZDA 4RVGA 5DBIA 3KRTA 1XHLA 1Q7GA 3OM9A 4PVCA 4JBHA 4RF4A 4B4OA 2NWQA 5IF3A 2DPGA 3NX4A 1O5IA 2O3UA 1PIWA 8LDHA 4XCVA 4JQCA 2DT5A 1ZZEA 1E1MA 1E77A 1U4OA 3H3FA 3RIHA 1KY4A 4S1VA 1GUYA 5F1KA 4WECA 3AY6A 3M1AA 4W9NA 2X5OA 3KEOA 2EKPA 3DZHA 3O4RA 4BOYA 2EF1A 2D5CA 1RJWA 4AJNA 2QIOA 1EEHA 3EAGA 3F1KA 3WGTA 2D4AA 1BHSA 1KEWA 1KBZA 2FPIA 2PH3A 4JGBA 1LJ8A 3GY0A 2G82A 3CTMA 2ZTMA 3HDQA 1HKUA 4ND5A 1LQTA 4RDIA 5DDIP 1ZK3A 4D3FA 1B8UA 1HSZA 3ZHBA 3A4VA 3AY3A 1UXJA 3D1LA 1FK8A 2VRCA 2DM6A 2VUUA 1HDRA 3CZRA 4FJ0A 3FPCA 1AUPA 1AHIA 2X0RA 3R3JA 3QP9A 3ZH2A 2D5AA 3RU9A 1B14A 1UP4A 2B4QA 1Y7TA 5JFOA 2B4RO 1ONPA 3H9JA 5A3VA 4D3SA 4TQGA 5CG2A 4WJZA 2PFGA 1U28A 4Q3BA 4XJTA 3ZV4A 1VI2A 5CEEA 2NQ8A 3HDJA 5B4TA 5A3JA 2DAPA 1DSSG 4AJ1A 1H6DA 1D1TA 1WMAA 3RJ9A 2BF7A 3JQ9A 4DIBA 1RM0A 3LQFA 4MVJD 3GZNB 3GEMA 1W6UA 3GG9A 3SC4A 4M54A 3ZW8A 1NP3A 4GX5A 3A9WA 3RFVA 1I0ZA 2FRDA 4B4VA 4YAKA 3OQBA 2I67A 1B3BA 3VTFA 1NVMB 3EC7A 2OMEA 1I2CA 3E5RA 4CM8A 3L0DA 2Q2QA 3L4BA 3H5RA 3FPLA 4TVBA 4BL5A 1KC3A 1I2BA 2HAEA 5C37A 3U9LA 2X58A 4NJOA 1V0JA 2EIHA 5HS4A 3GMDA 2O4CA 5H83A 3UXYA 4RZIA 5A03A 3MJEA 4YAJA 4J7CA 1KETA 4ESOA 5I9MA 4XRRA 3RQSA 4KOAA 1LTHR 4YEDA 2EJWA 4J4HA 3RC1A 2O23A 3AI1A 3RUEA 4CMEC 4ZN6A 2Y05A 3NGLA 4GVLA 5F5LA 3FWNA 3BZUA 4RPJA 3DFUA 3WGHA 2O2YA 5JCXA 3ADOA 1N7GA 2HMTA 5EQFA 2GDZA 1NAHA 4WE3A 1Q0LA 1EQ2A 3VTZA 3VZSA 4UUMA 4U5QA 4D3DA 4XA8A 2GASA 3KEQA 4CLRA 1J0XO 2SCUA 1F06A 2CD9A 4NMHA 5U4QA 2Q4EA 4NZ9A 4CMGA 5L7TA 1ZSVA 3OA2A 3D3EA 2GCGA 4GLLA 5FI5A 5THKA 4CM8B 1KVUA 2WYUA 1NFFA 4E4YA 4L4RA 1NXQA 4TRNA 3DXFA 4BO8A 1PJSA 3I6IA 4CM4A 1S6YA 2Z5LA 1E6UA 4FJ1A 5JNLA 3DAFA 3LLVA 4OOEA 2GO1A 3K31A 4BNYA 3L6EA 1PJBA 1H6BA 4BGVA 3W4KA 1M2WA 1HE5A 2PV7A 3VKUA 2V6FA 2YDYA 5CHEA 5HRUA 5DBGA 1X14A 5K9ZA 3PHGA 4MPDA 1MG0A 4NHEA 4NU5A 4EITA 4MVJH 2A4KA 2B35A 3BTVA 1ZBQA 2D0IA 3HSKA 3INGA 5BNTA 1NVGA 1IULA 2DKNA 2JAPA 2X6TA 1QYCA 2PWZA 2IXAA 2E4AA 3NT5A 4R51A 4O6VA 2WYWA 1C0KA 3GRKA 5JYDA 1ZNQO 1E5LA 1RWBA 3D5QA 3RUHA 1GQYA 2RH8A 1PZGA 3A14A 4ONEA 5G0UA 3TZHA 1C1XB 3WNQA 3AK4A 4J49A 4IZIA 1U7HA 1DDOA 3OA0A 2R00A 3ZDFA 1JVSA 4FPXA 5IFLA 3IUSA 4AICA 2VHXA 3FRJA 4ZQEA 2GPTA 3WTBA 1B3RA 4XIYA 2Z95A 3PGXA 4A0SA 1A7KA 4CODB 3DBLB 5F1PA 1NPTO 2W4QA 5JMWA 3NJ8A 1LLDA 1LRKA 2PGDA 3RCBA 1KVSA 2IRWA 5JYFA 4FFMA 5HBRA 2GNAA 1ADGA 1DOHA 2PZMA 4N5NA 1KEUA 3UVEA 1YBVA 4RF3A 3KXDA 5IG2A 5JE8A 3W6UA 2CY0A 3CE6A 3UAGA 4TROA 1PWXA 2WSBA 5HM8A 3WNVA 3TZQA 1NQOA 3GGPA 1M6HA 3BHJA 3LT2A 4BNWA 2QQ5A 4FB5A 5A5FA 1NASA 4IUYA 1ZJYA 2JL1A 2EP7A 1B15A 3WYEA 5L51A 3ZWNA 4OHUA 4R54A 1NBOA 5BSHA 3ROKA 1KVRA 1Y8QB 1Z75A 4MVJF 2AA3A 4DLBA 2UAGA 1IB6A 3ON5A 4IZHA 3C1AA 3PFFA 1PJ2A 1GZ3A 4PG6A 4YRAA 5B4VA 1IL0A 1HLPA 2NV6A 3OEWA 3PJFA 2PH5A 3ITDA 3PGJA 1O95A 3HG7A 2X9GA 2VRBA 4GSLA 1GL3A 3RI3A 2TMGA 4GVXA 1HDOA 3GFBA 3NYWA 1ENZA 2BRUA 2EXXA 1E0DA 1GEGA 3O26A 3RROA 1MP0A 4Y6RA 5ADHA 2ZCUA 2C7GA 1LSUA 1WDKA 1NR1A 1OMOA 3QWAA 1YL6A 2POQX 3NT2A 1ZSNA 2YFQA 3WJAA 3IJPA 5JY6A 1Z45A 1V35A 2G76A 1BSVA 1OC2A 5A02A 4IDBA 1O6ZA 3BMCA 5JXWA 2FR0A 1PJQA 1U7TA 1ZMTA 1XKQA 3HFGA 1FMCA 3WMXA 1Y5RA 4G65A 3D64A 3JYLA 4CMHA 1EK5A 1I3LA 1BXGB 4CR7A 4UUNA 4CM1A 4UVGA 3FSRA 4EW6A 1YO6A 3HADA 4OQZA 4X54A 1SB9A 2NU6A 2Q2WA 3DTTA 4J0FA 4Q39A 2Y99A 4I08A 5H82A 4RQUA 4DC1A 3FNHA 1T1SA 3TFOA 2FPPA 1GZ6A 4OXKA 3RBXA 3KLMX 5KVQA 2C2YA 2ZQZA 4JBGA 4WLVA 3RUIA 3EMKA 3F46A 4IJVA 3G1TA 2FZEA 1KEPA 1HRDA 1UUFA 4EYEA 3U3XA 3DONA 2HO5A 3IAHA 4ID9A 3WG9A 5CDSA 3BAZA 4ZD6A 2JHGA 3K30A 3PZRA 4YT5A 5T57A 4CM7A 2X9NA 4ILKA 4FS3A 2BLLA 1DRWA 3K96A 2P5UA 2DC1A 3AY7A 4YAGA 1FDSA 5U9CA 4F6LA 3CXRA 3GHHA 4DBVO 1MXFA 5KIAA 2NLOA 2GN8A 4YJHB 3LF2A 3T4EA 4GX1A 2IZZA 4RVFA 2I99A 1DLJA 2PTGA 1P44A 4Y9DA 1DHTA 3UFXA 1CQJA 1MV8A 2ZYGA 3L4SO 2NVWA 3GUCA 3S8MA 2EJVA 1BVUA 1RM4A 3WDSA 1HE3A 4IBOA 3KYCB 4KTVE 1FDUA 3OJLA 4B7CA 4MP3A 4XGKA 3WWZA 2IXBA 3JTMA 4FFRA 4CM6A 4DQXA 4UEKA 1F12A 3G3EA 1U1IA 1DAPA 3TDKA 1E5QA 5FWNA 2QHXA 1WDMA 4YJGB 3KLPX 4N54A 1R0SA 5L7YA 2BFAA 3GVXA 1HDZA 4BQRA 2CVZA 1FDTA 4TKLA 2W2LD 1TB4A 4CL3A 4DL9A 2W2KA 4L75A 3UH1A 3PHHA 3GRPA 1ULUA 1HYEA 4IDEA 4J3FA 3BIOA 3DMYA 4TZKA 2CDCA 1AXEA 1TI7A 2W98A 3V8BA 4M86A 3DZJA 3ETEA 1AXGA 1XLTA 3S2GA 5L4SA 1ZJZA 1NPDA 2JKVA 3PI7A 5G0SA 1MC4A 2P9GA 3QLJA 4BHTA 4GBJA 4R1SA 2FWMX 2AE2A 4ALNA 2BELA 3RC2A 3WX0A 4AJ2A 4MKXA 3IKVA 3WOHA 3Q9UA 4PLCA 3EGOA 4IY1A 4E2WA 4K6CA 1WZIA 1VSUA 4EEXA 2ZYDA 2PY6A 5B12A 3E9NA 3GMSA 1DXYA 4PLTA 2BFOA 4CV1A 1NFRA 1AN9A 5EPOA 2VHWA 2ZKLA 4KTTE 2Y0EA 3WB9A 2AQIA 1PR9A 3EK2A 2I6TA 4WCDA 5DF1A 5ICSA 3AFNA 1IYZA 1Y81A 1M67A 3PWZA 3F1LA 2VOJA 