5BNTA

X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to nadp from pseudomonas aeruginosa
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
368
structure length
368
Chain Sequence
KRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVIDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of a Aspartate-semialdehyde dehydrogenase bound to NADP from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 115
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5bntA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5bntA01
1LDYA 4ALKA 5JYDA 2PV7A 3RKRA 1YBMA 1A72A 3ROQA 4J9VA 3C7CB 4CMIA 5IDQA 3MZ0A 1GYQA 1ONOA 1W73A 4KOAA 1QKIA 1YJ8A 2YUTA 4FQ8A 2QHXA 3GY0A 4UVIA 4CQMB 4FFMA 1EDOA 4N7RA 4D3FA 4EDFA 3SX2A 2ZYDA 4J2HA 4Q3DA 3ONFA 3OJLA 4RORA 5ENVA 3VZSA 5L51A 3TNLA 5GZ6A 3AUSA 3LT4A 4E2WA 5HWSA 3L6OO 3ETDA 2WYUA 2P9GA 1LSSA 4BNLA 3PZRA 2NNLD 1E7MA 1YL7A 2IZZA 1WXDA 4PLYA 1LSUA 2ZJ0A 4OXKA 4IMPA 3PEFA 1J4AA 4IQ0A 4J1QA 1WDLA 1NQAO 3BHJA 4XQGA 4RVFA 4ZRNA 4CLEA 3KM0A 5JO0A 4IS2A 5A06A 1RKXA 4A10A 4B7CA 3NT2A 1FDSA 4OMUA 2V7PA 3RBZA 4ALNA 4CR6A 4MVJI 1G0OA 2Q22A 4IJWA 4QUKA 1BTOA 1G0NA 3T7EA 1H94A 4RLSA 1B15A 1X1EA 3UCEA 3B70A 4XGKA 1RM5A 3HDHA 3QVTA 4AJJA 4J91A 1NP3A 4EGFA 4J43A 1PIWA 1ZJZA 3AWDA 4RVHA 3OQBA 5EQDA 3BHIA 1Y9AA 1DHRA 1Y8QA 2PZMA 5CP8A 1DC3A 2BF7A 4AICA 5JDCA 2FR8A 1DSSG 3BTSA 5U4QA 3L77A 3QIVA 1ZVMA 4FJ2A 5EN4A 3NTRA 5EERA 2EF1A 4TKLA 1DAOA 1AUPA 5A03A 4NFYA 2HJSA 3FR8A 5ILGA 4J16A 2JCYA 4GSKA 4WOJA 5IXSA 4WNIA 1E7SA 1GUFA 2JHFA 2I3AA 1WDKA 1TI7A 4HBGA 3LQFA 3WOHA 4CM5A 1C1XA 1YBAA 1VLLA 3QQPA 3GEMA 2FPIA 2DKNA 4R1NA 1DC6A 3CZMA 4TRRA 2EERA 4FIZA 3JQ9A 1DO8A 2Z5LA 3RFTA 4YT2A 2VYVD 1SB9A 3EVTA 3WDSA 5JAIA 2DUWA 3MJTA 4BGVA 1LEHA 4IJUA 4IZHA 3WG9A 5BSEA 3PLRA 3JQGB 1XDWA 2NVUA 1DIRA 4OM8A 3Q11A 1CRWG 3VPSA 1HDXA 1I36A 1H6CA 2HCTA 3FNGA 4XYGA 5AYVA 3K6JA 1WLYA 3VZPA 2QIOA 3KHUA 4L74A 4FPXA 2FR0A 3ADOA 1BXKA 1DAPA 2C7GA 1VM6A 2I6TA 3I23A 3RBVA 1E3EA 5EPOA 1PR3A 2PD4A 2A4KA 3IC5A 3AK4A 2XAAA 4BNTA 3RC9A 1ISJA 1AXGA 1EEHA 1LQTA 3KV3O 4I5GA 5KJ1A 4ZHSA 5A05A 1EQUA 1LJ8A 4CMBA 4D42A 4EJ0A 1SOVA 5L4LA 4MKXA 4IXWA 3ULKA 3TZCA 4L73A 2J5RA 2PZLA 4J4TA 1N1EA 4B3JA 4H3VA 1GYPA 4GLOA 2DLDA 1O8CA 3KB6A 4TRJA 4BO8A 1SC6A 1OZAA 3V5NA 1PJBA 5JY6A 3Q9UA 1IPFA 1XQ6A 4YRAA 3WBFA 4NIMA 2PKQO 4OIMA 5KVQA 4Y67A 3ANNA 1E0DA 1DLJA 1JDJA 5J23A 1DRUA 3MJCA 4N18A 3RUHA 5ILOA 5C3MA 4JP2A 1UH5A 4GMGA 1PQUA 1HEUA 2PZKA 1U3UA 1NVMB 1BDMA 2NU7A 2OBYA 2B0JA 3VVCA 2D2IA 4PLFA 2E49A 4ZJUA 1XGKA 4DL9A 3UN1A 4YT8A 4K6CA 4KQWA 4BGUA 1XSEA 2EP7A 1DFHA 1KS9A 2WDZA 1DIGA 3KSUA 1IYZA 5F1KA 3G0OA 1RYDA 1MG0A 1EVIA 2O23A 1Z7EA 1GU7A 4XJTA 3U3XA 2JAPA 5JLAA 5ICSA 1HE3A 3C24A 2VT2A 3PJDA 3W6UA 3DO5A 3AY7A 1OBFO 3I9NA 4YPOA 1YO6A 1WWKA 5JPIA 5DULA 2AE1A 3S8MA 2YHIB 1ZMOA 1NWHA 4PN3A 1PWXA 1VC2A 3KXDA 2Y68A 1A4UA 4Q3AA 3PIIA 4XKJA 4E5NA 4WECA 4IDEA 3OQ6A 1CDOA 3O8QA 3L4BC 1AHHA 4DWVA 2GZ2A 1NWCA 1EFKA 1MG5A 3GZNB 1YB1A 1V0JA 2I65A 1QYDA 1ZSYA 4R1TA 1BG6A 3ZNQA 5JDCC 3GR6A 5CHEA 3BIOA 5T73A 1PJ3A 4RL6A 1JWAB 3VPFA 4OJNA 2P5UA 5CPFA 5TSDA 2UUOA 3IS3A 1VJTA 3ZWOA 1D3AA 1RJWA 1NFQA 1WMAA 3KZVA 3CKYA 3UUWA 2W90A 1BWSA 4AFNA 2CSUA 4MVJF 3FN4A 1PR9A 2WE7A 2ZQZA 4LVUA 1I2CA 2PH3A 2QRJA 1E6WA 4ZGWA 1E7QA 1FJHA 4PIVA 3NYWA 3V1TC 5A9SB 1FDVA 2H63A 1WVGA 2NQ8A 1U8XX 4P4NA 1RM4A 3AM4A 1ONPA 4LMRA 1K5HA 4TROA 2X86A 1PJTA 5G0VA 2NACA 5HA5A 4O59O 3L6EA 1QLHA 3ZGYA 2X6TA 4CM1A 2X9NA 2BI7A 3HB5X 5A5FA 2E37A 1XG5A 4DPLA 2VWGA 4Z0HO 4GX2A 4QEDA 5AXCA 4PGFA 1R4NA 4YJDA 5DP1A 3JD3A 5GMOA 5DCUA 3QLJA 2RAFA 2C20A 3OJFA 5H83A 3K96A 4HNGA 1KVUA 4R51A 1Z73A 3BTOA 2Q2WA 2FN7A 1HETA 3CZRA 3K8ZA 4E31A 2O3TA 4WLEA 1R6DA 4OKNA 5HBRA 1PGOA 4BV8A 3GF4A 4E4YA 3WWYA 1YRLA 4L0QA 3D3EA 3RUCA 3DMTC 5JFOA 4RV9A 1A5ZA 2VHVA 2VOJA 2FZEA 4N5MA 4H15A 1E1MA 3ENKA 2AQIA 4TZKA 3H9JA 2IE0A 1ISHA 4PLTA 1R15A 1P45A 2I3GA 3JQCA 3NJ4A 4XB2A 5TQVA 4RDHA 4YT5A 1NXQA 3TZHA 1EVZA 1U5AA 3FD8A 4R9RA 3BTUA 3OH8A 4ZQEA 4FC6A 4UREA 4DIFA 5HS4A 2ZB4A 4IUYA 1I30A 3I4CA 5ENDA 4DMLA 4R3NA 4ITUA 4DXHA 5ITVA 3H9EO 3KO8A 1N7HA 3PPIA 3MTJA 4CJXA 1PJ4A 1X7DA 2G17A 2C2XA 4OYRA 1BVRA 3IMFA 3L4SO 1ZK2A 2PY6A 3ASVA 2AQKA 1TT5A 3JQ6A 3VH4A 1MA0A 1ISGA 5BNFA 3BMNA 3GA0A 1BW9B 4J0EA 3ZWWA 4PG4A 4G65A 3ON5A 1DFGA 2D1YA 3ITDA 3QWFA 4OAQA 1ZO8A 4IXTA 4PLGA 3FNEA 3ROPA 1SAYA 4XGIA 2ZATA 5BNIA 2HLPA 2X1HA 3MTGA 3BMCA 4A73A 4CMGA 4E5MA 4CLHA 1ORRA 1NQOA 2DUUA 2GN8A 4UUNA 5U9CA 1WDMA 4ZU3A 4BNYA 2UVDA 2IEDA 3W8DA 4BNGA 3PDUA 3A28A 2QZZA 4BKUA 3AM5A 5I7VA 4RZHA 1HKUA 1P74A 3GPDG 2Y0EA 1FDUA 4I9UA 3DC2A 3D5TA 3L4BA 2V6FA 3OJOA 4GWGA 3WJ7A 2WD8A 2B5VA 3DQPA 2VYVA 2DBRA 1I2ZA 5CEFA 3KVOA 1PQWA 3DOCA 3FF4A 1HYEA 4JJFA 4R54A 5F5LA 2O2YA 3DBRB 2DBQA 3EVNA 4I1IA 1O94A 1ISIA 3VPHA 1CF2O 2UAGA 4FFNA 3WWZA 1GTMA 2BFMA 2Z1NA 4CMKA 4U0KA 4CODB 5KJ6A 5JW6A 5A1TA 3LLSA 4IMRA 4BUCA 5I8WA 1YVEI 3Q2KA 1M75A 4EI2A 4II2A 1Z75A 4GI2A 3HUDA 3UXYA 1IZ0A 5TT0A 3TQHA 3C7AA 5DOVA 2WMDA 3ZV3A 1N92A 5LC1A 4W7IA 4J1NA 3DZHA 1B3BA 1UP4A 1Q0QA 3ZHYA 4E2XA 3F4LA 