1XSEA 2PR2A 1QLJA 1E3LA 1LUAA 3OIGA 4J9UE 3T7CA 4IDFA 3AU8A 5DNAA 3RFXA 3I3OA 1UP7A 4TMFA 3Q2IA 2WE7A 1W0CA 4IM7A 4DQVA 2QYSA 4W82A 3KYDB 5J23A 3C85A 1GPJA 3EY4A 1AHHA 1SB8A 1K5HA 2ZATA 4M49A 1SEPA 4ALMA 2PD6A 4WK6A 1FXSA 4J7XA 3ZI0A 3IOYA 3H2ZA 1DFHA 1YS4A 2DPHA 1L7EA 3H5AA 3GEGA 4BKRA 1DHRA 3FTNA 1ENPA 3H7AA 2IZ0A 1SC6A 1X7HA 1R66A 3NUGA 5DP2A 3VKVA 3E48A 5CDUA 3TFQA 1ZVMA 4RVDA 1N8KA 4KUHA 1LRJA 4FOSA 1U5AA 2DBZA 4J91A 4J1QA 4II2A 4BO1A 1P0FA 2AG8A 1B2LA 5ICMA 4AL4A 3LC1O 4HP8A 1GV1A 4NPCA 3AUUA 3U49A 1GY8A 4WCFC 1T2AA 3DZGA 2X0JA 4OJNA 3BMNB 2OORA 3KHUA 4BS9A 3U4CA 2D8AA 4HFNA 4UUPA 4I9NA 4NU6A 4NBVA 1KOLA 3ZWPA 2G1UA 2GLXA 3NTOA 2Y67A 4FR5A 4R9SA 1E3EA 2BFPA 3WIEA 1HZZA 5EESA 3OEYA 4D46A 5G4KA 5CFZA 5L4NA 1QORA 4E5YA 4J6FA 2NTNA 1RPNA 1JQBA 3HHPA 1HDYA 1VPDA 2H9IA 2DTDA 3RU7A 2JCVA 2C29D 4B7UA 2DTXA 4EDFA 5TJ9A 2Y0DA 1JKIA 4Y6SA 3UOGA 4GKVA 4JROA 4CM9A 4QO8A 4EJ6A 4Z9XA 1KYQA 3BMCB 1N1EA 3Q2KA 5TF4A 5KKCA 2W2KB 1E1KA 1ISMA 3R1IA 3TQHA 4ZA2A 3WGQA 1E7QA 3GVCA 4FFLA 2RH4A 2GN4A 4MIOA 2QZ9A 2H1SA 3WIDA 5JDCA 4E5PA 4E30A 5LC1A 4BNVA 3CKYA 1E3SA 1XQ6A 3H2SA 2VHZA 5JSFA 5CG1A 4WLEA 2JCXA 3CINA 3NGXA 1MA0A 1UXKA 5DCWA 1T2CA 1EFKA 2HJRA 1JAXA 4FBGA 3HZZA 3IP3A 4NG5A 2P2SA 1C14A 5JDIA 4NFSA 5IAAA 1ZXBA 4CLXA 5DCUA 4FDAA 1IPFA 3PJEA 2HK8A 1SEVA 1H9BA 3HDYA 3BMOA 3FR8A 4B4UA 3SJ7A 1PQUA 3COSA 4DYVA 3C1TA 3NDIA 2D2IA 3SLGA 4RF2A 3JD2A 1J6UA 1LLCA 2Y93A 1Z82A 1EUCA 3PHLA 5A4DA 1DIHA 4PIVA 2OXIA 4RPHA 1YWGO 1R4NB 1NQTA 3NTQA 2J8ZA 4QXMA 4U6SA 1EK6A 4NH4A 4DUPA 1CJCA 2IYOA 4OKIA 4DA9A 1E3IA 2HMWA 2W90A 4WASA 4B8WA 1ZKMA 2B0JA 1YONA 4N18A 3JQAB 3QIVA 5THQA 4ND2A 2J3HA 2C20A 4RPLA 2NM0A 4ZRMA 1JU9A 1WMBA 4R1UA 2AEMA 1E1LA 4WOJA 1ML3A 4GPD1 3V1UA 5JAIA 1SOWA 1WW8A 3UN1A 2HSDA 5KVSA 3G49A 1NFQA 3O8QB 2BGKA 3NJ4A 5TT0A 3VDRA 4BMNA 4PLVA 4CJXA 1EBFA 1SOVA 1VJ0A 2BI7A 4CPDA 4BGIA 1NTOA 1R6DA 4C7JA 1YKFA 4YQZA 1H9AA 2CDBA 4LCJA 4NBUA 4B4WA 2BHLA 4H16A 1O89A 2VN8A 3SX2A 1PJ4A 3INTA 3W4IA 4LN1A 3NTRA 2O48X 4ZU3A 3WJ7A 3ZWVA 3ANMA 2VUSA 2B36A 4WLOA 1V6AA 1C0LA 1PJTA 1X1TA 3I4FA 5BNIA 5KVVA 1MFPA 1P33A 1DJQA 4TZTA 2IE0A 4O59O 3C7DB 3KV3O 3QVOA 4IS3A 4XKJA 3SXPA 3JQ8A 3ONFA 1R16A 3TJRA 7MDHA 1BGVA 4IPTA 3P2YA 4L9RA 4G81A 4WLUA 2GGSA 4MINA 1XGKA 4PVDA 1I30A 3HB5X 4PG5A 1ZH8A 3E5MA 1MFZA 1P1RA 2Y1FA 2IEDA 5JDIC 3DBRB 1Y5MA 1YGYA 4IJUA 1QXSA 1UH5A 2BH9A 3N7UA 4C4OA 4CMAA 4GLOA 5CEFA 1ZFNA 2E48A 3M6IA 2AQKA 2V65A 1C1DB 1I24A 2JD0A 3ONDA 1BMDA 1RYDA 1DRUA 4LW8A 5HTOA 5IZCA 1VJTA 5TX7A 3ABIA 3CIFA 2XPCA 3KVOA 3ZWCA 4L4SA 5AOVA 1D7OA 4YJGA 5ENVA 3TOZA 3OJ0A 2FHSA 1O8CA 4QEDA 2EGHA 2JFHA 1ZEMA 1P9LA 1CF2O 4U0JA 1DC6A 5L9AA 3EYWA 4XQEA 4YCAA 4YXFA 5LDHA 1G1AA 5HS6A 1UZNA 5ER6A 1WWKA 4PGFA 5I7EA 3ZU5A 4BNMA 4LSMA 4RORA 1LDYA 3LC7O 1ENYA 4LGVA 4J7UA 4RVUA 4BNZA 3GHYA 3GAFA 1I3KA 1EMDA 1T25A 2O2SA 5A9TA 2O7QA 2WMDA 5JAZA 4BNHA 4WNCA 1GPDG 1A7AA 3GUYA 4IMPA 4NBWA 5COAA 4GGPA 5L3ZA 4UVDA 3C3XA 3P2OA 4FC7A 1U3VA 3I23A 1UR5A 1XQ1A 3ONEA 4BO6A 4DTIA 4RO0A 4I5GA 4E5MA 1UXHA 1Y9EA 1JLLA 1FDWA 2NUAA 3I52A 3LU1A 4L73A 3V1YA 5ES3A 2Q1SA 4HNGA 4I8XA 1OC4A 3ZU3A 3AI3A 5G4KB 4K28A 2WDZA 4IS2A 2QYTA 1OOEA 1CERA 4KWHA 4AJLA 1PR3A 2X9VA 3DAPA 3TSCA 4BNLA 4PCVA 4E31A 4JP2A 4BO3A 5BR7A 3T7EA 2BGLA 4BQPA 4E21A 4ZGWA 1A9YA 1PSDA 1LSOA 2H5LA 1G6KA 2I5PO 1VL6A 1WAMA 4K26A 3VZQA 1TT5A 3LK7A 3W4JA 2AE1A 5C3MA 3QVXA 4ITUA 4W6ZA 2I66A 3WS7A 3I9NA 1PGJA 1IOLA 4YRDA 5F21A 2QZZA 3VAZA 2J3IA 3FR7A 3PHJA 3DBVO 1CQIA 1Q0QA 3C7AA 2HRBA 4XYGA 4RGBA 3RUCA 2EW2A 2DBRA 4N7RA 4O1MA 3OECA 4EEZA 1YOVA 3E9MA 1NYTA 5CPBA 5DULA 3NT4A 3ZGYA 2O3SA 3QV1A 4ROSA 3RJ5A 2HU2A 1LSJA 2QRKA 1I2ZA 2Q3EA 3I9KA 3GN2A 4KUEA 1KEVA 1MGOA 1YDWA 3QVWA 4W99A 2NVUB 4CQLB 1HLDA 2R2GA 4RJTA 1D4FA 3ZHXA 2E82A 4XDZA 1BXGA 4D44A 1RM5A 3QY9A 2FN7A 3STHA 4Q3EA 2YHIB 1ENOA 4J43A 4IDAA 1SO8A 4CM9D 1XEAA 4ZQHA 4MIEA 3IKTA 1U5CA 1PZEA 3KOUA 4L74A 1F8GA 3GR6A 1OAAA 3AOEA 5CDGA 1PTJA 1NNUA 3PHIA 1LRLA 3IUPA 3TWOA 1Q7CA 2VWGA 1ZCJA 1P74A 3I5MA 1T1RA 3FI9A 5IJZA 4EGFA 3WBFA 5FFFA 3ZV3A 2V6BA 4CMBA 1F14A 4CUKA 1ZK4A 3D5TA 1LDEA 4ZVVA 3M1LA 1JWBB 4WCFA 3GEDA 2JJYA 2Q4BA 2FZWA 5M6DA 3DBHB 4BNKA 1PU2A 1HWYA 3UUWA 1MUUA 1EDOA 5G4LA 2B5VA 1ZK2A 2JFGA 4P8RA 4OOFA 2WEKA 1K2WA 3NKLA 4KQWA 3E6AA 3GLQA 2R00C 3JQEA 1BW9A 3E9QA 1HZJA 4PRKA 1KVQA 4FSHA 5BT9A 1KS9A 1SCUA 1K3TA 4YACA 1LU9A 1QYDA 2B69A 1GEEA 3KYBA 5IDXA 2EW8A 2JAHA 3OFSA 3VOSA 5G0WA 4RV9A 2HMUA 3EDMA 4YBZA 4HFRA 4BKPA 4LMRA 1ZMOA 3VC7A 4R3WA 4JCOA 4OYRA 5GMOA 3PIDA 2VOEA 4DQUA 4YPOA 1TA4A 4QFDA 5JS6A 4I9UA 4CLOA 5TJHA 2ILTA 5I8WA 3JD4A 3KETA 4BKOA 3PIIA 5EINA 4I1IA 1E7YA 3GGOA 3OICA 2RCYA 1R37A 2HK7A 2UUOA 1OI7A 3GAZA 2IYPA 3IJRA 4DIOA 4G5HA 4IXWA 4O63O 4HADA 1QMGA 5G0VA 1N5DA 1DB3A 4MKZA 4WUVA 2J6IA 2WE8A 5J9GA 4QX6A 4L0QA 4CLEA 3QWHA 5IXSA 4A73A 1JAYA 4HWKA 4JIGA 4CR8A 2DUUA 4FFPA 2NTJA 1P1HA 5JYAA 4MP8A 4HY3A 4E6PA 4ND1A 3ZU4A 1MC5A 2J5QA 3GGGA 4E2YA 4MP6A 1X13A 3ZHYA 1I5RA 5TLSA 2YFHA 3H9GA 1JKFA 4TRJA 3Q1LA 4LRSB 4PN3A 4DLAA 5ITWA 1IHXA 4R9RA 3B1FA 5GZ3A 3CEAA 5A1TA 1A27A 2CF6A 3AI2A 4H7PA 4QO7A 1LLUA 2ZIZA 3Q9NA 2E37A 3U4HA 2J3KA 4D43A 3B1JA 4NJMB 5JC8A 4E12A 3WGZA 2G5CA 2QRLA 3JQBA 1Z7BA 3VPGA 3H65A 4FN4A 1T2FA 3MZ0A 1X0VA 2X0NA 1EVZA 4N5LA 4BMVA 4BKQA 1UXIA 3PLNA 4M87A 3S55A 1IZ0A 3BTUA 3JQFA 4J2OA 1E3JA 4A7PA 3Q0EA 2ZB7A 3ETDA 4E2XA 2C59A 2CNBA 4HKTA 3L9WA 4Z0HO 1VL0A 3ZCXA 1YJQA 2Y1OA 2CVOA 2Q22A 4R1TA 2AHRA 3OBBA 3AOEC 3QWIA 1WLYA 2X5KO 5HWSA 3G0OA 3GK3A 4DWVA 1PL6A 4J1SA 1YQDA 3PJDA 2NVBA 4JK3A 4Q3AA 4AJPA 4ND4A 1UDCA 4MVJP 1E6EA 4RDHA 4BO2A 4CM5A 1PWZA 4MKRA 2I9PA 3PWSA 1Z73A 1BVRA 1HEUA 2CFCA 3DHNA 4PLPA 1PJCA 4J1TA 2WJPA 1ZIDA 2OBNA 4BB6A 5A9SA 2ZB4A 1YQGA 2VT3A 2AEJA 2Y1EA 1I8TA 3WTCA 4IGEA 3AU9A 3GVPA 4DMMA 1H93A 5L4LA 4W9NC 3PRJA 5JPIA 3WGIA 4EUEA 3QW2A 4GWGA 1VM6A 1V3TA 1BDBA 1YBAA 1NPYA 4M1QA 4FW8A 1E1NA 1LNQA 3AUAA 3RUFA 4CLOB 3DZKA 1ISIA 2RHRA 2Q1WA 1QR6A 3SBOA 4FOOA 3G17A 3RFTA 2V7PA 3LVFO 4S3MA 5K6AA 1P77A 3WGGA 4R69A 4ALKA 1Y8QA 2UYYA 4P38A 4ZICA 3OMLA 3HNPA 1WPQA 3JD1A 4NBTA 4Y8VA 1DAOA 2EEZA 1VKOA 2I65A 4FCCA 3H9EO 3H9UA 8ADHA 7ADHA 3CUKA 4Z3KA 3U4DA 1ID1A 1T2EA 4G2NA 4AG3A 4F46A 2NADA 1LQUA 3EZLA 3QWFA 4DXHA 2YV3A 3DMTA 5G2OA 1ZUD1 4XD2A 2DQ4A 1NHWA 1W73A 1WDLA 3HE3A 3U5TA 4GGOA 3OJFA 1P1IA 2Q45A 4RQTA 4PLHA 3LC2O 2HMVA 1NVTA 1NQAO 1Q0HA 4ZJUA 5A05A 1KY5A 3KUXA 2VRCD 2YHIA 3OSUA 4NNJA 1F17A 2E6UX 3WFIA 3L6OO 4DMLA 2AQHA 3OIFA 2BGMA 5KKAA 4FIZA 1EDZA 2CSUA 3JQ6A 4MVJM 3F6YA 2VWHA 2X8LA 4YWJA 3V5NA 3SVTA 3FBTA 1ZXLA 2VNAA 2OUIA 1IHYA 2B4TO 4DLLA 4E5KA 2VYVD 4P22A 3ORFA 4XGIA 3TF5A 3DOCA 4OIMA 4Q3NA 1XR3A 4CR6A 4O0LA 4GX2A 4WGGA 2C2XA 3BMOB 3BMQA 1YOVB 2A9FA 5F1OA 3E82A 3KTDA 3U0BA 3JYNA 3DB2A 4R41A 1UDAA 2C5EA 3NDRA 3PQEA 2W2LA 1X15A 4N5MA 3DBLA 1GADO 3P5SA 3DHEA 4YDRA 2ZK7A 4HUJA 1QV6A 2DFVA 3PDJA 4YJDA 3W1VA 3AM3A 2Q46A 4XYEA 2J5RA 3F47A 3O38A 4XZ3A 5I7VA 2FPGA 2GN9A 3GOHA 4JX8A 1YB4A 5COBA 3FWZA 4IDGA 1U4SA 3WWYA 2DLDA 4QFCA 4F6CA 5L53A 5I9NA 3VVBA 4I5FA 5TT1A 3HQ4O 2Y1DA 2NACA 5JW6A 3C1OA 3QVTA 5C5IA 2DTEA 1J4AA 3CSDA 1CDOA 4YJHA 4E33A 4OM8A 1VRWA 3QE3A 1R0KA 4QTZA 3VPSA 4IDCA 3KSZO 1DFGA 1ORRA 2VCYA 4QQRA 3LT0A 2IODA 3DHYA 2F00A 1GYQA 3R0IA 4F3YA 1U8FO 2UVDA 4BNJA 4OO3A 1M6WA 4KZPA 3I9LA 1WVGA 3DZIA 1FJHA 4D0RA 1E7WA 2GYYA 3RC9A 3A1NA 1YE3A 1PZFA 5MGBA 3GDGA 3S2EA 5EJ2A 4FGSA 2VZ9A 3D7LA 2AEFA 2X23A 1QLHA 2FOIA 3GVIA 4J1NA 4IJKA 5ILOA 2B37A 1NM5A 1NR7A 4DPMA 3HWRA 4Z0TA 3LYLA 3GT0A 4LVCA 4BNGA 4Z6KA 3ICPA 4CMCA 3V2GA 4B79A 5KNLA 1EQUA 3S1LA 4TKMA 4YYZA 1DFIA 5GY7A 2WD7A 5L7WA 1PQPA 3F4LA 4LVUA 4Z3DA 4TVOA 4CUJA 4K9DA 2EERA 4YRBA 3ST7A 4XWYA 4LMPA 2XAAA 3EW7A 3DC2A 2ZTUA 1NHGA 3K2EA 4EJMA 3EHEA 4W7IA 1RM3A 1SPXA 3ZU2A 3GPIA 1EUDA 4MVJE 3DO5A 4E3ZA 2A92A 1I3MA 1UAGA 3BYZA 3QA9A 2BI8A 3UF0A 5IZ4A 4XB1A 3GDFA 1UAYA 4ZQBA 4CV0A 4JJFA 3DZBA 3NRCA 2VUTA 3BMNA 1C3VA 1DO8A 3X2EA 5CAEA 4U7WA 4KDFA 1M66A 2FR8A 2IDZA 1PL7A 2PGJA 3KO8A 1PS9A 1TT5B 2VTDA 4I5DA 4EJ0A 2ZTLA 4QT0A 2YHUA 4IMRA 2DVMA 4OSPA 2Y0CA 4Z9YA 4MVJA 2TMDA 4DBZA 2X5JO 5KTKA 3I6QA 1EVJA 2UDPA 4J4TA 1EBUA 1G0NA 3Q6IA 2HDHA 1GD1O 3TL2A 4AJOA 2YDXA 3B1KA 3MTGA 4PLGA 1HDGO 3MEQA 3PLRA 4R68A 3E1KA 2NQTA 2C82A 1I3NA 5T8KA 5JC1A 1GCOA 5L40A 1O9BA 3RVDA 4OQYA 3WSVA 2C5AA 3AUTA 1HF3A 1YB5A 5C7LO 3GNQA 4J90A 3VVCA 1SMKA 4BVAA 5T6BA 4TWRA 4CM4B 3HFSA 4LSWA 2NVUA 2O4UX 3QSGA 4KDEA 4Q3DA 1PEDA 1QSGA 4CMKA 5KWEA 3OQ6A 4E13A 5BQFA 2GSDA 5EMHA 3VH4A 3ANNA 1QV7A 5IN4A 4WOKA 3BA1A 5COQA 4EBFA 2OBYA 1Q1NA 4FQ8A 3B20A 1LXCA 1X7GA 3MWDB 3OP4A 4RLSA 3ZNOA 1GR0A 4RLHA 3NAQA 4UAGA 5KCZA 4CLDA 3LZ6A 4JBIA 1P1FA 1DJNA 1R12A 2E49A 4XQGA 3SJUA 1DIBA 3PTZA 4R16A 1PGOA 5ENDA 2FSSA 1ZEJA 4DPKA 3MJSA 1H6CA 1Z7EA 1WZEA 2UV8A 4OAQA 4BKUA 1DRVA 3FNFA 5KJ1A 1I33A 3DDNA 5AQ1A 2YQ5A 1WP4A 4PG4A 2O3JA 4XR4A 3JQGB 3WLEA 4PG8A 3VDQA 1JN0A 3OETA 3RBVA 1YDEA 4IIVA 3V2HA 2LDXA 2WWRA 5KOIA 3KBOA 1ZO8A 5ILGA 4PZCA 1R0LA 2Q49A 3JQFC 4NIMA 4L8VA 4OKNA 4CMEA 1U3UA 3R3SA 4GMGA 4PLFA 4PZEA 1R4MB 1NWCA 3MJVA 2CVQA 4Z0PA 5AYVA 5A9RA 4IIUA 1X1EA 4U0KA 1HDCA 2LDBA 1GYPA 3LT4A 5AXBA 5L95A 2GD1O 3H4VA 2X1HA 3GPDG 3ICCA 1JKJA 1F8FA 3AM5A 4HXYA 1XWFA 2QRJA 4IQGA 1N92A 4M89A 3B6ZA 3QHAA 1H2HA 4M8SA 4WLNA 1GYRA 5MDHA 4PLZA 3H6KA 4MJLA 