3JQFA 4J0FA 1X0VA 4LCJA 2D4AA 2O2SA 1W6UA 4RZIA 1LRKA 3D0OA 3PQEA 5TJHA 3P19A 5IN4A 1DRVA 3BMQA 4RO0A 4DBZA 1OOEA 3OQ1A 1GZ4A 3M1LA 4KZPA 2GD1O 5M6DA 4EJ6A 4II3A 1E5QA 4FGWA 2H9IA 4P4LA 2CZCA 4XD2A 4Z9YA 2H5LA 3GVXA 4Y98A 3UVEA 2OHXA 1ZK4A 3WTCA 4CQMD 1O6ZA 2C7VA 4RLHA 1PZEA 5AXBA 3M2TA 1HE2A 1A9YA 5A3JA 3QY9A 1P0FA 3B20A 3RUFA 5BR7A 5JNLA 2JD1A 4MP3A 4BS9A 1GV1A 4CMEC 4OO3A 2GYYA 1R16A 1KYQA 3C1TA 3VOSA 2PD6A 5G0SA 4J7XA 3JQBA 3LT0A 3G1TA 1GYRA 2VUSA 1J6UA 1UAYA 3ANMA 3P2OA 4ROSA 1N7GA 2EKLA 1RPNA 3ENNA 1C1DA 1BXGA 2W2KA 2C5AA 3HQ4O 1I3KA 4L4SA 4N54A 4DLAA 1JN0A 1BRMA 3GMDA 3JQFC 1YL6A 2DBZA 3O8QB 3Q6IA 4NPCA 5T67A 4WNCA 3A1NA 4LMPA 3SC4A 3DZIA 5KIAA 3P5SA 5ES3A 3DR3A 3G3EA 4KMSA 1CEQA 2O3QA 3ZV4A 4OXNA 1EK6A 1T26A 1UP7A 1ZSVA 5IJZA 4XGNA 1GQQA 3AM3A 4D46A 3G79A 3ZWCA 5TT1A 2BMAA 5AOVA 5DDIP 1KY5A 3DZGA 4RJTA 1GUYA 4EUEA 1P9LA 1JKJA 1BXGB 1UXKA 2C5EA 2X22A 4GX1A 4IJKA 4ALJA 1R4MA 4R5MA 1FF9A 3DXFA 4FD3A 1ISFA 2HUNA 4DUPA 4U0JA 4DC1A 3AUAA 4UVHA 2YY7A 4DYVA 3JQ8B 1YKFA 4YACA 4OXYA 3WICA 1DLIA 1PGPA 2JKVA 3ZHXA 1Y7TA 1VI2A 2H1SA 4GLLA 3C1AA 1T2DA 5IF3A 1AGNA 2PD3A 3DBVO 5FYDA 1EDZA 4B4VA 4GPD1 4YR9A 1G6KA 1X7GA 1Y8RA 1F12A 1X15A 2GN4A 1LUAA 3FBGA 1VJ0A 3L9WA 2E48A 1PGNA 3O26A 4L76A 4F6CA 1QYWA 2DM6A 4FFLA 3S2GA 4E30A 3DAGA 2P2SA 2WTBA 2WM3A 1R0SA 3GNQA 1YE3A 5CAEA 3OEYA 4XYBA 4WK6A 3RAJA 1OAAA 3VC7A 4O5OA 3ST7A 1IULA 2JL1A 4KUEA 2VNSA 3KSZO 3I3OA 3WFJA 5C7LO 4ALMA 3ONDA 4JQCA 1BMDA 4IBOA 2P9CA 4Z3KA 2EHDA 3G49A 1R66A 3HJAA 2SCUA 4Z9XA 4FR5A 2GNAA 5EIOA 2Y1OA 3PJEA 3UGKA 3S2IA 4BOYA 1EZ4A 1GZ6A 3E03A 3L9XA 1Q0HA 3RFVA 1IHXA 4YYZA 3ONEA 1E3WB 4XDYA 3C3XA 3Q9NA 4CM9D 4GMFA 1LU9A 4LVCA 2B4TO 1HF3A 1YBVA 4MJLA 1B3RA 3EUWA 5JYEA 1NPDA 2XXBA 2Q4EA 3H2ZA 3QWHA 4NFHA 2RIRA 2PFGA 1T25A 4YAIA 5G0UA 1XKQA 2WYVA 3NDRA 1LDMA 1ZCJA 5G4KA 4EW6A 3JD0A 4I08A 4R16A 2RBEA 4BNUA 4GVXA 3IKVA 2R6JA 2Y1GA 4OQYA 4AJNA 5FFFA 2C29D 3CH6A 5KTKA 3NDIA 1I3MA 1HZZA 3JYOA 4M1QA 1HT0A 2Y66A 3VZRA 1E7WA 3JCZA 2OOSA 5EL0A 5L53A 3DFZA 2EJWA 4RGBA 3TOZA 5G4LA 2HQ1A 4FN4A 1HDZA 3F47A 5ADHA 3B6ZA 2OZPA 5HTOA 1LLUA 3DTYA 1X14A 3E9MA 3ZNPA 3WNQA 4O1MA 1F8FA 1QYCA 2BGMA 2O3RA 3SJUA 3TSCA 2YV2A 1H6BA 1B8PA 3ZU5A 4PZCA 4BKPA 3BAZA 5BQFA 1S7CA 1N2SA 4IINA 1J49A 5TS3A 2I76A 3RIHA 2QZ9A 2DU8A 5DBGA 3JD1A 1GAEO 2NU9A 3QVXA 1NHWA 4QECA 3INTA 3U09A 3RSHA 4RPJA 3FR7A 4PFJA 4QTZA 4DLLA 2GSDA 2VZ0A 3ZW8A 1NR7A 1XU7A 8LDHA 4XR9A 5HS6A 2CUKA 5IFLA 1NBOA 3W4IA 4RPKA 4CV2A 3PYMA 3RU7A 4FSHA 4CM4B 3DONA 1BGVA 2V6BA 2W98A 4HWKA 4XJSA 3UOGA 3U5TA 4JJIA 1S6YA 1KVTA 2W2LD 4BO0A 4YB8A 1EBFA 1U4OA 1M2WA 2PNFA 3AOEA 4XEHA 1DRWA 5JY1A 1DXYA 1EUCA 5JBIA 2O7QA 3ITKA 3H3FA 3WSWA 1KIFA 2B35A 3JQGA 4K1LA 1UDBA 5AXDA 4YJGA 1B2LA 5KVSA 4D0SA 8ADHA 2YZ7A 5CEEA 2EXXA 2AG8A 2UUPA 3DBLA 3MCVA 1PJCA 4JNKA 1I33A 3I83A 4TRNA 1B14A 1UXGA 5DT9A 4X54A 3OMLA 1VRWA 4YAKA 3FPCA 4C4OA 1L7DA 1T4DA 3W8FA 2FPGA 3SLGA 3I1JA 3OFSA 1JLLA 4LGVA 4WCDA 1HDYA 3TJRA 2W2LA 1Z74A 1IOLA 4HADA 3S55A 1P77A 3HDQA 4FCCA 3C7DB 3I9JA 2D3TA 3RC7A 3LU1A 3RU9A 1YWGO 4BVAA 3RD5A 2HMWA 4IDDA 2AE2A 1VSUA 2YV1A 2EIHA 1KOLA 1DEHA 1E6EA 1CWUA 3INGA 2IEBA 3H7AA 1AHIA 1A27A 3DZBA 3D64A 1YB4A 3DHYA 3G1UA 4HY3A 1I0ZA 1Q7BA 3NRCA 1LC3A 1P1IA 1IUKA 3LK7A 3ORFA 1NX6A 1H2BA 2J5QA 1RM0A 4JX8A 3ZWAA 1ONNA 3ROKA 5MGBA 4ESOA 3RUIA 4ND3A 2AA3A 5U1PA 2J3KA 2FP4A 3PHLA 3R3SA 1D7OA 3AI2A 1Q0LA 3JYNA 3WIEA 4BQPA 3SXPA 3GAZA 2I66A 3GN1A 3E8XA 1JU9A 2C54A 4NJOA 3K2EA 1A9ZA 3I9OA 2GERA 5H81A 3CMMA 3KYDA 3CSDA 4OSOA 1MUUA 3F1LA 3GC6A 3AOGA 4NBRA 4DQUA 4AJPA 3PXXA 3RJ5A 1T24A 2CF6A 4NI5A 2OP0A 1E92A 2AEJA 1GCOA 3HB4X 4QSMA 1P1KA 5DP2A 3H5AA 3VDQA 3CMCO 1QYXA 4IIUA 3WB9A 1R4NB 4CM4A 1KETA 3ZWPA 5L7YA 1LRJA 3QW2A 1QV7A 5IXYA 1ZNQO 1LX6A 3D4NA 3GGPA 4F3YA 1XCBA 1A4IA 1J0XO 2GZ3A 5B1YA 3ZV5A 4CMAA 4BQRA 2IYPA 4GSLA 3ZWYA 4RVDA 5JMWA 3KTDA 3CINA 3EK2A 3WYCA 1V6AA 2PR2A 4QFDA 3GHYA 5DNAA 3TF5A 1ADBA 4KQXA 1Y6JA 3DWFA 1I3NA 4CM9A 4DLBA 3KYBA 2BH9A 4BB5A 4P4GA 1Y1PA 3F9IA 1LXCA 1TT7A 5JCJA 1DPGA 2Y0CA 5G0TA 1E3SA 1T1SA 3K2BA 2G82A 1UXIA 1C3VA 1T2AA 1WP4A 1MLDA 1NQTA 1R12A 4GKBA 4BMVA 1AXEA 1LLCA 5TGDA 4JIGA 4YQZA 5L95A 1XIVA 2DFDA 4DVJA 3TZ6A 4P38A 1Q1NA 3QJ5A 3HSKA 5TJ9A 4NR0A 1SCUA 5BSFA 3B1KA 2HK7A 1WZIA 4FFRA 1O0SA 2D59A 2AEMA 3JQ8A 4FW8A 4NBTA 3E5RA 4B7XA 4PCVA 4BGIA 1CJCA 5CDUA 7ADHA 5JYFA 1OI7A 3KETA 4XRGA 3T4XA 2X8LA 5FI5A 1NQ5A 2DVMA 1Y9EA 1U7HA 4YTEA 1O5IA 2IRWA 5I9LA 1X13A 4HFMA 2VCYA 2FOIA 3TRIA 4NDNE 4PRLA 1VSVA 1HE4A 4I5EA 4TMFA 2AQ8A 4PVCA 1C0PA 3LC2O 1NM5A 3GT0A 3STHA 1PS0A 3MEQA 3ZH2A 1N5DA 5TNXA 2EJVA 3WS7A 2JD0A 4N5NA 2Y1CA 1J5PA 5A9SA 4EUHA 2GCGA 2X23A 4DTIA 4E6PA 3VDRA 1WAMA 4RF4A 3PFWO 4MVJG 1WW8A 2ILTA 4LISA 3PDJA 2EG9A 2O4UX 3BMOA 1PQPA 1DJQA 3NAQA 3I9MA 2IXAA 1W4ZA 4KTTE 6ADHA 1B0AA 2QX7A 5FF9A 4OQZA 1TVEA 4GX5A 4RPHA 4CM8A 1DIBA 2P68A 1PS8A 1PZHA 1Z7BA 3I9LA 3PIDA 3WGZA 5C7IO 2X7HA 4J6FA 2J5KA 4DIBA 1LSJA 5L3ZA 3RUAA 1NAHA 3WNVA 3QWBA 5FI3A 4Z9FA 2HK8A 2VUUA 2BHLA 3RKUA 3MJEA 3GGGA 4R1UA 4YA6A 5FEUA 3WSVA 2JAHA 4XDZA 3PJGA 3AY3A 2G76A 2HMUA 4HFNA 3U4DA 1AE1A 3W4KA 1IZ9A 4YXFA 1LTHR 4PG6A 1NVGA 4LRSB 1FK8A 1ARZA 1EVJA 5F1OA 4LCEA 3JD2A 3RASA 4IY1A 3AUUA 5T6BA 1P1JA 3S2EA 3NT4A 1LDNA 2ZJ1A 3IIEA 3FRJA 1JAXA 4L8VA 1O9BA 5CDYA 2VTDA 2QW8A 1EK5A 5KKCA 5BSGA 2IDZA 4JROA 1KC3A 4WEQA 3UICA 1HRDA 5B12A 2YFQA 4AJHA 3V2UA 4D0RA 5L4SA 4IM7A 1IHYA 2Q46A 4MINA 4W9NA 3BMQB 3KRTA 3ASUA 3FWNA 1EE2A 3JSAA 1TA4A 3PHJA 3ZN2A 5CG2A 2P5YA 1I5RA 4XRRA 3BYZA 3E6AA 4UVDA 2FHSA 4IPTA 3S1LA 2CNBA 4EEXA 2QYSA 3NUGA 4RDIA 2EP5A 2JFHA 1GQ2A 4FOSA 3TN7A 3GQVA 4S1VA 3ZNOA 4IZIA 5EQFA 1RM3A 1MX3A 3OSUA 4L4XA 2GRAA 1A7AA 2ZB8A 3TZKA 3NEPX 4XB1A 2TMDA 1MXFA 3PYLA 3U49A 4GX0A 3JTMA 1YB5A 3ZHZA 3ZNNA 1NHGA 3WXBA 5K6AA 2VT3A 5C7OO 2NTJA 3BMCB 5CDGA 5KJFA 4MP6A 3OF2A 4ND2A 4CM3A 3HZZA 1F14A 2JCXA 4YCAA 4P8RA 3T7CA 1I3LA 2FR1A 4FGSA 3QVWA 4EYEA 1SEVA 3OJ0A 2PGJA 2HMVA 4R3WA 1XELA 1JWBB 2D5CA 4CM8B 2GZ1A 1IB6A 4NU6A 1ZFNA 4XQ9A 4CMHA 2IXBA 4BB6A 3O38A 3DEYX 4NHEA 3MOIA 3GHHA 1B8VA 1PU2A 3QSGA 4CLRB 2Y1EA 5JCXA 3ICCA 4R41A 3DMYA 1HSZA 3ZU4A 1JAYA 1E7RA 3AFMA 5KCZA 3FTPA 3D7LA 1MC5A 1PGQA 3IJRA 4CM7A 4OHUA 2J3JA 4WUVA 1GV0A 3LF2A 4QQRA 2GDZA 2NVWA 2OL4A 3UAGA 3AI3A 5JSFA 3T4EA 3PLNA 4ZQBA 4M54A 2GASA 4N5LA 3KYDB 3R0IA 2WD7B 3VPGA 2NM0A 4YQYA 1I24A 4KWHA 1DFIA 3GGOA 5T57A 1MP0A 1YGYA 1RYEA 5BNTA 3LYLA 5EMHA 4BNIA 1CYDA 2X9GA 3GDFA 1GEGA 4MIYA 1I32A 1LSOA 2DC1A 2A94A 2WWRA 2VRCA 2ZIZA 2EKQA 4UUPA 5KWEA 1PEDA 2FMUA 2BFPA 1CETA 2JD2A 3BXXA 4RQUA 4D43A 4Q3BA 3OEWA 4CV0A 2ZCUA 2Y1DA 1F17A 1EE9A 4P22A 4IQ8A 3LLVA 4MVJH 3NJ8A 1MGOA 1PJLA 3UFXA 4KWIA 3ZDFA 1YXMA 2FWMX 1H2HA 2ZTUA 2X0JA 4AVYA 4I5FA 1MV8A 2Y67A 5G4KB 4M86A 4I9HA 2HRZA 4EZBA 4NK5A 1C0KA 2ZTLA 2O3JA 1LDGA 3RQSA 1ISMA 3NKLA 3A06A 4MVJP 3A4VA 2VHZA 4W9NC 1QSGA 3JYLA 3H65A 2X58A 4Z0TA 4B4WA 4EUFA 3HG7A 2Q99A 2HDHA 2NADA 3KOUA 1HXHA 5ITWA 2VZ8A 3PK0A 1W8DA 4BNXA 1ENPA 1KVQA 3FSRA 2WJPA 5C37A 4BIIA 3RCBA 1M76A 3OIDA 2W2KB 4JCOA 5AXAA 3LC1O 4IGEA 5B4TA 3OA0A 4NG5A 1K0UA 2Q1UA 2ZB3A 4TWRA 3NV9A 1UUFA 1MFPA 2Y99A 3UF0A 4DYDA 4E2ZA 3DDNA 3SVTA 3VHRA 2Q49A 3U4IA 3JQDA 4RVUA 1KVSA 5FWNA 1NPYA 1GZ3A 2G1UA 5CDTA 2EGHA 3H4VA 2CMDA 5A02A 3E9QA 1E77A 2I99A 5L45A 4K26A 4NZ9A 2D8AA 2YYYA 2Q2VA 1KEUA 2Q2QA 4IIVA 1H5QA 1YDWA 4WLVA 1C0IA 4R4JA 2DPHA 1D4FA 5A04A 2H6EA 1L7EA 2OBNA 4Y9DA 1FDTA 1HWYA 4IGFA 1E1LA 4G5HA 3JYPA 4IQGA 5GZ3A 4M89A 3U9LA 2GLXA 2AW5A 2FPPA 3WQSB 4QO8A 1HLDA 5JMPA 3Q2IA 3IL2A 2NWQA 3DFUA 3MWDB 4ONEA 3AI1A 3KSDO 5JS6A 4RVSA 1Y8RB 3HWRA 2P4HX 5A4DA 3V8BA 4BMNA 1HYHA 3EYWA 3WMWA 4OOEA 3W6ZA 3EC7A 2VWQA 1XLTA 4JK3A 5L9AA 3WGYA 4MVJM 2PTGA 4W82A 1NPTO 2X9VA 3FHLA 3EZYA 1QG6A 3E1KA 4NMHA 2P4QA 4XYLA 1U2GA 2Q4BA 5KJEA 4AJEA 4YRBA 3JQEA 4Q3CA 1I10A 1LRLA 2OGUA 4NBWA 4XYEA 5JDIC 1DOHA 1LLQA 1WPQA 3EY4A 5JXWA 1YJQA 4J4BA 2HU2A 2CVOA 4WCFB 4KP7A 2NU6A 2NVUB 3EW7A 4ID9A 4WCFA 4A26A 4OH1A 4BNHA 5JC1A 4E13A 2CDBA 4FBGA 1N1GA 3GEGA 3VKUA 1YH3A 5T8KC 3JQAA 1U7TA 1PJSA 1Q7GA 4WLOA 2A35A 4G81A 3RWBA 1DHTA 4CR8A 3ZWVA 5THQA 1V3TA 1KEVA 1ZXLA 1PL6A 2B36A 4OKIA 1HDOA 4IDGA 4WGGA 1LI4A 2J8ZA 1ZK3A 1ZUD1 4CM6A 3TFOA 2QRLA 5BSHA 1ZEMA 3DBHA 1Y81A 3PHHA 4IJVA 1D8AA 4RCVA 3WQQA 1V3VA 2XPCA 2VUTA 4BO3A 1FDWA 1E6UA 3WGHA 4AJ1A 3O03A 2OO5A 2D0IA 4NJMA 5CFZA 4NJMB 1EUZA 2CY0A 4Z3DA 4TZTA 5COQA 4PLPA 4MVJD 3P7MA 3QVOA 3KLMX 4BV9A 4IDBA 2YW9A 2FSSA 2VHWA 3CXRA 3OP4A 1SZJG 3PGXA 4AJIA 3EGOA 3ZWBA 4ND5A 1IE3A 4NFSA 4XIYA 3ETGA 3RFXA 1JQBA 5BT9A 3GVPA 2EW2A 1U3WA 1BW9A 2PK3A 1P31A 4OL9A 3HN2A 4A27A 4JBGA 3IKTA 3WGGA 3PVZA 3D3WB 3I5MA 3DBHB 1QR6A 4D41A 4YRDA 3RVDA 4ZD6A 3TL3A 3OA2A 2VOEA 3ZU3A 3GK3A 1LNQA 1U1IA 4XWYA 3EZLA 4WEOA 4G2NA 1H9BA 2DTDA 4PVDA 3W4JA 4KUGA 2C82A 4BO2A 1X0XA 3RJ9A 2CDCA 5LDGA 5I7EA 3E5MA 4GBJA 1O95A 4AJKA 3P2YA 5DOZA 4ZA2A 4J9UE 3WGQA 2NVBA 3BMNB 4GKVA 1U3VA 4WE3A 1C1XB 3F6YA 2DPGA 3TDKA 3BZUA 3GLQA 3U0BA 2EWMA 4Y6SA 4EEZA 4J7UA 1LDBA 1GUZA 1M6HA 4RVGA 4EITA 3TPCA 4TKMA 1QXSA 2V6MA 3LF1A 3LDHA 2Q1SA 5DN9A 3H9GA 2HO5A 1P1RA 3UCXA 1ADFA 2CFCA 3M1AA 2O48X 2JFGA 2W8ZA 3DHEA 4HV4A 5LDHA 2NTNA 4UVEA 5I7FA 3L0DA 2X4GA 1X7HA 5T64A 4QO7A 3DBLB 1SOWA 1VPDA 2VYNA 2G5CA 3AU9A 4H7PA 1BVUA 2XXJA 2BKAA 3VH3A 2FSVA 1ZSNA 2VHYA 4CR7A 2RH8A 3GUYA 4A7PA 4W99A 4EBFA 4FOOA 4RQTA 3HNPA 3MJ4A 1QLJA 5DCWA 4TSKA 1UAGA 4BO5A 3WGIA 4NNJA 2WEKA 3KBOA 4E2YA 3GH3A 3ZI0A 1SO8A 5TIIA 1GPDG 3WJAA 4NK4A 4BKOA 3O9ZA 3DBRA 1I8TA 2JJYA 1F8GA 3E48A 1V35A 2RCYA 1ADGA 2ZK7A 4WASA 1UXHA 4S3MA 2Y93A 4CMJA 5L7TA 3PQDA 2AG5A 3VTFA 4CMCA 2VWPA 1YQDA 3HFSA 5KOIA 3VVBA 1ZK1A 2WD7A 3GFBA 2X0NA 4UUOA 4E3ZA 1C0LA 1PZFA 4D3DA 5IZCC 3I6IA 5L7WA 2NU8A 2PWZA 4R9SA 2ZQYA 4BMSA 4HKTA 1F06A 4KDFA 3O4RA 4Q3NA 1UR5A 1ZBQA 1E7YA 1H9AA 3PGJA 4RPGA 5IN5A 1SB8A 4U7WA 4B3HA 1ENYA 1ZKMA 4PLCA 4YWJA 2R00A 3QV1A 1U5CA 4ZICA 2OFPA 5DZSA 3ZW9A 1EVYA 4A0SA 4L4RA 3ZHBA 1K3TA 1H0KA 3ZCXA 1DJNA 1E1NA 4D44A 4GAEA 1LBEA 5COBA 1LA2A 4PLZA 4E32A 5C5IA 5T5QA 1SPXA 4XCVA 5K0ZA 1YQXA 4O0LA 1ZXBA 2BELA 3NT5A 2G0TA 3F1KA 1U4SA 3F46A 2B69A 4R69A 3FNHA 4DQVA 1HDCA 1PZGA 4E5YA 4I8XA 4YJHB 1BDBA 3NGXA 4UEOA 2C07A 2B37A 3JYQA 2WYWA 4BNJA 1E3WA 