1U2GA 3ZN2A 5IN5A 1ZSYA 2FSVA 4YQYA 1EE2A 1EUZA 3Q11A 2Q2VA 2XXBA 3FNGA 2DUWA 4EUHA 1NAIA 4XQCA 1HTBA 3C7CB 3VZPA 4BIIA 4ZRNA 2ZJ0A 3RBZA 3O8QA 3TL3A 1B7GO 5AVOA 4BNNA 5JDCC 4Q3CA 4CV3A 6LDHA 1VE9A 2NU8A 1K6IA 3K73O 1T26A 4DVJA 3NV9A 1GV0A 1P1JA 3IMFA 4MDHA 1LBEA 4WEQA 2C07A 1R4MA 1P3DA 2P4QA 4A5OA 4R4JA 4R1NA 2PA3A 5DCYA 4R5HA 3JYQA 1U8XX 4XEHA 3BMQB 1HXHA 1N2SA 4IXTA 3I4CA 1EVIA 3K5PA 3DWFA 4TSKA 4W4TA 1QYWA 4E2ZA 3WXBA 2YZ7A 4BO5A 2I76A 1N9GB 5DT9A 3ZWWA 1C0PA 3AUSA 3DAGA 1W8DA 1Y8RB 3ENKA 2ZB3A 2O3RA 1CYDA 3IC5A 2VTEA 3PP8A 4IINA 5I7SA 1PGNA 4PLYA 4R5MA 3KYCA 3UW3A 4GI2A 1T4BA 3S2IA 3PQDA 3JQDA 1IY8A 3WLFA 1WNTA 3ZWMA 1XU7A 3QWBA 3KM0A 1H5QA 2VWPA 4GAEA 3BTOA 1IUKA 1UDBA 4IQ0A 3NDJA 3DZFA 4W7HA 2DBVO 2YUTA 1B8VA 1NQ5A 4TRMA 5F5NA 1H2BA 1PJLA 2FR1A 1G0OA 1GQQA 1H6AA 3WGOA 1P31A 4MIYA 3GF4A 5DP1A 3CMMA 2RBEA 4YVFA 1JDJA 2UUPA 3JSAA 4UUOA 1XELA 3CH6A 3HJAA 4I5EA 5ITVA 1DC4A 2HK9A 1V8BA 3R6DA 4ZQFA 5TC4A 5IDWA 1V3VA 4NQZA 3V1TC 2HUNA 5T8KC 4EI2A 3PDUA 2VYNA 4E0BA 1A4UA 2ZYAA 4BNTA 3WMWA 3E8XA 4FFOA 3K8ZA 4OGWA 4UEOA 4D42A 3TPCA 4D45A 3N58A 1DEHA 5KJFA 3S2FA 2Q1UA 1QG6A 4OSOA 4CQMD 1QRRA 3SLKA 3U62A 3GVHA 5IDQA 2Y1GA 1VC2A 3O9ZA 4AJHA 3C24A 1Y6JA 3P7MA 1XYGA 1CRWG 4OL9A 3PEFA 2DU8A 4NK5A 2HJSA 1HE4A 2FP4A 3G1UA 1RKXA 4ND3A 4OH1A 4YAEA 5IDYA 4PG7A 3TN7A 4BUCA 2B83A 5DZSA 1ISHA 1HE2A 3VH1A 5IXYA 3WYBA 3MOGA 4WPGA 1YB1A 5FF9A 9LDBA 1T4DA 2XXJA 4NI5A 3L4BC 2O7SA 3GA0A 1BWSA 1B0AA 4GKBA 3F5QA 1FF9A 1B16A 4CM3A 5DOVA 2HCTA 3JD0A 3KSUA 3MCVA 4IJWA 1ARZA 2JCYA 2GR9A 5TS3A 3I9OA 1T2DA 1LDGA 3KSDO 1C0IA 3FBGA 3GG2A 3CPSA 1PX0A 4YT4A 4RVSA 2O50A 3ASUA 4UVIA 1Z74A 1OZAA 3RUAA 1CEQA 3JQAA 2EV9A 2OGUA 5KJ6A 2X7HA 2VNSA 2BKAA 3L9XA 4WLFA 1S7CA 1HL3A 3VPFA 3ZV6A 1MX3A 2A35A 1BRMA 1Q2XA 3L6DA 1ZK1A 4RPGA 5JMPA 3RSHA 5A9SB 3WICA 1EVYA 2Y1CA 2VWQA 3PPIA 4O5OA 3M2PA 1ISGA 2FY8A 4A03A 1HSOA 3GH3A 1Q7BA 2CUKA 2EKLA 3PQFA 5JLAA 2EP5A 3C8MA 3WR5A 3PYXA 5FEUA 5H81A 1K89A 1V3UA 2FMUA 4A2CA 2VQ3A 1RYEA 1JTVA 1LLQA 1ONNA 1QYVA 4GSKA 1MXHA 4HNHA 4WEOA 2RHCA 1UJMA 4CV2A 5B4UA 1LEHA 4J2HA 4UULA 4Y67A 3HUDA 3PWKA 3QJ5A 3WBBA 5TQVA 1YH3A 4C7KA 3LDHA 1DC3A 1LDBA 3LLSA 5JO9A 2IZ1A 1HYGA 2Y66A 2HRZA 3UICA 4JN6B 1LC3A 3Q3CA 4JLWA 4IGFA 2JD1A 3DL2A 3BHMA 5T64A 1DC5A 5LCXA 5I8ZA 4BMSA 3OQ1A 4P4LA 5AXAA 5B1YA 5I9LA 1Z6ZA 1A9ZA 3JD3A 4ZQGA 1AGNA 2P68A 1VLLA 3L07A 5AXCA 1E92A 1L7DA 3OJOA 2CDAA 4FFNA 4D41A 5JAQA 3ITKA 4ALLA 3UKOA 1GU7A 3T4XA 4BO9A 3AOGA 4KP7A 1ZW1A 5TGDA 3W8EA 3DFZA 2GERA 4UVHA 3NEPX 4R3NA 4CMIA 4DPLA 3TOXA 1YL7A 3KZVA 1PJ3A 5JCJD 2ET6A 1E7RA 1R4NA 2X22A 3ENNA 5C7OO 3ZW9A 1I32A 1M76A 3PXXA 1PL8A 3ASVA 4PLWA 4DREA 2HKIA 4DIFA 3DR3A 2ZQYA 3IL2A 3F9IA 1KIFA 3X2FA 2EWMA 1X0XA 5BSEA 4B8ZA 3CMCO 5A06A 4A26A 2ZCVA 4KUGA 2OL4A 4J9VA 4CLHA 1QKIA 2PKQP 1I36A 4Y6PA 1NX6A 4HBGA 3IDSA 2PD3A 4J0EA 2CZCA 1UP6A 2BD0A 3OF2A 3FN4A 3E03A 3RWBA 1V9LA 3OJEA 4BV8A 5JAMA 4XYMA 3F4BA 3TNLA 3RC7A 1JVBA 2QW8A 3GC6A 5F3RA 1D1SA 4WNIA 3WQQA 4NR0A 3M2TA 1XA0A 3RUDA 4D7AA 4XJSA 4Y98A 4YT2A 4ZHSA 4XYLA 2XOXA 3D4OA 3JQ7B 3AW9A 4AJ4A 9LDTA 1KERA 5C7IO 1LA2A 3VHRA 5BSGA 1ADFA 3IP1A 3BXXA 1A72A 1U2DA 4KMSA 1A4IA 2YJZA 4RL6A 4P4NA 1IZ9A 1X7DA 3RAJA 1GTMA 2D1YA 2OP0A 2PNFA 3DQPA 1YQXA 5GZ1A 5JYEA 1KC1A 1SZJG 4LCEA 5ER9A 4YB8A 1H94A 4HV4A 4XR9A 3ROQA 3ZV5A 2AW5A 1XDWA 2HMSA 4LK3A 3BTSA 2IEBA 1XCBA 1DBVO 3H8VA 1LDNA 1LDMA 1BXZA 2VHVA 3W6ZA 1P45A 3F5SA 4PRLA 4A10A 1TEHA 3D4NA 3WFJA 5CDYA 1IE3A 3ZWYA 4EUFA 3MTJA 4XRGA 3TZCA 4IQ8A 1ULSA 2QX7A 1SAYA 4QECA 4RVHA 3F3SA 3LSYA 3ZNPA 3FF4A 3FTPA 2RIRA 3H3JA 3IQDB 1GCUA 4XB2A 3JYPA 3K6JA 2P9CA 3L77A 4YTEA 4YR9A 1E7SA 1LC0A 1PGPA 4FJ2A 3TZ6A 1UZMA 2GRAA 3GFGA 1U9JA 2CMDA 1K6JA 2VHYA 3V2UA 3UCFA 1NWHA 2GN6A 1LI4A 1TVEA 3FNEA 2C7VA 3PVZA 1D3AA 4Z9FA 1JW9B 4J16A 5TRTA 3K9QO 4Q9NA 3EUWA 4NBRA 5FYDA 3SC6A 2NTVA 3DBRA 1W4ZA 3PYMA 3ZHZA 4BGUA 3RD5A 1Y8RA 3FHLA
chains in the Genus database with same CATH superfamily