4MPDA 4JXKA 3GNSA 7MDHA 4DIOA 3ROMA 2Y05A 2F00A 2GUGA 2POQX 4MVJA 3OIFA 2AXQA 4I9NA 1R4MB 3M2PA 3PQFA 4U5QA 1QMGA 5IAAA 4JJGA 3GRPA 1R0LA 3K5PA 2O50A 1B16A 3ABIA 2LDBA 1NFFA 1K6IA 4Y6RA 1UZNA 1H93A 4BNMA 4DC0A 2DT5A 3FTNA 2IZ0A 2YJZA 3WTBA 2O3SA 2X0RA 2YFHA 4W6ZA 1SEPA 4FFOA 4R1SA 4O63O 2B4RO 2VZ9A 2AHRA 1ZH8A 3H6KA 4ALIA 4MKZA 2B4QA 1XHLA 3PP8A 2Z1MA 2F1KA 5F21A 3C8MA 1L1FA 4CQMA 1D1TA 3GG2A 3GDOA 1P33A 1UDAA 5B4UA 1ADCA 4JBHA 4HP8A 4E33A 4Z0PA 4YDRA 1DIAA 1M6WA 2EV9A 2VRBA 3DZJA 3L07A 3OETA 3RI3A 4YT4A 2VYND 2JCVA 2HKIA 3LC7O 1Y5RA 4HUJA 4XQEA 5A5EA 3COSA 3EHEA 1XR3A 2BD0A 1WNTA 1ULSA 2VRCD 5GZ1A 1HDGO 4BO4A 4CMEA 2DBVO 4JBIA 4UAGA 5KNLA 1GPJA 3ZV6A 3QWAA 2HSDA 1PJQA 1XU9A 4UEJA 3RC2A 2NSDA 4ZN6A 2AEFA 5A3VA 1UP6A 3E18A 1HYGA 4FB5A 2GPTA 1VKNA 2FY8A 3WX0A 1TT5B 2RH4A 2HMTA 1B7GO 2BI8A 3MJSA 1ZK0A 5HM8A 4CL3A 2XOXA 4CLRA 5EINA 2ZB7A 4PG5A 1PWZA 2Y0DA 4DREA 4WPGA 1KVRA 1NYTA 2VQ3A 1E5LA 3EMKA 3SEFA 4QXMA 4OOFA 4URFA 1CERA 2Z95A 1TLTA 4PRKA 2Q1TA 5EJ2A 3F3SA 1XA0A 4A5OA 2GF2A 2BGLA 4KDEA 3I9KA 1F0YA 4GWKA 4CPDA 3PWSA 3BMOB 4INAA 2R2GA 1G1AA 2GN6A 3FNFA 5JO9A 4E21A 3IP1A 1ENOA 1V8BA 1E3JA 4AJOA 5L4NA 4K28A 5K9ZA 4JP3A 5IG2A 4LRTB 3IP3A 2HRBA 2Y1FA 3HFGA 4MKRA 3KLPX 4CL8A 4DA9A 5JYAA 3OHSX 4CQLB 4LSMA 3F5SA 1VL0A 2C2YA 2R00C 4FDAA 3D4OA 1JW9B 3DB2A 3SC6A 2VNAA 3EAGA 3FPLA 3GAFA 4PG7A 3H2SA 3H5NA 3GVHA 2GN9A 5CEJA 2NQTA 1GL3A 1QORA 3TWOA 3OICA 5I8ZA 3GG9A 2FRDA 2JHGA 4BO7A 3A14A 4J1TA 1Z45A 3AW9A 2B5WA 3JQ7A 5TLSA 1MXHA 3U62A 2OORA 4BKQA 1LLDA 2C0CA 4DPKA 4LW8A 2DTXA 3LSYA 2NLOA 3ZWNA 1ZMTA 5B37A 2O7SA 3LT2A 5J9GA 2QRKA 4KTVE 2DAPA 4QT0A 3E82A 3INRA 1OC4A 4IDCA 3DOOA 1PL8A 1O89A 4UVGA 1GY8A 4YEDA 1KEPA 3JQAD 2NTVA 3HDJA 4H16A 1E1KA 1B26A 1GEEA 3DOJA 1NAIA 3NTOA 4FFPA 1M66A 1PL7A 3UKOA 2BFAA 4XYMA 1VKOA 4YAJA 2Q50A 2YQ5A 4ND4A 2LDXA 3PI7A 3PJFA 4E0BA 1CQIA 3BA1A 1SMKA 1NVTA 3DL2A 4MO2A 4XX0A 1IPEA 4J1SA 4RF5A 4HX5A 9LDTA 4AL4A 3FCOA 3R3JA 4J3FA 3UHAA 3GN2A 2GO1A 1EBUA 1GCUA 4GQAA 2AQHA 3OM9A 1NNUA 3QHAA 5DCYA 4ALLA 4E5PA 1DDOA 3RUEA 3A9WA 5I9NA 2HK9A 2EEZA 3QVSA 1ZW1A 2RHCA 4W4TA 3RUDA 3K9QO 4NU5A 3GEDA 5AQ1A 1ML3A 3WFIA 2DFVA 1U28A 3PRJA 1LQUA 2C59A 1RWBA 3VH1A 3OBBA 3TFQA 4BHTA 4WLNA 3WQRA 5F5NA 5GY7A 4PLVA 4K9DA 2A9FA 4Q3EA 1WMBA 1T2CA 3HDYA 3N74A 4K6FA 1K6JA 2B83A 3WMXA 1Y8QB 2IODA 5COAA 1R37A 6LDHA 2BFOA 5F1PA 3X2FA 3IUPA 3CUKA 4YJGB 4HNHA 5JAMA 5DBFA 3AUTA 3AOEC 3OECA 3CTMA 1KBZA 3H8VA 4GH5A 3SJ7A 1X1TA 3UW3A 4E5KA 3V1UA 3BTVA 3VKVA 4WOKA 3PWKA 1EQ2A 4L9RA 4CV1A 3E9NA 1QRRA 4FJ0A 4LSWA 5IDXA 4AJ2A 1PS9A 1GADO 2PZJA 2WSBA 4GGOA 3JD4A 3H9QA 3ZZNA 2CD9A 4IDFA 4B4UA 5ER9A 1PTJA 1UXJA 2ZYGA 2E6UX 2V65A 3B1JA 4KUHA 4BKRA 4CLDA 4OGWA 1M67A 4F6LA 1JKIA 4U6QA 1H6AA 3Q0EA 3ETEA 1Q2XA 1E3LA 2BRUA 4D79A 1P44A 2V6GA 3FWZA 3GVIA 4YAEA 2O3UA 4CV3A 2TMGA 3HN7A 4NQZA 3GPIA 3UH1A 3DAFA 3PWZA 1JVBA 4MP8A 5DF1A 2NV6A 4QX6A 5H82A 3K31A 4PZDA 4DPMA 5TX7A 4TVOA 1HE5A 1P0CA 4Q9NA 4A03A 1C1DB 2P91A 2VTEA 1ZJYA 3U4HA 4TQGA 9LDBA 2E82A 1Z82A 1VL8A 4RPLA 5ICMA 4R68A 3Q3CA 4O6VA 4J90A 4XQCA 4XR4A 5IZ4A 3CPSA 3ADPA 4FS3A 5A9RA 3BHMA 1T2FA 5IDYA 1HL3A 1ULUA 2IYOA 3TZQA 1DBVO 4U8GA 4U6SA 2YDYA 4TRMA 4WKGA 4BO9A 4NBUA 1U2DA 2CVZA 3D1LA 3S2FA 3U4CA 1XYGA 3ZWXA 1DC4A 3DZKA 2YHIA 3C1OA 4C7KA 2I5PO 4CUJA 1TEHA 1VJ1A 1GD1O 3IQDB 3H3JA 3QP9A 1XEAA 1K2WA 3GVCA 3PHIA 3D3WA 4Y6PA 2J3HA 3V2GA 3F5QA 1OFGA 1H6DA 1N8KA 1SBYA 3I6QA 3ZU2A 3IDSA 3ZWMA 1XWFA 1DB3A 1NASA 3VH2A 1I2BA 2NUAA 2X5KO 2BGKA 3RROA 1D1SA 1I01A 3AU8A 3ANLA 4B7UA 3JQ7B 5JAQA 4IS3A 4CMIB 1HLPA 2GR9A 4CLXA 4BNKA 5G0WA 4R01A 1PGJA 1BHSA 4E12A 2VWHA 5THKA 1ZIDA 4W7HA 1P3DA 1LDEA 1HSOA 1UZLA 5HRUA 4JN6B 4OSPA 1NFRA 3IOYA 1GDHA 1QV6A 3LVFO 4C7JA 2A92A 3HE3A 1NR1A 4RF2A 1E3IA 4ZQFA 1TXGA 1PSDA 5KKAA 3H5RA 4R5HA 1GFSA 1U8FO 1YL5A 1R0KA 4B8ZA 4DQXA 1HTBA 1KC1A 4D45A 1MB4A 4F45A 3H9UA 3NDJA 4M8SA 4BNNA 4BNVA 5L40A 3LZ6A 1OC2A 2PGLA 3Q1LA 1HZJA 3JQ9C 4YBZA 2YQ4A 1BXZA 4WJZA 4ZQHA 2UYYA 4DGSA 5CG1A 3VAZA 1JA9A 5LCXA 2EKPA 3R6DA 1UJMA 5TRTA 1ENZA 5K6AC 4NH4A 2ZKLA 2YDXA 1KERA 4CLOB 1GR0A 1YONA 4Q39A 4LN1A 4JGBA 5T8KA 4MIEA 4YJFB 2RHRA 2E4AA 3AFNA 5TC4A 5EESA 2PGDA 3QRWA 3W8EA 3K73O 3WR5A 4J49A 5JAZA 3GOHA 4GGPA 1JKFA 4WCFC 3EDMA 3KEOA 4MDHA 1A7KA 1B8UA 5CDSA 1FXSA 3C85A 3F4BA 4BO1A 5CPBA 1UZMA 4QFCA 4UEKA 2W4QA 2VHXA 2XF8A 3GZ4A 4WLFA 3IAHA 1OMOA 1GQYA 4CLOA 4FC7A 4ZQGA 1YQGA 1QYVA 1XQ1A 4DMMA 1ZEJA 5I7SA 4Z6KA 2DQ4A 4NBVA 4L75A 1A71A 4YJFA 4XA8A 5JCJD 2I67A 2EW8A 3WLFA 3IJPA 4B79A 5KVCA 2I9PA 4M87A 4UULA 1EFLA 4XIJA 1P1FA 1W0CA 1KEWA 3GFGA 3G17A 4BNWA 2WE8A 3L6DA 4AG3A 3FI9A 1QP8A 3GMSA 4AJLA 5JDIA 4IDAA 4HXYA 4JLWA 3NGLA 3K92A 1P1HA 3NX4A 1PJ2A 4TVBA 2IZ1A 1ZZEA 2VN8A 1V3UA 3D4PA 5ER6A 3WYEA 2JFFA 2PLAA 2ZTVA 2P9EA 1CIVA 5G2OA 3D5QA 4ILKA 3IUSA 3M6IA 2HAEA 3DAPA 1ID1A 5AVOA 2PA3A 4MVJE 2OXIA 3R1IA 4ZVVA 4BO6A 5F3RA 1UDCA 4XZ3A 3ICPA 5I9MA 3SLKA 4I5DA 4AJ4A 3HADA 3RBXA 2Q1WA 4CQLA 3MOGA 3K30A 3PTZA 3VTZA 1JTVA 4YAGA 3N58A 4YVFA 2YHUA 4B8WA 4MOWA 4M49A 1T2EA 1PX0A 3GDGA 3DMTA 4Y8VA 5IDWA 4HFRA 2OP1A 3W1VA 2BLLA 