4JJIA 1JA9A 1LX7A 4Z4EA 1UPCA 3HBLA 5AKZA 5FYQA 3UAVA 4FS8A 4ZHQA 1ZUHA 2C5SA 2MSLA 3JQAD 3RFFA 3ZK7A 5I45A 4P80A 3GNSA 3Q9SA 3UANA 1X6VA 2GLTA 3FRIA 3LV8A 3VAYA 2J1LA 2OZPA 1E4EB 5A5EA 4D3ZA 3GI1A 4QBTA 4CQMB 4KODA 1R2QA 2CLOB 4QA9A 4XDGA 2YZKA 1BGXT 2K7ZA 1FOEB 1RLOA 2V6MA 1E9VA 4X8MA 5IJ0B 3I5UA 3CUEF 2GILA 5U1PA 1V1MA 2EIXA 2YXBA 1VRVA 3H4TA 3WIOA 1DKRA 3GLKA 4F4HA 2OBBA 3ETGA 1MX5A 3CISA 2NXCA 4NEQA 4XFJA 3SKVA 4IMIB 4NMLA 4N0DA 4YJFA 5ALGA 2CMGA 4EHFA 4NDNE 1V25A 1O97D 1HV8A 3CIOA 3DF9A 2YOFA 4YA6A 3HDGA 2LTAA 4AIRA 1L1FA 1II9A 3GEHA 2VDRB 3QBVA 2IW3A 1Q77A 5K3AA 3IEPA 3F2VA 1KEZA 4EYSA 5IT4A 4Z7QB 4NJMA 1WMSA 1JHAA 1CNFA 1GPYA 2W2QA 4PHFA 5BOVA 3T3EA 4D5GA 2F4VB 2OILA 1ODLA 3A06A 4KPFC 4PPYA 5BNFA 4PNHA 3IDZA 4MCJA 4DEYA 3NIDB 1TF5A 1TT7A 4OQXA 1SBHA 4CWAA 3MFQA 1KWKA 3GP8A 3WOVA 5UKDA 3BWCA 1L7OA 3Q87B 4MPPA 2VYVA 3GNTA 4FYKA 2JI8A 3CLKA 3KEMA 2C3PA 2VQ6A 4N0EA 1ZGBA 1IB0A 3NYRA 3VC2A 1UPTA 4H3VA 3BHIA 3EXFB 4M99A 5JHGB 5FLYA 3WQRA 4GPIB 3ZNQA 4AJJA 2IUTA 5JQGB 1J0AA 3OCYA 4H1UA 4B3HA 2WJJA 2ID4A 5HCIA 1TC2A 1CFJA 4W5QA 1YF3A 2JF0A 4P31A 1BXKA 1EK2A 1V7CA 3KC2A 3QNMA 2JAUA 5EXEA 5H0IA 3SHWA 5IKMA 1IJKA 4AKIA 1M75A 1NOJA 1T9ZA 2BFFA 3NO4A 1YZTA 1D2NA 4NF2A 4E32A 4M21A 2ZI6A 1U3TA 4EZBA 4D79A 3UB2A 3UOAB 1G9TA 1FU8A 2WWHA 3LGSA 5CVDA 5JBIA 3KJQA 1N6NA 1XK7A 1EFRA 4ZVQA 3VR4H 5IMSA 4XQ9A 3GWGA 3ZY5A 3DOOA 1JJ7A 3GJ4A 1FS5A 1V26A 1AUVA 1ISJA 2CFOA 2NSDA 2O2GA 2YY7A 4LYJA 1QFMA 1N6RA 4IG4A 2IZOA 3RTBA 2OSVA 2BUCA 3MUFA 1E66A 1RQ7A 1Y3DE 2WZBA 4PNZA 5AVUA 2CDNA 2YV1A 1XMQB 4LRYA 1V39A 1QG4A 3DXXA 2CF5A 2ZZMA 2O2EA 1GAQA 3M8KA 4HDNB 5HKBA 4E03A 5DOZA 1QVVA 3A0RB 1BH6A 2DUJA 5BRJA 2IYTA 3GH1A 4F9GA 3QVVA 3W8DA 2HPVA 3WDKA 2QTVB 3MWEA 3CVYA 4RENA 2OYRA 1KMQA 4OQQA 2C7QA 1JEQB 1ADBA 1U7ZA 2GA9A 1M10A 1AY0A 3H1PA 1OH5A 2XTZA 2D3WA 4ME6A 3WDLA 1MB4A 4JBNA 5E1OA 3SQOA 3BBPA 1GZDA 4CKEB 2MYPA 4O89A 4QM6A 1QP7A 4H6PA 2JFWA 2KX7A 2Q9BA 5K3SA 1LX6A 3EZYA 1I2AA 1KDTA 1KI2A 1NUTA 2GRUA 4BO0A 3P0EA 1X1QA 2ZRAA 3CNBA 3IELA 3U09A 2QG4A 1YBMA 1E1QA 3AWDA 5IJWA 4XH9B 3QU5A 1NI3A 2FPNA 2X7XA 3GXOA 4TPKA 2A1IA 4L8LA 3ZCUA 2Q21A 3EQZA 1GPNA 3MS2A 4EVQA 3FCSB 3WGVA 1EZ4A 2O3TA 5J2TA 3CUUA 4ZYXA 4N3CA 3PGLA 4MQUA 2PGIA 3BQMB 2H6EA 4CLRB 1Q5PA 3PNBA 1OBFO 1A71A 2G77B 4AQDA 2C0QA 3ESBA 5M34A 4JJZA 4KBGA 1PQWA 5ELXA 3PNOA 3SHQA 1WD7A 3N7TA 2WF7A 1PK7A 2WTBA 3HDHA 2Q8NA 3TZKA 3CNHA 1L7QA 1L4BA 3R77A 1PG2A 3NBYC 1CW2B 2I7DA 2NU9A 3KEFA 4HH4A 1E3WA 2RAUA 4RZHA 1SY7A 4WD3A 3PFKA 3RTCA 2FWPA 3G88A 3V7FA 2EZ9A 1XZ8A 3VZRA 2LV8A 2O8DA 1F1JA 1EFLA 1UBRS 4JYCA 1P2DA 5AKHA 1W5TA 1VBKA 3KSAC 2BFMA 2AD1A 2WD8A 1GVHA 1YQUA 1RIIA 3U4IA 4OHFA 3JV7A 5KU7A 4DB2A 2H92A 2JGIA 3OZSA 4PYIA 4MW6A 1E6WA 5LLDA 3D7RA 3KR0A 4E7PA 4M98A 1E5DA 4G86A 1ONOA 4YY3B 2RKWA 1ES9A 1J8VA 4I9HA 3KX2A 1BCSB 4FHGA 3E61A 4PM4A 1VIVA 5MN6A 4HB3A 4BFZA 3R3ZA 2I3GA 1C7FA 1U3WA 2D3TA 2FEPA 1OIVA 1V16A 2QRNA 3P19A 4FMBB 4B3TB 9MHTA 3IKMB 3CZMA 4HH0A 4C01A 4X41A 3BJZA 1KHHA 3H8WA 2YZGA 3QRWA 4X61A 4B6GA 5K0ZA 1FFSA 3H75A 2GPYA 3N2NA 1XMOB 2BTQB 1JZTA 1VLZA 1C29B 1V11A 2WD7B 1SUFA 3DEFA 1N3BA 3O84A 5BMVA 5BNWA 3I9MA 2WG0A 4NX2A 1UWLA 1V5EA 1UCFA 1WTAA 2GD6A 3EVTA 4MPJA 3UCEA 2XYRA 3TG2A 3G8AA 5IC4A 2VZ0A 1KFEB 3AESA 4RMHA 3FOCA 1QQBA 2IPLA 4L6AA 2ONJA 5FWYB 4AWBA 4B3JA 4QVIA 3A6KA 4QRDA 3D3WA 2VNKA 4Z49A 2BZSA 4HD8A 4YPFA 3WC4A 3GUUA 3UK2A 1AUXA 3TNJA 1VCOA 3FUCA 5A4IS 4Y2HA 4FDMA 1DV1A 1LI7A 2R86A 1PGQA 3G82C 3FMVA 4TRRA 1E7MA 3I4LA 4X92A 5B37A 2QVLA 1MAWA 4AMGA 5FAXA 1GRCA 3Q10A 4EA8A 3AHDA 3IDOA 2C8VA 4RSGA 1QYIA 1VLMA 2O6HA 3FWYA 4OLHA 5EZSA 2W93A 4KPUB 4DW8A 2YXLA 2C1ZA 3GJRA 4RKRA 4YAIA 4YC7A 5TPZA 3DTVB 4TSFA 4HB2A 3RSQA 3X0DA 3MT8A 4WL0A 2XKAA 4N49A 4XLLA 1WU7A 2XNDD 3DBHA 1BS9A 1Z9BA 3A2KA 1SBYA 5M5BA 2WIKA 3NHMA 3I34X 4MOWA 3CS3A 4LWOA 2ECOA 5F7JA 3DUFA 2IJGX 3EQ2A 3IWBB 2ORYA 3GFOA 3K92A 5THXA 1Q0SA 3WGUA 1QP0A 2ZSBA 5CP8A 1TUGA 4RLFA 5IT0A 1JQKA 2OY0A 1QHNA 1HYHA 3ZZNA 1RVDA 4F06A 3ZLJA 1YZVA 3FZGA 3OFKA 3V1NA 1AC5A 4ZI7A 3QXCA 4KK4A 3RYIB 5HFAA 5AOAA 4QTXA 2OHXA 2IPNA 1BG6A 3WWCA 2V0NA 3ROMA 3ZWBA 5CITA 2HLDD 3IP9A 5BW5A 1YJ8A 1UBSB 1KZ4A 2C84A 2XOKA 2VZ8A 1ZD3A 3H1GA 3IKLA 1E2LA 2PYDA 3V4VB 1Q7GA 3I42A 3OM9A 4PVCA 4RF4A 5TF0A 4MRAA 4B4OA 1WF3A 2CFTA 2CVFA 2NWQA 3NPAA 4ZYTA 2OK8A 1Y42X 3P9SA 5ALEA 3GEEA 3RRYA 2R96A 2OBFA 4BE7B 1NIPA 1Q84A 2VF7A 2VZLA 1H4SA 3NX4A 1O5IA 1A96A 1PIWA 4TTPA 3W1WA 2O8CB 4KWEA 1U7WA 3H04A 2IQ5A 2R7AA 1BE8A 3H4MA 1J5XA 4X45A 3SAJA 2WY2D 2XCUA 4UFNA 3ZS8A 4JD5A 3E3LA 1A4RA 4RXTA 1WLSA 3ZDAA 1QUFA 5ED0A 3LS2A 4DIEA 2HX1A 4RGQA 3EZ9A 4WECA 3AY6A 1FTYA 2P9HA 2QM8A 3M1AA 4JYPA 3PI6A 4WZAA 4GRAA 2VTBA 3H5IA 3HYRA 3FTQA 4WNAA 4EKYA 1ZW6A 2ZIXA 3OPYI 4MO9A 4AW9A 1ESNA 2WP8J 4HVCA 3I8XA 1NF8A 3N8IA 3G0CA 1XN4A 1G7RA 1VECA 4JR0A 5ERYA 1BHQ1 1BHSA 5TR9A 5HYVA 1L9KA 1KBZA 4O4LF 1S2GA 3K1JA 2Q9UA 2AR9A 1ODFA 3BZWA 1LJ8A 2I8AA 1K98A 3ECSA 2G82A 5C8YB 2ERYA 4HQ0A 5LZ7A 1N75A 3ESYA 5JVDF 3Q3HA 4UBOA 2FFBA 4DZZA 1LPAB 1AQ6A 1EB9A 2NZJA 2YC2C 4FI3C 1P75A 1B8UA 3WY9A 1P5JA 2Y2VA 4XEUA 1HOTA 1UXJA 3E4CA 2DM6A 3K70B 3FPCA 2AFHE 4RKWA 4EABA 2BI4A 2LD4A 3WIBA 2BH2A 4RHCA 1B00A 3L0SA 3ZH2A 2E87A 1UP4A 3A2LA 3MCZA 1Y7TA 3QM1A 3A6HA 5JFOA 2HYIC 4MLDA 5CG2A 2R8XA 4WJZA 3O0DA 