4HFJA 3I52A 3HHPA 2AMFA 3PFFA 1VE9A 3GRKA 3GNTA 3OIGA 4YJHA 5TF4A 4D7AA 3PZBA 3CEAA 2D5AA 3WGTA 4B3IA 1N9GA 2O4CA 1N9GB 1NTOA 3PYXA 1K6XA 1DC5A 4BL5A 2QYTA 1MFZA 4BGEA 1EMDA 3RC1A 2PH5A 1Z6ZA 3KYCA 4LK3A 1EUDA 2J3IA 2ZTMA 1C14A 1IY8A 3FBTA 3KYCB 4F46A 4PZEA 3GZNA 4J7CA 3UCFA 2Q3EA 4FJ1A 1V9LA 2YV3A 5MDHA 3QWIA 3WGOA 3WBBA 3MJVA 3CE6A 3V2HA 2HJRA 2OUIA 4J4HA 1KY4A 1BSVA 4BNFA 3B1FA 2OMEA 5KJCA 1AN9A 2UDPA 5KVVA 4GVLA 1Y5MA 3AJRA 3AY6A 3DHNA 3WIDA 5A9TA 1YOVA 3X2EA 2HMSA 2PKRA 1TB4A 1CQJA 2CVQA 2J6IA 1LC0A 3QE3A 4ZRMA 3TL2A 4B4OA 4BNZA 3QA9A 4ND1A 1YDEA 2QG4A 3VPXA 3WLEA 4CUZA 2UV8A 3I4FA 3OJEA 2CF5A 1IL0A 2FZWA 4PLWA 4UUMA 2X5JO 1U9JA 2GGSA 3SBOA 1YS4A 1FMCA 5IZCA 3TOXA 1DIHA 3CIFA 5B4VA 3LT1A 4RF3A 1YOVB 1MC4A 5JC8A 1VL6A 2DTEA 1T4BA 2ZCVA 4GL4A 3GUCA 3JV7A 3WYBA 1WZEA 2CDAA 3JQAB 3N7UA 1JVSA 4A2CA 3JQBC 2X5OA 1HDRA 3DZFA 3KEQA 4WLUA 5DBIA 3V1YA 4CUKA 4DBVO 4D3SA 2PKQP 1SNYA 2Q45A 2X0IA 4J2OA 3VZQA 4PLHA 1T1RA 2EGGA 3KUXA 4DRYA 3NTQA 1Q7CA 4MIOA 2ET6A 1U3TA 3MWEB 5JE8A 4M55A 4EJMA 2QQ5A 1K89A 3PHGA 2ZYAA 4PG8A 3DTTA
chains in the Genus database with same CATH superfamily
2QROA 1MHPA 1G3RA 1CZNA 2IOFK 3V8NA 2EFCB 1YBMA 1OXKB 1ZM2A 3RKRA 4DLUA 4D3YA 4LY0A 5BVHB 1JFFB 1JG7A 4J9VA 1NYLA 1PWEA 2YX1A 4Y6LA 2WQ6A 4AKIA 4Y1GA 1ONOA 4PC3A 4KOAA 4YRSA 1QKIA 1IY9A 4YMTA 4Z3OA 3GY0A 2RGCA 3R76A 2WF6A 3AX6A 4AB1A 1ZAKA 2GM4A 2FPSA 1F0NA 4TL6A 2P6NA 5D51S 4RJLA 4D3FA 4EDFA 3MQ2A 2ZRPA 3TNLA 1V1JA 5GZ6A 1QCCA 3AUSA 2JIRA 4TS3A 4BYMA 4NNPA 4E2WA 2PN1A 3L6OO 2X7JA 1G20B 1FMTA 2P9GA 4HTFA 3RIEA 3WHIA 4DR2B 2R4UA 5EIHA 2PUDA 2QMQA 2XGMA 1K4MA 1KI9A 1BH2A 1P0MA 4O33A 2ZJ0A 4IMPA 3IELA 1J4AA 5EE1A 4IQ0A 4J1QA 5CIQA 1RJDA 2VATA 3BHJA 2Q6TA 3BN3A 4XQGA 3ZWQA 4E11A 1H9CA 2KLBA 5H1YA 4G4GA 4B7CA 3NT2A 1FDSA 3U4QB 2XB4A 1T15A 4AF7A 4FWIB 1QTQA 2Q22A 4BZPA 3TLEA 3HB0A 3B6MA 1CB7A 4BMPB 3CT4A 5AKEA 1KGSA 1BTOA 1L2TA 2XYRA 4JB3A 2BISA 3T7EA 3FWYA 4RLSA 3TOVA 3B70A 1ZDMA 1A82A 4JWTA 2WP8J 4F4HA 1JALA 4QYMA 1ILEA 1G6OA 2FQYA 2WHRA 5DU2A 5JNRA 3QVTA 1KFJB 1GPWB 1QH9A 3EGEA 4AJJA 1KK3A 4FYMA 4G85A 4BLPA 1CUUA 1D2NA 2CFSA 4EGFA 3SC2A 4J43A 2V54A 3KG2A 4HXFB 5HVNA 3OQBA 1QE0A 2YZ2A 3LGSA 2XI4A 1DUVG 3EXIA 4LDQA 3O8BA 4L3WA 3NM4A 4QRIA 3ZH9B 1AA6A 1DHRA 1Y6QA 2PZMA 1RRKA 1DC3A 3L41A 4LHWA 4WKPA 2I9KA 2VZEA 2FR8A 3C87A 1W5AA 1F6DA 3IQWA 5U4QA 3QIVA 1XVIA 4FJ2A 1ZWKA 1C30B 1EFUA 4FYYA 2JLCA 3GUUA 4JKOA 5GJWC 3NDPA 3A2MA 3FR8A 1JNXX 2QD4A 3EIEA 3VYRB 4DMRA 4V1CA 4NS1A 1QHSA 2QUJA 4WOJA 1SY7A 4IIJB 5IXSA 4FXOA 1WB9A 2QRVB 1NBHA 5C1IA 1E7SA 1C9DB 1RAFA 1FP7A 1T2NA 3IIJA 5DKFA 1P6UA 1WDKA 1TI7A 3UQYS 5JQGF 1S4MA 3LQFA 4HBGA 2PMWB 5EWMB 4PZ0A 3SZGA 4CM5A 3K72B 1IONA 3EVFA 1H05A 2DKNA 3EMDA 1DC6A 1D2MA 4KGZA 5HUQA 5AW2A 1A4XA 3JQ9A 4FIZA 1DCKA 4FE7A 4KGVA 4MR9B 2VYVD 3EVTA 3WDSA 5FUBA 4NICA 2DUWA 2ADOA 4NAVA 4YCDA 4EENA 4BGVA 4RL4A 3M5DA 5CD9A 2XUPA 4RC9A 2QYOA 5KSOA 5FWYB 4KK4A 4UHEA 3UK2A 3HSSA 3V8MA 2DHRA 3RS3A 1PZMA 2NVUA 3FWPA 4NENA 4AS2A 4DNFA 3CF4A 2QN8A 2WTAA 1X77A 3Q11A 4QOJA 4LGYA 5E7MA 5DCLA 3V8PA 4H4DA 3A6ZA 3BE5A 5CLQA 1ZY2A 2IPNA 1H6CA 1LPPA 2HCTA 3FNGA 2FRDC 4XYGA 3RSLA 4N12A 3S1AB 1WLYA 5CCBA 2QIOA 2O8EB 3T15A 4A9AA 4FPXA 5D3MB 3UA4A 2C7GA 4EA6A 1RYNA 1VMAA 1W2GA 5ED4A 3JU3A 5EE3A 3TSWA 1PR3A 1J2JA 3CZQA 2XAAA 2RJNA 2BOVA 2XSZD 1CVLA 4K2AA 3CW9A 4G3XA 2P62A 1EEHA 4HTFB 4MRMB 3BXPA 4GUDA 4I5GA 4BMYA 4EQ6A 3D6FA 4ZHSA 1W2WB 2FSVC 3L8YA 3BILA 5A05A 2XNKA 5LDDC 4LVOA 1V1RB 3A11A 4ENRA 5AFSA 5BQXA 1DGQA 5CB4F 2CKDA 4D9EA 3R9XA 4LJ8A 4MKXA 3QBEA 1WD7A 2PBFA 3ULKA 1AURA 3N07A 1F5SA 4L73A 1YI0A 4MYUA 4NOJA 3UT5A 3ZK9A 4BQFA 1H4QA 4H3VA 4EUNA 2YZNA 4D80A 1O8CA 3BK7A 3KB6A 1DJLA 4KE9A 1NXVA 1OZAA 4Q7EA 4BO8A 1ZCAA 2QX9A 2I54A 5JY6A 4GRIA 1AGYA 1IPFA 4Q1DA 1LNZA 2OR3A 4DKXA 2PKQO 3RPEA 5BN4A 3PQ5A 1CS0B 2JBAA 3MHPA 1E0DA 1JDJA 4HLUC 1C4XA 1ZA2A 2HI0A 5D3MA 5LLDA 2AN4A 2H2IA 3MJCA 1XTZA 4TTIA 3RUHA 4X1OA 3KQTA 1GTG1 1SHZA 1JS1X 1Z4JA 3KJFA 4YS6A 1SKBA 1U3UA 2PSDA 1NVMB 4DR5B 3ADCA 2B0JA 4E08A 1IUPA 4D8YA 1EU1A 1J8QA 1WZNA 1VL1A 3U1VA 1JLKA 5DHRA 3QKTA 2C2BA 1DQRA 3K5WA 3UN1A 1YKGA 1G2PA 1UBFA 1F7VA 1DFHA 4UM8B 4QVIA 4FZ3A 4FKZA 1DIGA 4PBSA 4RHUA 3KSUA 4V0ME 4PM4A 1WQ1R 1O97D 3EA0A 3G0OA 1IJFA 1GZSA 2C3UA 1EVIA 2O23A 1N9ZA 1XXLA 4BVFA 4IF4A 4HDOB 4D99A 1RWMA 1XNHA 2QB5A 4GLJA 2XIQA 5CDHA 3U3XA 3RRFA 1VHTA 1Y33E 2I7DA 4UZSA 4Q4AB 3PPVA 5SZIA 5K45A 1L5WA 2VT2A 3UH0A 3LHKA 1ZPDA 3WRWA 4AS1A 1OBFO 3I9NA 1GAWA 1YO6A 3D6VA 5EIAA 1XNQB 1WPGA 4QPDA 5JPIA 3FXAA 3EPPA 1HE8B 3IHLA 2AE1A 3OWXA 3KD2A 5I7RA 1VQ1A 5BP7A 3IAS1 4PR3A 2ZREA 1NWHA 5KQGA 4XPIB 1AD2A 2DG2A 1VC2A 3KXDA 4R2HA 1W59A 4ZVOA 3K9HA 1Q1GA 1Y5IA 2ONYA 3BORA 1B73A 2GEUA 2ZDQA 1KO4A 3IBGA 3QW4B 4Q3AA 1OH8A 1TAHA 3WB2A 4L15A 3OHMA 3O8QA 4WOPA 3GRFA 2H85A 4RFVA 1MG5A 2X3UA 2QD5A 1YB1A 2IBTA 1BQ3A 3H2KA 3OTWA 1OQAA 2DF8A 4EG7A 2E2WA 4D8VA 2OGZA 1Z34A 2AFHA 2ZSFA 3EH1A 3OPQA 1PJ3A 3DW1X 4OJNA 2P5UA 2C7RA 1Y63A 4CGYA 5CPFA 2JI4A 3KFXA 4ZODA 4G24A 4PPGA 4RW0A 1Z2PX 4R71A 3AF1A 3OZRA 5BXYA 3TGLA 3QF4B 1NFQA 1EXDA 1WMAA 