1IZ8A 1OKKD 1AXRA 1IHPA 1VYTA 4FWIB 3HCEA 1Z2DA 3G2PA 1QTNA 4LXYA 3ND9A 4XJTA 2EL7A 4RFVA 5CEEA 2NQ8A 3HDJA 2P4SA 3ND7A 5C0OE 5C4MA 5A3JA 3G8DA 3EX7C 1WMAA 2FEOA 4G4SO 4PPGA 1EAMA 4QYSA 3MGKA 5EGSA 3RJ9A 1AV6A 1CFZA 3LQFA 5LLSA 3Q5EA 1SRRA 4MVJD 3FUVA 3T7SA 4X85A 5HHTA 4LF5B 3ETJA 3H42B 1ZVQA 3KQYA 1YS2X 4P5PA 5GONB 5IMBA 4I1YA 4PX5A 3RFVA 4C21A 3FYDA 3DEJA 1B6TA 3RS9A 5B1DA 3Q8KA 2R5FA 1VJGA 3QVKA 2O0HA 4QYMA 4YDSA 3EC7A 2OMEA 1I2CA 4QUDA 4CM8A 3L0DA 1Z47A 3L4BA 2XV1A 3H5RA 2CLKB 2OD9A 3I2YX 4BL5A 4QIHA 3KTFA 4QOSA 4Y1RA 4MWBA 3K1ZA 2QZSA 2HAEA 2JIQA 3L8GA 3TLZA 1FSPA 1U99A 5E9AA 2VH2A 2YY6A 1MJNA 2ZS9A 4PYMA 2XMDA 2EIHA 4HL6A 5AI9A 4F6RA 5GINE 5ARDA 3VHXA 2PANA 1EM8A 1QVZA 5A03A 3LRTA 1UZUA 4HAIA 1YGPA 3VUEA 4ESOA 5CA0F 4DR5B 4XRRA 1ZESA 4KOAA 1LTHR 5CNIA 4J4HA 4EHBA 3RK1A 1SKAA 4TLBA 3EG9B 3ZGVA 1BFDA 3OG9A 4I3FA 3AI1A 1F7VA 4G4IA 4UCFA 5KZMB 2IXEA 2HDWA 4GVLA 4N5HX 4EKIA 4NU8X 5JPCA 1FU4A 2SKDA 1E2GA 3DFUA 4KKXB 4M88A 3TXXA 5GIOE 2J7KA 3ADOA 1VPVA 4QHTA 9ABPA 1M5TA 1NAHA 3DVRX 1N2JA 1EQ2A 4C0WA 5CD1A 4YUAA 2I7CA 2D2FA 4U5QA 2ZSIA 4D3DA 4IHJF 2GASA 3E7DA 4UHKA 3JASB 3EF1A 1J0XO 2SCUA 3BIFA 3COWA 4ZO9A 3SYLA 3KXPA 2I55A 2ZIVB 4BAUA 5U4QA 1NF2A 2ZUWA 1EIWA 4NZ9A 1USVA 1MIOB 4DWJA 3OA2A 2J6HA 2G4LA 2GCGA 3B7GA 1JAZA 4CM8B 5KTOA 3SYKA 1QG0A 2WYUA 3HLTA 4NPHA 1E2FA 1CBUA 3OLYA 4P3KA 2ZLBA 5HQ3A 3HNOA 1XZJA 3I6IA 3QG5A 1XD8A 4FJ1A 1E6UA 1CC1S 4N65A 3U4QA 2QN9A 4WNYA 2I4RA 3L79A 3EXG2 3LL4A 4R71A 1XMVA 2IFTA 2FA9A 2NU7B 3D9QX 1PJBA 1U8TA 4D3XA 4F4JA 2H2DA 3K5IA 3T5TA 4MUFA 4OHVA 2C4KA 1KH2A 1V9CA 4BGVA 1M2WA 2EBHX 4MRPA 4N48A 3VKUA 2Z8XA 1AQYA 1XAGA 1X9HA 5L3QB 3GLFB 3GARA 5B36A 4Q16A 3M1IA 3COVA 3EGCA 1X14A 1E0SA 2IYAA 4HN9A 3FUXA 1MO2A 4MPDA 1MG0A 3AVUA 2ZYWX 4EIWA 2OECA 5FR1A 4N9QA 4IFIA 3HA7A 3D8TA 5C5EA 2B35A 2X6QA 3BTVA 1XMPA 1O6FA 3EXHA 3HSKA 5WRFA 4AY6A 2BHNA 3RAPR 1AHPA 3PD7A 1QYCA 4NMWA 1W36D 5EIXA 4OQPA 1K5DA 2IXAA 1VFNA 4QU8A 3WAJA 5A5GA 4O6VA 4A92A 4W5NA 4IFBA 3OJWA 4OQMA 5JYDA 1ZNQO 4UXIA 1RWBA 3D5QA 4UU1A 1TM1E 1KSJA 5G0UA 3TZHA 2XKBA 4DUYB 3H2HA 3KR9A 4A6DA 4J49A 2PMBA 1U7HA 221PA 1V95A 2QLTA 4G8DA 4GOOD 2RKBA 1HYQA 3CQ9A 2CYAA 3DZ3B 4IWXA 4RM3A 1VE1A 4AICA 3LO8A 2QSZA 3LWDA 3FRJA 3I01M 3Q8MA 3EJWA 3W5DA 1E99A 3L8DA 1G9XA 5H3CA 1E5XA 1FXUA 2ANBA 2HBQA 3QJGA 4L8FA 5EQJB 4CEIB 1H3EA 3CRRA 2W4QA 3UUEA 1PL0A 2BFNA 5K8CA 2O20A 3CPJB 2AX3A 3NC1C 1SCKA 5EWMB 5B6JA 2XDAA 1N3IA 5EXXA 1KVSA 1RIFA 2RHWA 2R8OA 4ZJZA 3ZTYA 5HBRA 1G2IA 1ADYA 1WE2A 2PZMA 1DOHA 2QF7A 4J0IA 5G1NA 2RHGB 3W8RA 5C9ZA 1P60A 1T5SA 1EG7A 1FX1A 1O95D 1VLVA 1L8QA 1PV2A 2CV1A 1PWXA 2WSBA 4TS1A 4QEZA 3WNVA 5HM8A 3EIXA 4RTQA 3D2LA 4DV3B 3LT2A 4BNWA 3UXEA 1TQ4A 1RXUA 1U02A 2JLZA 4IUYA 4LXTA 1EX1A 1GRNA 4B7AA 3WB0A 4GOXA 1B15A 3ZE7A 5L51A 4MKGA 4KR7A 4R54A 4TX1A 4LZNA 3N2LA 3SNKA 5EEHA 1KVRA 1OI2A 2IYNA 3GP3A 4AWXA 5HRCA 3LBIA 4BFUA 3MWKA 5JTUA 3NAGA 1U9IC 2FN8A 1V8OA 2FG7C 4WZ6A 1CJSA 4PG6A 2HYDA 4LYEA 4P83A 1U28C 5CT9A 3FFBA 3PJFA 4YRAA 5B4VA 2C99A 5EP3A 4B3CA 5DU2A 1E1QD 1O95A 3BSWA 5BV0A 4IIXA 1HR0B 1GL3A 3RI3A 2F43B 1E2IA 1I4OA 4LGMA 2RJ3A 4NECA 2EXXA 4KQGA 3EEYA 1GEGA 3TLMA 2WIFA 3KJZA 2J0UA 3D7SA 3RROA 4NG4A 2X7JA 4Y6RA 4HEA6 3OJCA 3A6PC 1JIQA 4J0GA 2C7GA 4F84A 2QMUA 2IYSA 2WUVA 2FW8A 4JJKA 2PXHA 1G4HA 2C2ZA 4U2KA 2YFQA 4RACA 3RFCA 4UE2A 5KPJA 3WMRA 5JSHA 1GUBA 1O9HA 3SN6A 1UBKS 4PCLA 5F9HA 4BWGA 1SG6A 1NVXQ 1TYDE 3M3PA 3MWGA 5AKKA 5IF9A 1UXOA 1U2ZA 3V1LA 5JXWA 1T6NA 2XQVA 5LMZA 3QENA 5FWDA 4BP1A 1TVCA 1I0IA 1QR2A 3D1JA 4DMFA 4KXUA 3JWGA 1XKQA 4BZXA 1NJ6A 3T0GA 1GPBA 3HFGA 4KLNA 4RE6A 3WMXA 4HZUB 1QIIA 2JLYA 4EUSA 2BGRA 1QWSA 4FX5A 1EK5A 1I3LA 2G09A 5DLEA 4UUNA 4DADA 2IHKA 5EE9A 1NP6A 5E7JA 4R1PA 3EMDA 5HILA 1YO6A 1LFAA 1M8JA 2RD2A 3HADA 1B8OA 4OQZA 1XU4A 5B3LA 1NGSA 1SKYE 2OAQ1 3A9RA 2R97A 1X86B 3DTTA 1IUNA 5B7GA 1O87A 1C8BA 4I08A 3ZIAD 2BFEB 4DC1A 5BN3B 2QR3A 3EUAA 4KQKA 5B3AA 2EU8A 2ETVA 1Q1AA 3KXKA 1T3GA 4QJBA 2FPPA 4ENUA 1GZ6A 2QJWA 1GGJA 3KLMX 2C2YA 2LKDA 3QI2A 3SDZA 1G3RA 5JUWA 2C8KA 1CF9A 1KI7A 1ZGGA 3IA7A 3R4VA 1NW9B 4IJVA 1OTHA 3G1TA 5DX8A 4L08A 4A5SA 2XHZA 1EFRD 4UU8A 5JNUA 4GI3A 4FKZA 1PCXA 4RZSA 5JZSA 1Q1EA 1T5LA 1XK6A 2V1XA 1X70A 2OGTA 3CWZA 4QFMA 4RMJA 2I62A 4UM5A 4TMYA 2UZ4A 5GADl 4ZVTA 4Z2AA 4DWWA 5H1YA 3E1GA 4ZD6A 1JBQA 3KZNA 2EFCB 2X9NA 5E2BA 4ILKA 4QSHA 5ADWA 3QKRB 1S3FA 5IUKC 3CUYA 2INGX 4FS3A 2BLLA 1DRWA 5CA0A 3UJ7A 3T1HB 1C3LA 2WWTA 1H2XA 3KQVA 3O5AA 5F78A 3GA7A 3GWZA 4EF4A 3DEAA 4Z4FA 3VQTA 1PT5A 4F6LA 4KR3A 4FOPA 1MXFA 3O47A 2GN8A 5HJEA 3QEKA 2JVIA 2JGMA 1M3SA 2BR4A 5IANA 2QTCA 2WWXA 3THWA 3AP2A 2PQ6A 1J8DA 