2YC2C 2VF4X 4F1JA 3USZA 3KZVA 1CQJB 2ERXA 2E21A 2N47A 4MKHA 2ODQA 4OUDA 3UUWA 1JJIA 3KQHA 5LZ2A 1RBMA 3NATA 4ZHQB 1W44A 3IMEA 1PR9A 2ZROA 3HBNA 3N8GA 4QG3A 1WPXA 1LVGA 4URUR 5H8WA 5HJ7A 3HWSA 2Y1XA 1G7TA 2XNDD 3EPAB 3NC1C 4JQOA 4QOGA 4B82A 4C9BA 5J47A 3EGDA 1FJHA 4KI0A 3W9YA 3JWIA 3NYWA 2JJ2D 2Q0QA 3LZCA 4RTMA 3H05A 2WP0A 4X3CA 1X7XB 2WFMA 1V4VA 2NQ8A 5BR4A 1MV5A 2EL7A 2ZVJA 4WFJA 1SQGA 4P4NA 4CT5A 4R8MA 3EJ6A 1QRSA 2PKYX 3F8WA 1ONPA 2FG5A 2NU6B 3BSYA 4LMBA 1JMKC 4LYEA 4TROA 3W3ZB 4JI1B 3QXGA 5HA5A 4O59O 3VH2A 2RAVA 1N6KA 5CBPA 2IXGA 2JGAA 5JZMA 2X8AA 2VTBB 3GT7A 2ZWOA 1VG8A 4DPLA 1R50A 4EX6A 2E87A 4YJDA 3HO6A 4NP6A 5DP1A 4IAOA 2IYQA 5D85A 1E4OA 3WMGA 3QLJA 4FFVA 2RAFA 2AI1A 3OJFA 5KREA 3GIWA 2X8JA 1KVUA 2MWMA 1QHIA 1XTKA 2ZKIA 2DCUA 3RSFA 4QODA 1XKLA 3AR4A 3ES9A 3CR7A 4KSYA 4RMIA 3HLTA 1JQLB 4RXUA 3Q4GA 3RK4A 4WLEA 1V7PC 1PR6A 1R6DA 4OXXA 1TCBA 4ESVA 1RQ2A 4WKCA 5HBRA 2CHGA 3GF4A 1V39A 3KUCA 1UMKA 3RVQA 4NXMB 3KQQA 1V1MA 4LSZA 1MO2A 3LRTA 2NSYA 3UMFA 4B3DA 3CVWA 3K0EA 1ZA1A 3D3EA 2QXTA 4KZKA 2FZGA 3D8HA 4P4TA 4U9HS 2P4UA 1U9YA 4IIBA 3PXUA 5JFOA 5MFPA 4TKUA 2XYVA 1A5ZA 3QVJA 1TYBE 1E63A 1JXQA 4H15A 4HVTA 4Z99A 4D98A 3QNMA 3ZCUA 4DUGD 1NC1A 2AQIA 2X14A 4P34A 1IBKB 3AF3A 3H9JA 4X93A 5LOVA 4MB0A 1ISHA 1VYVA 1QS0B 2RK3A 4OTZA 3PGMA 4D3XA 1AQNA 1VGRA 4AIIA 3DZ7B 2ZS9A 1R15A 1P45A 1UFVA 3U7QB 1ILWA 1BZYA 4YXWA 1VL2A 2ODEA 2JAQA 4Z1MD 1VHDA 1WS6A 2FPUA 1SPBS 5CT9A 4R9RA 1HBJA 1JSLA 1RYHA 3OH8A 3AFHA 3CEMA 1A9QA 1R64A 3OE7D 4HHEA 4DIFA 4DG9A 2HA2A 1I30A 4C88A 4ITUA 4ZEXA 1QKJA 4H31A 3KO8A 1N7HA 4Y2XA 3EC2A 3MTJA 1MABA 2CVPA 3LA8A 3X0DA 4OYRA 4YRFA 5HMMA 1FU4A 1G6Q1 3IMFA 3GJTA 2JRLA 1Z0DA 1CVRA 3L4SO 4ZVNA 3TQRA 1MHTA 1R8QA 2PY6A 4G0OA 2QGNA 2J7PD 4OHBA 3J81A 1TT5A 3CXUA 1F4VA 2JIPA 4E46A 4EO9A 3MERA 4EKNB 5BNFA 1XQYA 4I7EA 1ZM3A 4J0EA 2CLKB 4G65A 2AVNA 1DFGA 4JYAB 5IWCA 4GPAA 1L7VC 2DHDA 4OQLA 4DANA 4CEIB 4D4IA 1I2MA 1ZO8A 4MQFB 4IXTA 4HDSB 3FNEA 3VBEA 5GP1A 1XKTA 5BNIA 2CJWB 3MTGA 4QAQA 3G6KA 1NW6A 2CLSA 4CMGA 4E5UA 4E5MA 1KPGA 3TG2A 1NQOA 4IWNA 2GN8A 4MGHA 1UC8A 2OOKA 2CFIA 4ZU3A 5E3JA 2CN1A 3DUWA 4HH1A 1TQ6A 2XYGA 4BNYA 2GYUA 1BEZA 2FWBA 4PPNA 4PYQA 3KJEA 1A98A 2JFBA 3ABOB 3PDUA 4BNGA 4TWJA 3HDGA 3A28A 1GG5A 1HURA 4BKUA 1HKUA 4ZJYA 1EFPA 3HXOA 2BFCB 1QDLB 3MMSA 5K8VA 1U1FA 3DC2A 1XLTC 1OIXA 3KXIA 3O21A 3QI7A 3ZDEA 5E8RA 3ZCTA 4YLYA 2ODPA 4GWGA 2WD8A 2WM9B 3IBYA 2VA9A 2VJPA 2WNIA 4BDSA 3PSHA 3H5OA 3G1WA 3KVOA 2IXEA 3DOCA 1VE6A 1P5RA 1XJQA 1J39A 2DBQA 3DBRB 5TQJA 4C04A 1O94A 4YCLA 2YNMD 3VPHA 3O3OB 3W9UA 1U2PA 4WI1A 1N77A 1XEWY 4YAWA 4OXQA 2UAGA 2ZUDA 2E1PA 1B1CA 1JECA 2XHEA 2Z1NA 4U8HA 1ZUIA 4ZU6X 2ZT7A 2FW7A 3LLSA 3N8KA 3NWPA 2B61A 3HFRA 5I8WA 1LZKA 4CCYB 4V39A 1DAEA 3DKIA 4WN9A 5FTMA 1F6WA 4CNBA 2WJ4A 1Z75A 2P30A 4MCJA 2BDUA 3AR6A 2HRDA 4OYLA 2PLFA 5TT0A 2O1SA 3UXYA 4JOQA 1QMIA 3C7AA 5JPDA 1I9CA 2C96A 2RH5A 1DAMA 4KSBA 3ZV3A 4DDVA 1N92A 1UBUS 4PFQA 3SR0A 4Z4HA 1R6UA 4DM4A 3KQMA 4M7PA 1QO0A 1U8UA 1JLMA 4E2XA 4IJ6A 1O0CA 4JV5B 1PHPA 4UARA 1QMHA 3F4LA 1QIHA 2UVPB 3IUEA 3JQFA 3T4PA 3PCRB 2C00A 4LCJA 1MZVA 1W6UA 3NXSA 2GYWA 3D0OA 1NVFA 2QAGB 3ZD8A 5KTNA 5TJHA 2YMPA 3P19A 1DRVA 2GK3A 5FLKA 2XCSB 1MVOA 3M1LA 2GHIA 3D4LA 4F86A 4KZPA 5T41A 4EJ6A 1C2TA 2FSFA 2VBIA 1E5QA 4FGWA 3TW0A 4NEGA 1NKSA 2JLXA 1N3LA 5H4GA 3CPEA 4PANA 1YFLA 2CZCA 4Z9YA 4LDJA 3TXXA 5I4CA 1U9IC 3QE2A 4IHJB 2J59A 2OHXA 1ZK4A 3PNQA 4YJ2A 1VP9A 4RKYA 1J56A 4CIYA 4HYEA 4CKZA 1WF6A 1TUGA 2C7VA 4DCTA 1EYZA 1CHDA 4ND8B 4L7QA 3MOSA 3QY9A 3RUFA 4R7ZA 5AJWA 3DGFC 1XNRB 1RZUA 4P84A 3ZE2B 1R16A 1KYQA 5H0IA 1DQNA 2Z08A 3BRWA 2G9QA 2GDJA 4AY5A 2QEQA 2WJVA 4DG5A 2RHWA 5JZOA 3P2OA 1N7GA 2EKLA 4KPGA 2ROQA 4R40A 1BXGA 2C5AA 1I3KA 4M7OA 3CRZA 4N54A 1AUVA 3UTDA 3OCUA 1BRMA 2HCJB 4H1WA 3ORQA 1SBCA 2DBZA 2BKVA 3O8QB 4RTLA 4HMQA 1YKSA 4A4DA 5AMXA 4WNCA 2BGTA 3BH6A 1I6MA 1GAQA 2AKAB 3EXFA 4LMPA 4HGQA 4TLCA 4JSTA 5DYGA 5CGQB 3K6SA 5K4HA 3N75A 5ES3A 4JI2B 1CEQA 1HT1E 2BGNA 2HSGA 3B1YA 3IAAA 2YZMA 2ZRMA 2R97A 2A8YA 5FNVA 4REQA 1WHSA 1L5HA 1ZSVA 3EP4B 3G2MA 3ZVKA 2DKFA 4H7FA 2CLLB 3KOWA 1N5JA 1X94A 1C81A 4KRXA 2G1PA 3ZWCA 1A4RA 3R7AA 1V5FA 3SEZA 4PXSA 3KYJB 2H29A 3DZGA 3OFKA 3FYSA 4RJTA 1GUYA 1YJXA 4BJ5A 1IY0A 3M89A 2ODNA 4NEHB 1HO3A 3P0JA 3UC5A 3VGJA 2OB1A 4G1CA 1KE1A 1R27A 2ZBVA 4RABA 1EVLA 4PW0A 3SKYA 4IJKA 5KC8A 1R9JA 4F3TA 3DXFA 3R3ZA 2GHTA 4HDQB 1XD9A 1BEUB 3T7TA 2NO6A 4DC1A 4ZOAA 3IUJA 4HWOA 2IY9A 3WLJA 4CIWA 1OBVA 2FWIA 3AEYA 3JQ8B 1I7NA 1QIDA 1IZ7A 8AT1A 4LZLA 4WK2B 2P9JA 3VXKA 3WK8A 4BP1A 3ER8A 2ZBQA 2DHCA 1JHOA 2RHOA 3C1AA 3HMKA 2UYQA 1SXJD 1H5NA 3GCGA 2PZEA 2KB0A 3SEAA 5HCIA 3ZLUA 3E2MA 4GPD1 1X7GA 2P0YA 3DZ5B 4RPCA 3S40A 3L1HA 2DETA 5I5GA 1T9KA 1W9MA 2GN4A 2XZTA 4TTAA 3O9VA 4QNNA 3C3AA 1L4FA 1ZU4A 1S3FA 4L76A 4F6CA 1VIDA 3FOCA 4M2LA 4ZHQA 1PDVA 4CU5A 4FFLA 2XT9A 3DAGA 5IC6A 3Q98A 2WM3A 5BRAA 3GNQA 2DX7A 5CAEA 4XYBA 3VC7A 1UWVA 1FU8A 4RYLA 3ST7A 4NYMQ 3OLVA 1SD1A 2WU0A 1GQFA 5DSZA 3P96A 4JC8A 5C7LO 1WW2A 1Y1KE 3ONDA 4ALMA 3O8DA 4OFXA 3SHFA 4JQCA 2FEKA 4CL0A 1KJZA 4GD3Q 2OHGA 1BDIA 