1UBCA 2PTGA 1YJAA 3W3AD 1P44A 4RIEA 4BDTA 4DT1A 4Y9DA 4GXRA 3OIUA 3TFWA 1L4GA 3CEJA 1IXSB 1YDHA 1P7VA 4I2VA 4XB6B 1TOAA 4Y9UA 3IB6A 4Y2YA 4LQLA 3GUCA 1P9WA 4RKYA 2XW6A 1KRWA 3HJGA 3P9QA 4GMDA 1X7YB 2EJVA 2FCAA 2JBHA 4JSTA 4OEHA 1THMA 1XFDA 4TXMA 4QTYA 2WLTA 3WDSA 4A2QA 5JADA 2TRSB 3VR0A 1QNLA 4IBOA 1NATA 4KTVE 4QATA 5FBQB 1DOAA 4K0RA 4U2CA 121PA 4DY4A 2YMQA 3ZX5A 1F12A 4NV0A 2C7BA 4IJ5A 3G3EA 4O29A 1NF9A 2LR0A 1XTTA 1NLYA 3W90A 3TDKA 5JCOC 2IHJA 1E5QA 4O2LA 2QHXA 3JAWA 3EEOA 4YJGB 3KQWA 1PHRA 4RETA 3VX3A 1YZHA 3GVXA 1HDZA 5BV7A 3LYHA 4GR9A 1AGRA 2CMFA 2CVZA 4TKLA 3PTLA 2W2LD 1I1HA 3BERA 4XTCS 5C18A 2VAVA 4JC5A 1HYEA 4IDEA 4B7ZA 3BIOA 1AXEA 1TI7A 3HJNA 4DCJA 8AT1A 3T34A 3ETEA 3ERCA 1FFWA 2FFAA 3BD9A 1ZJZA 3KKEA 3ZR4B 5JMOA 1SCUB 1PSWA 4HDRA 1MC4A 4B47A 2NO4A 2FWMX 3LLUA 3AJEA 3IBGA 1U3GA 3VO1A 2QM3A 2G72A 5JVDA 3EJ6A 2VA9A 1I3CA 4IY1A 1RAIA 1UJ5A 3OQJA 4M46A 1WZIA 4JVLA 1VSUA 4EEXA 3T5MA 3O8LA 5B12A 1L7RA 2BE7A 5C5DA 1X3SA 1SCIA 2HV8A 4BMPB 1NFRA 2V7WA 2P8JA 3DKKA 3PC4A 3THYA 1AN9A 5EPOA 1H2WA 2VHWA 2ZKLA 1VL1A 1FRFS 3KE9A 3T3MB 3V4RA 2AQIA 1A88A 1B0PA 2WSSD 4JXXA 5CRIA 1AGPA 4NY1A 5JS2A 4JHXA 4KGDA 3KT0A 1GFWA 3F1LA 3V7NA 5K09A 1XSEA 1MT3A 4QXRA 5GWXA 3VKGA 3Q3GE 3IPXA 3TCXB 1LUAA 3SIPA 3WA6A 2XKKA 4HUQB 1ZD9A 3P96A 2HQSA 4JJ7A 4QNRA 3LL7A 3RFXA 1IMJA 1SBZA 4P3PA 2WABA 2DQKA 3HJHA 4AECA 4X91A 1BE6A 4X8OA 3WKCA 3DAYA 1WXEA 1H9CA 5F64A 4NRDA 5K51A 5J59A 4TKUA 5KNBA 4Y1EA 5DBOA 2QB5A 4U39A 1N2HA 1JJVA 1QB8A 4J16C 5ALYA 4ALMA 3U1VA 4J7XA 4F5EA 3OFVA 3BGSA 2FLKA 5ALJA 4NSNA 2IOHA 4JI8B 4JVOA 2YX1A 3GEGA 3PL1A 4L7QA 3MT0A 3R75A 2QE6A 2BGNA 2GYWA 2H06A 3MPUA 4CTMA 1DHRA 3H7AA 4U2BA 3AR6A 4BMXA 5DK6A 3NBFA 1F20A 1EGQA 3EODA 4RESA 4MV5A 5DP2A 3RF7A 4HNVA 1ZVMA 5CDUA 4RVDA 3ZV7A 1N8KA 3QBJA 4EJSA 4BO1A 4FOSA 4II2A 4CCYA 2FW1A 2JIOA 2RGXA 5DFAA 3ZK9A 3AVOA 4UU0A 1SCAA 5JI3E 3O1JC 2RBGA 3LC1O 3K8YA 4LY6A 4EARA 5CB6A 5JXHA 3H6GA 4DMKA 4EW1A 1UWKA 4M1WA 1VJRA 2WZDA 1RU3A 2X0JA 3EAQA 2RGYA 3NEAA 3MXTA 3PC2A 5A5DA 2AJ8A 4HFNA 2R6AA 3ZWPA 3WLPA 4DZTA 2O0JA 1L4FA 2JGDB 2RHLA 2RJNA 2Y67A 4GO1A 1PLLA 1DVRA 1GWNA 2CZGA 4HZIA 5EESA 1KJ8A 3OEYA 3ZVRA 4D46A 2F90A 3TNFA 3VV3A 1RXSA 4E5YA 4J6FA 3GJTA 2FFJA 4YRLA 2VXOA 4W7SA 3ZI4A 3T61A 3EPRA 3ZZUA 3I6MA 1JQBA 1UBOS 1M1NA 1GKKA 2HF7A 3HHPA 4IGKA 1HDYA 2ILVA 5CT4A 1VPDA 5DVZA 2ACVA 2I22A 3BXHA 4TTAA 2JCVA 4B7UA 3CB4A 2DTXA 3HH8A 3Q7EA 1BEUB 4HQFA 3UOGA 1XEWX 4JROA 3UGQA 2B9EA 4KE7A 1KYQA 4XWGA 4Z9XA 4O1IA 5CM8B 5EKTA 1N1EA 1RRKA 5TF4A 5KKCA 2W2KB 3CR7A 2YIDA 5TQ0B 3ZEIA 2RGRA 1EUCB 3GVCA 3LY8A 4FFLA 1A76A 4MIOA 2X4DA 1NW8A 3GL9A 1Y0BA 5CR9A 2EL9A 2CXSA 1P3Y1 1FJ2A 4RAQA 5A6VA 1J1UA 1SC4A 4D74A 3U6KA 1FRNA 1ETUA 1STOA 2CLIB 3IBCA 3MW8A 4HQOA 4Y7DA 1BAPA 1XQ6A 3MUOA 3LWBA 1XI2A 5F2KA 5SZHB 5BSFA 4EO9A 1YB2A 5B2FA 5JSFA 4ZU1X 4RWZA 3DV9A 3PUIA 5FUBA 3D3JA 2JCXA 3M70A 4KQ9A 2R1VB 4X24A 3EP4B 2R25B 4FQ5A 1F1BA 1FNMA 1UXKA 5LU8A 2VDMB 3JZFA 4K7JA 1ZRHA 2IOFK 4N8EA 4NG5A 5HXAA 1BQ3A 4NFSA 2FPUA 3BIXA 1YMQA 4QDJA 5IAAA 1XC7A 1D0SA 3E8SA 4AUKA 3G85A 3H3XA 1IPFA 3IOMA 4B6EA 1L3IA 4NYMR 4O2RA 1SEVA 3VPDA 4L0DA 2G1KA 4ZZIA 3BRSA 5EG5A 5KTMA 1IDN1 2H7CA 4NL4H 1IBSA 1WQ4A 3FYTA 4GDFA 2CLMB 3NDIA 2YYAA 3HCAA 3L4EA 2H0RA 3O91A 3JD2A 3OE7A 1M6VA 3HCRA 1LLCA 5ICFA 5H9WA 1EUCA 2QIPA 2CJFA 2EVWX 3F98A 4PINA 1DIHA 1E62A 3IT3A 1V8FA 4X90A 1YWGO 1R4NB 3NTQA 4G63A 2QUZA 4JLPA 4QXMA 2LCFA 1GUDA 4BQEA 3W34A 3RAFC 5IS2A 1UEIA 2BL4A 4CIXA 1ZJ5A 3EP5B 1V7ZA 1YT5A 3ESXA 3QU2A 2E4ZA 2WUFA 1QV9A 4QGFA 2IYOA 2O7VA 3V00A 2OZLB 3H83A 1E3IA 2F3QA 3QYPA 4WASA 5EJFA 1ZKMA 3PC8C 1WVIA 3T9FA 2I6QA 3VTAA 2VDQB 4D9FA 3K0FB 4MWZA 1SHTX 1SVIA 3C3AA 2JFYA 3S2SA 1FP2A 2BMWA 4WI1A 2HQBA 4JR2A 3T9CA 5IH7A 5TQ2B 3TQOA 5JYCA 3FOAA 3QLTA 1ML3A 1AN0A 1JLMA 1L2TA 4GPD1 2J07A 3GELA 4CDNA 5JAIA 4M83A 3V4PB 3KXIA 4MWSA 3K9FC 2V5UA 4ACAA 5K20A 5KVSA 1XTPA 3C43A 3O8QB 4R40A 3C5CA 4Y0VA 2JATA 3NJ4A 2P6MA 2Q6VA 4XIFA 2WJ3A 4O5AA 4CJXA 1EBFA 5TEVA 3NH6A 1UMCB 4CPDA 1NTOA 2GEFA 2PX0A 4CNQA 3OTIA 2WMOB 3M4ZA 2BWJA 2PO7A 2FG5A 3G9ZA 4EO4A 1PJ4A 2J0VA 1F8XA 2AJTA 1OZGA 3SR4A 3AQ4A 1N3YA 4JFAA 4LN1A 4NYJQ 1U8YA 1NDHA 4NXMB 4ZU3A 4PAQA 1GG9A 2VUSA 4ROTA 2B36A 3GLIA 1MDFA 3NZEA 3DZ5B 4B75A 5JV5A 2IPOA 1X1TA 3I4FA 1GN9A 3F7TA 2ZJ4A 4TZ6A 1AKTA 1QHXA 2WFAA 1XRMA 3H2JA 3TE7A 2P6NA 4RBNA 4O59O 2BP7A 1GA6A 1P73A 1ZRNA 2D74A 1YC5A 2HJGA 1XEWY 3OZWA 4MR7B 4N40A 4MW2A 3G7UA 4XCXA 4YROA 5CIYA 3WE7A 2FDRA 1RYYA 3KKZA 4KV9A 1GXSB 4OG2A 4ERNA 1BGVA 5ADUS 1I7LA 1NIJA 2XJ4A 4G81A 4BCBA 5ES4B 4MRVA 5I6DA 4D1YA 2QLNA 5DNYB 2E5FA 1KU6A 4PVDA 1VLHA 5E7MA 4X7RA 