2PX5A 1WBJB 3G49A 4YP0A 5LWHA 2JB9A 2JKZA 3WKEA 5B6IA 4FUQA 1T3LA 2GNAA 1EP3B 3F96A 1M0WA 3KUUA 1NP6A 3PJEA 1UAAA 4QBKA 1K8RA 3S2IA 1EZ4A 2J9ZB 4WTOA 2F1JA 1H8ED 1F1JA 2WKPA 3UEOA 4XSHA 3QMVA 2BF4A 2LP4Y 5FWXB 1S3SA 5DHSA 2LE0A 1KAQA 4FGUA 3FVRA 3RYTC 4YYZA 1YHZA 1VGQA 4XDYA 1P0PA 3Q9NA 4K6OA 1XTBA 3DL7A 4DR4B 4CFSA 2Q4EA 2BP7B 4JBWA 1Z0KA 4P08A 3W5VA 4HT3B 5FQOA 5DYTA 1ACLA 2PNJA 1T25A 4D25A 1F2TB 1U2DC 2YY5A 4WXRA 1SU8A 1XKQA 5G0UA 4PAGA 2WYVA 5DRYA 5H59A 2WJAA 4N5DA 3LUCA 4EW6A 1HNNA 1T0PA 4ETNA 2KHZA 2RBEA 3A2LA 1GPUA 2BMJA 1VBKA 2R6JA 4GVXA 4W5QA 3ACDA 1Q74A 3CLTD 1ZGCA 1BYIA 4HYYA 1ETUA 2P69A 1IJBA 2PA0A 4GBED 1Y9ZA 1HZZA 4M1QA 1HT0A 3R0JA 4REMA 4G67A 3QNWA 2C3PA 1SZDA 2BGIA 3JCZA 2NXEA 4IEIA 5EL0A 3DFZA 2EJWA 2IU3A 1DPFA 1BX3A 3DE7X 4LA4A 1CJVC 2HQ1A 4AM8A 4N82A 5ALXA 4JVOA 1P1CA 4G0PA 3S2UA 5GM2A 2Z58A 3E2PA 1JENB 3PC7A 4OQPA 4S1WA 1YVUA 3O73A 1B6SA 1X14A 4PO3X 3ZWKA 3I92A 2EW1A 4M1SA 3GB9A 4B34A 5A2GA 3HI6A 1B8PA 4G07A 2WKWA 1WU7A 4PZCA 2BHNA 1JB9A 2Q5EA 3RVPA 2IE8A 1HK7A 3WL8A 1N2SA 2CFTA 1OX6A 2PT7A 4FXPA 5DMHA 2B2CA 5CT6A 1J49A 1B8NA 2WT8A 3LBHA 5DM70 1KI2A 1FQOA 4HWGA 4RY8A 4W9RA 4WINA 4B44A 1K27A 3HUFA 4DM7A 4TXJA 2YTZA 2EBFX 5CM9C 3A4MA 3EOBI 3HYRA 3BCSA 1VIVA 3UAVA 1R8JA 3INTA 2BWJA 1M1NB 1QB7A 1VA4A 1XDSA 2GSDA 3PR1A 1LBTA 4QTZA 3QEOA 4OB6A 2N1BA 1AIPA 2WHQA 5HS6A 3GLFB 1KZ1A 4P3XA 4RPKA 3S0JA 1XTJA 4QPZA 5J5VA 1BGVA 2YJ4A 4ENSA 2V6BA 2QI9F 2YMLA 4YPFA 2XMPA 4K05A 2Q5HA 5TE9A 1L8XA 1Q84A 4ZDIA 3A25A 3UOGA 4XWKA 5F9FA 3HKEA 1YAJA 4PHFA 1S6YA 1KVTA 3UW1A 2D1RA 1RLIA 1BMTA 3NH6A 2O14A 3G5TA 3L8ZA 1JTEA 5AHKA 2OYRA 4ZEVA 1EWTA 1JEOA 2GM9A 1DRWA 2FFQA 2PNFA 1G7CA 2QUZA 3THWB 4LRWA 1B4DA 2AFHE 5JBIA 4FWTA 3OJWA 1M72A 1P2BA 2B35A 5AXDA 1D07A 2XCQA 2GNPA 4PZPA 1H1TA 1XD2A 1EJ2A 2W6ID 3KLOA 4AUEA 4OHFA 2UUPA 1Z88A 4IW3B 4A23A 1H1LB 5BYKA 1NDQA 5EHNA 4DLSA 1OLUA 3LW8A 3Q72A 4XVRA 4TRNA 1JDNA 4UCQA 5FPSA 1W48A 2CLFB 4OI4A 1D6JA 4YAKA 2B2XA 2J30A 2LNDA 2XJ4A 3KELA 3QF4A 1Y82A 1Z4IA 3FPHA 4LJKA 3NWBA 4YRCA 3EF0A 4JHXA 3AVXA 2NPIA 1USIA 2H4HA 3HPRA 1MJ5A 2JZCA 4WCDA 4KHZA 1ND6A 2W2LA 5FOWA 1Z74A 2PFSA 1IOLA 1FNNA 2R6AA 4NZZA 1JQJC 4H1TA 2CMFA 4A2WA 1UMBB 1SCKA 3LU1A 4UMDA 3RU9A 4JDUA 2YV1A 4PAMA 1KOLA 2OZVA 3H4TA 2H7VA 2J0UA 3GCDA 1QFMA 1QX3A 2JLBA 2ZT8A 1M2VA 3L1JA 1A27A 3AZOA 5D86A 4KODA 4HY3A 1I0ZA 5JAOA 1Q7BA 1HH4A 3NRCA 5BUQA 5IAOA 4ARBA 4J0DA 1NF9A 1SCAA 1MA3A 2XODA 2ZYVX 3FM9A 1LX7A 1IUKA 1P7YA 3FSGA 4WN3A 1DQYA 1GNTA 3LK7A 3TL6A 1QIEA 3ORFA 2CT8A 1XVLA 2XUZA 2RBKA 4JP1A 1RM0A 4FOTA 4JX8A 3ROKA 4K81B 4XASA 4MUHA 3T3EA 3TXAA 4Z1OA 1XLUA 2PX3A 5KYGA 3TTVA 2QAIA 3IT0A 1KAMA 5JQGB 5KYUB 2FP4A 5ALPA 2FW6A 3JYNA 4V0QA 1WXGA 5HKOA 4KLNA 4KFTA 3KJQA 1NW9B 1UMBA 2CLIB 3FLMA 1EZ1A 2ANBA 5HFAA 3GN1A 4CWAA 5J1SB 2XECA 1RI3A 1DX6A 3CONA 3L93A 2C1EA 4IIDA 3ZLBA 3X1DA 2WAAA 1CJMA 2D1FA 3K2EA 3TECE 4G5GA 2GERA 2C4VA 5BW4A 3ZHOA 3CSDA 1GPMA 4OHVA 1P9WA 4OSOA 1MUUA 5IM4F 4DHEA 2FFRA 3AOGA 3NOXA 1PFVA 2FF5A 2RK6A 3BKWA 3M8KA 3PXXA 5BN4B 3URMA 5FRDA 4ES6A 4YRZA 2RHBA 5T6MA 4X41A 3LX6A 2CF6A 5DBHX 1FDOA 2GOYA 2AEJA 2EGUA 2RKWA 4Y18A 1YD7A 2PO7A 1NVBA 3FKSD 4GC9A 5ERYA 1E2BA 1UANA 3TVYA 5L7YA 3O1JC 3LWZA 3I01A 1SHUX 2GBGA 3QIAA 2CNOA 2DJIA 4F3YA 1XCBA 3AILA 2ZJAA 3KU1A 1L7MA 2WWTA 3ILHA 4LOLA 4MW6A 4WIAA 1DI0A 3CZ9A 2IYPA 3ZV5A 4BQRA 4CMAA 1G20A 1X19A 4RVDA 4U2GA 1LVHA 4D9NA 1SVNA 3AETB 5JZVA 1H5UA 1B8OA 3GHYA 3IALA 5DNAA 4ZV7A 2HNKA 4MHOA 2G70A 3PVCA 3ZHSA 2CXOA 1ML4A 3ETLA 3KYBA 3AEUB 3KKZA 4G36A 4HS9A 4XEUA 4KV7A 5IKOA 2DWUA 1JG4A 4JC4A 4BB5A 4HPJB 1R8YA 3O8NA 2H2HA 2XE6A 4BX9A 1TT7A 1XTPA 1I72B 4C4RA 4ARVA 1KQOA 5C18A 3OKPA 1C3VA 2VKQA 1SUFA 4Q48A 1A3CA 1MLDA 1NQTA 4I6GA 4MULA 4Y6QA 3CQ9A 3CR8A 2JIQA 1BROA 4DT1A 5L95A 4RCYA 3PGLA 3TZ6A 4S12A 3PFKA 2NTYC 1OJ7A 1Q1NA 2YWRA 4P31A 4N0QA 2Z57A 1P80A 5TJ9A 1U7OA 5A4FS 1SCUA 3B1KA 1MRSA 2FEXA 2HK7A 3IRVA 2AXNA 4NOKA 4ZOEA 3NOOA 4FFRA 4G5FA 4NBTA 4O08A 4ZDJA 3KQLA 3PEYA 1FRNA 1QZZA 3HFJA 4B7XA 1U7XA 2LV8A 4BGIA 7ADHA 2FX5A 4L8YA 1QGAA 4XRGA 1M2VB 2ZUEA 3PR3A 3DL4A 3KEFA 2DHQA 2YKGA 1G59A 5FI5A 1IRIA 1NQ5A 3AR5A 2VK1A 5K3BA 4JLBA 4KXFB 2JIZA 4F9TA 1JDBC 3G9QA 1G9TA 1U7HA 4UFOA 1D6NA 4YTEA 5G3YA 2FUEA 4KH1A 4NBKA 1XNJA 3ANSA 1U1CA 4JLJA 5M34A 3OPXA 3SC3A 4C76A 1Z5OA 4PRLA 3RHFA 4I5EA 4L22A 2AQ8A 3I2GA 3NTVA 1C0PA 2A5GA 5BSMA 3OZFA 4C4ZA 1JUDA 2RCNA 3N53A 1IWPB 5CVJA 3WMRA 4D0NA 5D7NA 4B3BA 2OXEA 3T5AA 2J46A 3BH7A 4WL0A 1DUSA 1MF7A 3PEVA 3VI3B 1RHKA 5EUBA 4JUDX 3SNKA 4N5NA 4ZMSA 1J5PA 3JARA 2VJNA 2X23A 3LUPA 1TM1E 4Q4HA 5FO0A 3ZZTA 1VYTA 2WUDA 4DTIA 4P4SB 4E6PA 5AM3A 3UJNA 2JLYA 4OBBA 3LX4A 4U00A 3CG0A 3LFUA 3H1GA 3O92A 3P2JA 3SE7A 3DJFA 2EG9A 3BMOA 1FPQA 5C80A 3TCNA 1XDDA 2IXAA 2CNNA 4KTTE 1N8NA 5D84A 5KDLA 4ZCTA 3EWAA 2IZ6A 3FVVA 4MHSA 5FF9A 4URVR 1AKMA 2M9MA 3QX8A 4ID3A 1DX9A 2MOKA 2NUPB 2R1UA 3L04A 4IV0A 1PS8A 1Z7BA 4NAUA 3PIDA 4EGJA 5C7IO 1OFHA 3QXXA 2V55B 2K7ZA 1IHOA 2J9GA 2XRYA 3BBPA 2J5KA 5BYBA 3RUAA 4EK9A 1O6BA 1ZH4A 3EJWA 2BSQA 1XL1A 3HZOA 3IUYA 3MCZA 1ESCA 4JL5A 3C4VA 4NHOA 4EHBA 2FN9A 5C1BA 1R1DA 2HREA 4TMVA 1NJ5A 5B7QA 3LCMA 2VXCA 1COWA 3ZR4B 2Q3LA 3UWMA 4ZMRA 3GGGA 1HA3A 4IICA 4X60A 1FRZA 2QTTA 3B3FA 1PSZA 1RABA 2MT9A 5HJEA 2V5UA 4G4IA 1EK0A 1IZ9A 4YXFA 2HWWA 4NDZA 1FTYA 2O0KA 4Z2AA 2TSYB 1FYWA 3N3BC 2ZPUA 2QXUA 1W0KD 3Q6NA 2Q2OA 4FN5A 3KTOA 4UU7A 3L0SA 1M2HA 4LCEA 4WESA 4WN9B 1E6CA 1NJGA 4AX8A 2OPHA 5T6BA 1MOZA 1Z7WA 2QJOA 4Y2VA 2WWIA 3NT4A 3ZXUB 2RGYA 4NJEB 1EM8B 3UT0A 1JAXA 4L8VA 1QE3A 1YCHA 2PRJA 2QUKA 1L7BA 2Q7OE 1NBMA 2IYYA 1PG0A 1KPIA 5LUAA 1KK2A 2ANCA 1V16B 2B8WA 2W2QA 3B36A 3RDPA 1JJ7A 5BSGA 2FEPA 4O2AF 1NNI1 4QARA 1AZWA 2A14A 1HRDA 4G5OA 4IQFA 4AJHA 5B12A 2C2KA 1LQ2A 3RYFA 2VC2B 1PK9A 1B43A 2WTXA 2C77A 5HF9A 1L5NA 1Z62A 3PR2B 2NNWB 3BMQB 2BONA 3PEUA 1H69A 1RHRA 1RYBA 1EE2A 2RGXA 3BL8A 3JSAA 3HU1A 4GKAA 4IH4A 3FWKA 4KQFA 2F3UA 4M37A 4RJJA 4Y1RB 5TQ2B 4NMLA 1BD4A 1Q21A 1M8PA 1O08A 5DIZA 3D0KA 5DGDA 1ST2A 4TLMB 4EAQA 1L4LA 1NRWA 3R3UA 3VGPA 3WA7A 3LXUX 1HQYE 3GIDA 1CQIB 3PFCA 3IB3A 2VK2A 2QYSA 3O84A 2BBOA 1ZNZA 3D6UA 2EP5A 2JFHA 4FOSA 5TGTA 1OILA 3TN7A 3ZNOA 2V96A 4A2PA 5EQFA 2NZYA 3EEQA 2WWGA 3L7IA 4MJ3A 5KCMA 2JZOA 4D9KA 1RHUA 3D3KA 4L4XA 3UWSA 1A7AA 5CXQA 2FTKE 2ZB8A 2J0QA 1QC5B 5IVHA 3TZKA 3H4IA 3NEPX 4QXAA 5HDBB 3PYLA 1TDJA 3MTIA 2QTFA 3OQNA 1FUKA 5JYBA 4UE6A 4F5WA 3ZNNA 2GD6A 3WXBA 3E5NA 2JLSA 2ZAIA 4HDMB 1C5KA 4DV7B 4HQRA 5K0CA 2NTJA 1W4CA 2HJVA 3FFXA 4B7ZA 5DNUA 5LNK1 3RADC 3TR6A 1FLNA 4EI8A 3OUUA 1F14A 2Y9MB 1QGZA 3T7CA 2IYXA 1UBTS 3BK2A 4FNOA 5F64A 3QVWA 3FFTA 1XQ9A 3G8DA 5HF6A 2PGJA 2YVLA 4R3WA 1RTTA 1JWBB 3RSZA 2GF0A 1T6ZA 4CM8B 2GZ1A 4DW8A 1ZFNA 2IXBA 5CVCA 1OV4A 1T8YA 3MWJA 4RGYA 3MOIA 4AROA 1NW8A 3CVYA 1ZJ6A 1RNLA 1PU2A 1XPRA 3PQCA 4C4YA 2O8VA 3QSGA 2XMRA 3QTLA 5KYWB 1DTWB 1EQAA 1RWKA 3TSOA 1TD9A 4OQQA 1L5YA 4GYWA 1E7RA 2JCSA 3AFMA 1DDIA 3V32A 1AZSC 3L5KA 3AONB 4DQKA 1MC5A 1L4HA 1AUOA 3NBFA 4CM7A 2BMEA 5JATA 1GV0A 3WHPA 1XPUA 2J3QA 2A0XA 2I2XB 3LF2A 4MJXA 3D4IA 4AY6A 2OL4A 1G7SA 2QP9X 4KH0A 4F5DA 5C8YA 2P2CA 6REQB 3NHRA 1RBQA 3KYDB 2Z6VA 4LZNA 3VPGA 5K7SA 1K3UB 4AW9A 4DG8A 3L7YA 1NJFA 4PONA 4BX2A 2CYBA 2NM0A 2JARA 1Q11A 2XQKA 3AYXB 3H1TA 2XDWA 2AHOA 3GGOA 5T57A 1L3BA 1MP0A 3SPXA 3WK6A 1RACA 1CFZA 1SU4A 4EY8A 1CYDA 2NSHA 3DDWA 1JG2A 1GEGA 2YJTD 2GPYA 4MIYA 3P9PA 4I6JA 5K0GA 1M5RA 1A7UA 2VRCA 2ZIZA 4UDNA 1PEDA 5D5PA 2BFPA 1CETA 1V7ZA 3U7IA 5M5BA 4KLRA 4DR3B 5B58T 3OEWA 3UQZA 3K9CA 2OD2A 2VLIA 1F17A 3K9NA 1C7EA 2PBRA 3NRBA 3FCXA 1EE9A 4IQ8A 4YLGA 2RFLA 2OQIA 4J16C 3NJ8A 5ALJA 1PFGA 4CIAA 4BVLA 3UFXA 4KWIA 3ZDFA 4Z4QA 2ZTUA 1SM4A 4QLAA 4JLPA 2D1TA 1MV8A 5KTYA 1T4MA 4Q05A 3IP8A 4MR8A 4Z4FA 3TLGB 2OFWA 1YQQA 4BAGA 3E0QA 1OSNA 2NVOA 5JVDB 2HRZA 2IPMA 1KOFA 3IQZA 4M9CA 4U5XA 1LDGA 5HIIA 4F84A 1W0JD 1USVA 1ZM7A 1WHSB 1F3OA 3A4VA 3NKLA 1CUAA 3PUWA 2VHZA 4IX9A 1QSGA 4OYHA 1A2BA 3PGKA 2F8SA 1K5PA 4HQ6A 5DJ5A 3HG7A 2JLAA 1UJ5A 2Q99A 3IOCA 4HR7A 2C95A 2G9NA 3KHTA 1RJFA 3M5WA 3DNMA 3OQOA 2W71A 3PQ7A 1LBQA 5ITWA 3PK0A 4TYYA 1ENPA 2PXHA 7MHTA 1JBKA 1T3GA 2A7XA 3FSRA 1FFEA 1OWPA 5EFOA 4BIIA 1M76A 1X1DA 2VQSA 2PXAA 3UV7A 5HQ3B 3ISVA 4GHWA 4N9QA 2GBCA 3LC1O 1OU0A 4B8YA 1FZTA 3NRJA 3BKXA 2E4ZA 4MYTA 4N3BA 5JEDA 3PL1A 3FDJA 2Q1UA 4QOHA 2ZB3A 4DVGA 3EOZA 5K8TA 3C5CA 3FNQA 1MH1A 2PRIA 3MT0A 2RI6A 3UWDA 4OLHA 2BJWA 4IIFA 4LHYA 3K05A 5AKXA 4DLPA 1UBKS 2GJAA 2X3YA 1PZXA 3DZ8A 1KVSA 4PNPA 2BEWB 2AOUB 3L2OB 5DASA 1M83A 2EGHA 4JVSB 1NMZA 2CMDA 4EPWA 5A02A 5JIBA 4G8DA 4UBLA 2D8AA 3BEOA 4B17A 3EASA 2I2AA 4EUKA 5IAGA 1E3DA 5E6RA 4GDFA 5C5DA 3QYFA 4L0CA 4R4JA 2DPHA 3ZE0B 1QAOA 4C6SA 2OBNA 4Y9DA 3NWJA 3L92A 1UT6A 4J0KA 5KOHA 4HB3A 5H68A 1ZJ4A 1DVRA 1HWYA 3AVPA 3SXJA 3TPFA 5JSZB 3F6EX 2PUWA 2HA3A 3OCYA 3U9LA 1N57A 4G0YA 1Y80A 3HSYA 3KC2A 4IKOA 4EJSA 5CFLA 5IUJC 3U5ZB 1TMYA 1Z0JA 2OK7A 3QOXA 2ID9A 4Y1RA 4ZT2A 2H8KA 5E7QA 2ZSUA 2OQVA 1M2EA 2YBDA 4ONEA 3ER9A 1X38A 2VCEA 2VH1A 3A9VA 4UQPA 3BCHA 3I37X 3T7JA 4ZZIA 4X1IB 4W6ZA 5CXUA 1Y7HA 4S05A 1JDUA 4RVSA 1GGVA 3PHBE 2FWRA 1GFWA 4GPBA 2REQB 4I2NA 3NHWA 5EAIA 4ETMA 4X95A 2BI4A 3MRXA 2IHNA 5CVUA 4PZYA 4DQLA 3AR8A 2BIFA 2ETXA 1TTPB 5LYJA 1BWRA 2ASEA 5FBVB 1NN0A 2I55A 3W6ZA 1DTEA 4TMTA 4DY6A 2H00A 1XLTA 4JK3A 2VJLA 4C7OB 4MVJM 3SI7A 1B42A 1USUA 1AGRA 4DLNA 1E2EA 2FPIB 2HQRA 2L69A 3BC1A 3UMBA 3A31A 1UINA 1MB2A 2Y27A 1M10A 3E1KA 3HP7A 4O1IA 1TTTA 3JQEA 2BKUA 1E0SA 1GTJ1 4Q3CA 4C29A 3CVUA 1I10A 2HF8A 4QBIA 3REFA 5C1DA 3RYHA 5F12A 3T54A 1NU6A 1NF3A 1HRKA 4EWLA 1NUSA 2HU2A 3GBSA 1ODFA 2NU6A 5ISMA 5KYXB 1J99A 4A26A 3RTAA 1YVPA 3G2IA 1V5EA 1A1SA 1YZKA 3EDOA 5B3AA 1CB0A 5IVIA 3OE1A 1P72A 3QVLA 4OLJA 2XRMA 3SLRA 4FD2A 2B2NA 1ST3A 2IYUA 3MGKA 2HWUA 4JVMA 4BTEA 3WAGA 1U7TA 3OZIA 1Q7GA 1CIPA 2XE8A 4RK7A 4ZOQI 1G5HA 2A35A 4AZ0A 1MHMB 2GD2A 4UMVA 3RWBA 4HNAA 4ZCMA 3KXPA 4YMLA 2XUQA 2FW8A 4JT4A 4RE5A 2YIJA 2RAUA 3ESZA 3QXHA 3RKSA 3ZWVA 4DEYA 3FLAA 2I8CA 4H59A 3IPLA 2VJMA 4LY3A 2WKSA 3W3AA 4NSNA 5HIAA 1LBIA 1CE8B 2AJCA 1NBEA 1Y9JA 1HT2E 2WJ6A 4LOJA 2IUUA 3WBJA 4CM6A 2QRLA 2OC9A 1ZEMA 3FGNA 3N8HA 2RGGA 3PHHA 4NPHA 1F1BA 4RCVA 4IV8A 2VHQA 2VQFB 1Z18A 3HXKA 4FLFA 2R7KA 3MW8A 3LPCA 1Q0UA