4IH4A 2B2XA 1SVNA 4BYGA 4F72A 3EPJA 4PONA 4UHFA 5A1JA 1Q19A 4F2WA 1M8FA 3AVPA 1XDDA 3GQBA 4ZFNA 2BTEA 1YU9A 2QYOA 4C4OA 4F3RA 1Q7EA 1V8DA 4GLOA 4Q21A 4R1MA 5IJAA 3SM3A 1N57A 4Q1FA 1KZ7B 5AKEA 1DMRA 3LQ2A 2FHPA 3ANSA 5LUBA 3RVBA 2PUHA 2KWIA 1K06A 1I24A 4Z51A 4H0NA 4YRFA 5IZCA 1P3JA 1CUHA 1DXHA 4NTZA 2GWRA 1VJTA 3QNUA 3ABIA 1GCGA 1NXXA 1VE7A 2WRZA 4PSDA 3CIFA 4TXLA 5A0FA 621PA 4L4SA 2GBPA 1D7OA 2FWBA 3DYIA 3JZMA 4US1R 4ZQCB 4DSOA 1T5OA 4L3VA 4H4EA 4C87A 1DBSA 5GJBA 2C2GA 5JECA 3ZVNA 1ZRSA 2H51A 3ZGZA 3HP7A 4WZBA 4DLRA 1JHXA 4KGZA 5L9AA 1R0XA 3EPKA 3MK31 4UPEA 1XTUA 3EYWA 3DD5A 2R1TB 4YCAA 1CK4A 1T6YA 5ER6A 5I7EA 2O5VA 2ZBVA 4LPKA 4QFBA 1OT3A 3RTGA 5I48A 1A4XA 2EDAA 1SOAA 3QXGA 4TTSA 3SYMA 3CVUA 3HJTA 4J7UA 3U5ZB 3BULA 1ZN2A 3RIMA 4LYAA 1IFXA 4ZAGA 1FUEA 2X13A 3PQ2A 2GKSA 4PQRA 2O2ZA 1Q0ZA 2ROQA 5A9TA 2QUHA 5I9TA 2I9KA 1R6XA 1J7JA 1GAJA 4HSEA 2QV0A 4L5CA 4BRSA 4WNCA 1GPDG 3GUYA 3H5OA 4NBWA 3RK4A 3GAAA 1AMOA 3C3XA 3VDNB 1BXRB 2YXEA 3C97A 4JZKA 4NMMA 2VEDA 5HRAA 4E5MA 3UVEA 1Y9EA 3N3AC 3LU1A 3I52A 3V1YA 1ATIA 3MTIA 4GZMA 4DLVA 2HU5A 4I8XA 4OAPA 5KCMA 4URUR 5J2UB 5G4KB 4FWBA 4XOUA 2NUBA 2E85A 3QW4B 4FVTA 2FPMA 2ABWA 1Y5LA 4N7MA 3WISA 1NVUQ 4BNLA 1CVRA 1RDFA 2W5UA 3QPBA 3UGJA 4DHEA 4PCVA 4F3CA 4MS4A 5BR7A 1DRJA 1MF7A 1E6LA 2BGLA 3HUFA 4JQZA 1ZNZA 4L9AA 1A9YA 2A7QA 2O52A 3B9PA 4XE5A 4Z1MA 1G6KA 2F3UA 2WJAA 4H77A 1UC5B 2R5WA 5P21A 3LK7A 3NOVA 3U7EB 1D7AA 2AE1A 1MC1A 2JGJA 4MV3A 1M6EX 3UK6A 4S04A 4W6ZA 3LCMA 4NJEB 5HUQA 4ENWA 3I9NA 5BSTA 1Z35A 1DI0A 3AILA 4I2NA 1OFTA 3HDTA 3KEGA 2J3IA 3FR7A 3DBVO 4GXTA 4L2IB 3MUEA 4XYGA 4AKEA 1Y5IA 3A4YA 3H18A 3RUCA 3LUFA 3HGTA 3O7WA 3OECA 3R7WA 4EEZA 5CPBA 1WMEA 4I1PA 3NT4A 1ZONA 1UMDB 3RWMB 1UKVY 5JSYA 3I0NA 3L0ZA 3VSDA 2IBSA 3U31A 1GZHB 5CTJA 1GTJ1 2FPKA 4UEQA 2DP4E 1F51E 3DP9A 3NCTA 4PX2A 4RU1A 2CLFB 4AULA 4DCGA 1MGOA 3RIYA 1W93A 3VR6A 4CQLB 4OGLA 3ZY3A 1D4FA 4NONA 1I9GA 3I04A 3LHFA 4DNOA 4D44A 1RM5A 3N9IA 3QY9A 2QVXX 2K87A 3STHA 1M7BA 2YHIB 4Q3EA 4J43A 3RM3A 5GPBA 4X6UA 3IKTA 3EBPA 4Y6LA 4L74A 1JXMA 5G1PA 5LQMA 2A8YA 2BBWA 2O2JA 3DQZA 1LRLA 4NNPA 4LFCB 4OXQA 1ZCJA 4PR3A 5FTJA 4BLSA 1QDEA 3IOBA 3VAAA 4EGFA 2BKUA 2XWBF 2GF9A 4MNTA 4UM9D 1USUA 4RMNA 4CUKA 1NURA 1ZK4A 3D2BA 3D5TA 4MQ6A 4XUGB 4ZCQA 4G4GA 1ZA2A 4PYNA 3KL2A 2RGEA 3ZJ5A 2W6ZA 4WCFA 2O7RA 3GEDA 2JJYA 4G1CA 1O3YA 2Q4BA 4NCJA 2Z3VA 3MRVA 1PU2A 1FUUA 1Q92A 2ZULA 4U2EA 3ZG6A 1QIEA 2HH9A 2FGJA 4QM7A 4QU9A 1HWYA 1Z6XA 1G8JA 1CT9A 1M34A 5DPMA 3UK7A 4C9BA 3IPYA 2C5HA 5HGXA 5G4LA 5J4VA 3NAMA 3K9LA 3D6MA 4L8GA 2JFGA 5DLQC 1WF6A 4WERA 1K2WA 1OTYA 3IOEA 5C1IA 1UJBA 3BE5A 5JJIA 4KQWA 2RK6A 3GLQA 4JU8A 3UJPA 1PEYA 3IEUA 3PR2B 2PJRA 4GRIA 4NARA 3NHSA 3HB0A 1BW9A 3E9QA 1DAIA 1ZGJA 1EX9A 1HZJA 1KVQA 2EFGA 7AT1A 5BT9A 3KZOA 3R7FA 1KS9A 1SCUA 2ZYUX 3IRUA 3PF8A 4JBYA 4WVFA 1DL5A 1LU9A 1QYDA 3KJEA 5EMLA 5B7PA 1PEKE 1ITZA 2QRQA 5BN5A 2H16A 3Q1KA 4EI9A 1WPRA 2WWWA 1VPEA 5T41A 4EO7A 3SXUB 1J2YA 2NTEA 1GJRA 4I9GA 4IKEA 4R2JA 5DNEA 1R00A 3X1YA 1MRNA 1E9RA 1Q3TA 2I2AA 3M3DA 3CCFA 4J7AA 4BKPA 4C5BA 1B1CA 4DA0A 2WHPB 5DYGA 3GLHB 3R3WA 1RJFA 1AG9A 4H7IA 4X5OA 4RWEA 5EPEA 3HBFA 4QQKA 3ZWQA 1IN5A 3CVOA 3RC8A 2VOEA 1JS1X 1NA5A 1OGYA 3L82B 4MQ4A 5M2QA 1UMBA 2P40A 1CQWA 4GHWA 2SNIE 3OPMA 1GCIA 2HPHA 3R20A 2C3OA 1VRCA 3LX4A 4OA5A 5EHQA 2ILTA 5TJHA 4CLOA 2BAGA 3FGZA 3QU9A 1M1YE 4BKOA 3PIIA 4HX2A 5EINA 1E7YA 2C9CA 2PUEA 1R37A 1HY3A 2A5FA 4KLCA 3SICE 2WYIA 3AJDA 4F4CA 5KKNB 5C1DA 8MHTA 1VPLA 1EA7A 4ZTBA 3P9KA 4MAMA 4JQOA 5MF6A 4JWKA 2FQWA 2GKGA 3IVRA 2DERA 4WQMA 3SEZA 1LPSA 1DB3A 1NXTA 2OHVA 1H66A 2PAFA 2PX8A 4O4IA 1SVKA 4R8KA 3U1BA 2PUCA 3FGNA 3K1YA 2HSGA 2WE8A 4L15A 5J9GA 2I71A 4QX6A 3HWWA 4G1BA 4TV8B 3TLYA 2G0NA 4A73A 5CFPA 3PVSA 4HWKA 3D8HA 3E5NA 1DKPA 4E5DA 2Q7XA 2D2XA 4DNFA 6PFKA 1E3TA 2NTJA 2ZSDA 4HY3A 2QL6A 2LBPA 2H1LA 4US0R 4C07A 3KAQA 1AQNA 2VPPA 1NMZA 5HJ5A 1HURA 2V3WA 3ZU4A 1YZKA 3NANA 1ZINA 4PYKA 4WFJA 4EQ6A 4MP6A 1X13A 3AEQA 1GUAA 3DGEC 4MRRA 2FKAA 1JI0A 5DLYA 4RANA 3VYSB 1AK9A 3WO0A 3WLQA 1KNXA 3B9RA 2XMRA 4LRSB 4KJZA 4TMKA 1W5AA 5CX1B 2ZXEA 4DLAA 4PN3A 1JV2B 1VYHA 3OM0A 4O4LA 2CLEB 4K9NA 2O1WA 4DIUA 2GM4A 3A0UA 3SQNA 1K6MA 5A1TA 2XUJA 2ZE5A 4PO3X 2CF6A 4N0PA 4EB6A 4JKYA 1Y9DA 4QO7A 3U4HA 3PNMA 1XNJA 4D43A 4NJMB 5LNK6 3AUYA 4RADA 4E12A 2AFIA 3WGZA 2JJ2A 3EF0A 2G5CA 2QRLA 4R8MA 1YJCA 4C0SA 5B64A 4A15A 4D26A 3SIXA 2GVZC 2RC5A 4FN4A 1VLQA 2H48A 2JI9A 3UA3A 3MZ0A 1Y3FE 2P7HA 1YFLA 1L5GB 4P7KA 3T4PA 3COYA 3NC0C 5CB4A 5DXJA 3TZBA 3SBDA 1LD3A 3ILHA 2AOUB 4WKBA 4GLFA 4EDHA 3JQFA 1E3JA 3W6PA 2ZB7A 3ETDA 2REQB 1Z0FA 1H2ZA 2GDJA 3HYNA 1BDHA 5EJEA 1DUV