5BNXA

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.3-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
TELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.3
total genus 26
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnxA00
3AN2C 3X1SB 1AOIC 4R8PC 3AZEA 4G91B 3LELD 4JJNC 3AFAC 5CPJB 4H9PA 1EQZC 1KX5B 3B6FB 4Z5TC 3WA9B 5B31A 2NZDA 1KX5D 5B33C 3UT9C 4G92C 5B31D 3AZEC 3LELB 2PYOB 1U35C 1P3FA 1S32C 5AV8A 3B6GA 2JSSA 1M19B 3AZMB 4CSRB 3MNND 5B1LA 3MGSA 3C1BD 1P34C 4J8VC 1P3LC 3WKJB 4H9QB 3AZEB 3A6ND 3UT9B 4YS3D 3AZFC 3UTBB 3VH5T 4Z2MH 3W96C 2HIOA 1JFIB 3X1VB 1M1AB 3AZJA 1M18C 4AWLB 3UTBD 3C1CD 3UTAD 4J8WC 4J8XA 2FJ7D 3NQUA 3W99D 4KGCC 3W96A 4Z66C 3MVDA 3B0DC 3AZNC 4LD9C 5B40C 5GT0B 1TAFB 1TZYC 3MGRC 3AZHB 5B0YA 1EQZD 4WU9A 5JRGB 3LZ0D 4J8VB 2HIOB 1JFIA 5B33D 1A7WA 3AZED 2BYMA 3AZJB 3C1BB 2BYKB 1U35D 3B6FC 5AVBC 3AZHC 3NQUB 3REJD 4G92B 5CP6B 3MNNC 3TU4B 2PYOC 4X23A 3LELC 4JJND 4KHAB 5B31B 4HGAC 5AV9B 3KWQB 1P3IB 1ID3B 1KX5C 5CP6C 5CPJD 4H9SA 2BYMB 3LZ1C 3AN2B 3UTBC 3NQJA 3KUYC 2LY8A 3LZ0B 1KX3D 5CP6A 2CWEA 3C1BC 1P34D 1P3LD 5B40D 3LZ1A 2CV5A 3AV1D 1P3MD 3UTBA 4YS3C 4YM6B 3VH5W 1U35A 1AOIA 1H3OA 3LZ0C 3UTAB 5B40B 5AV5A 3RELD 4LD9B 3B6GD 4ZUXD 3WTPA 1TZYB 1M18D 3AZGA 3X1TB 4YS3A 5B33A 3NQJB 4J8UC 5C3IC 4UUZB 3W98C 4KUDC 4CAYA 3AZFB 5GT3A 1B67A 3AZGC 3MGRD 3AZJC 3KXBB 1P3FD 5DNNA 4J8VA 5GT0A 3AZMC 5AV6D 3MGRB 3W99A 2HUEC 3W97B 5GSUB 4Z66A 3MVDC 4LD9A 4QLCC 5B0YB 3REJB 3AZGB 5DNNC 5B2ID 5GT0C 2HIOD 2AROD 3KXBC 3MGPD 3X1VC 4QLCA 5GSUC 3REHC 1M1AC 3X1TD 4AWLC 1P3PB 5JRGD 5E5AD 3O62A 2F8NB 3MGRA 5B32B 3W99B 1R4VA 3X1VA 5GSUA 1M1AA 5AV8D 3AFAB 5CPJC 3REID 3REHB 5B32D 3O62C 5DNMD 5CPKC 1P3BB 3AZLC 1ZLAA 3B6FA 3AN2D 3AZHA 4H9SC 4WNNB 3AV1C 5CPKA 3X1SA 4WU8D 4EO5B 3AFAD 1P3BC 3X1UC 4X23C 5AY8A 3AZMD 3LZ1B 3VH6T 3WA9A 3MGQB 3KUYB 2YFWB 5B31C 1P3PD 4JJNB 1KX3A 4ZBJC 5AV6B 3AYWD 3KWQC 1P3IC 1P3BA 5B24D 2AROC 3KXBD 1P3FB 5AY8D 4X23B 5AV5C 1P3GC 4R8PD 1S32A 4J8VD 3REKC 3WTPC 3KWQA 1P3IA 3WKJA 4XUJC 4KHAA 4ZBJB 5FUGA 5AY8B 5AV6C 2CV5C 3R45A 5F99B 5AVBB 5CPIB 3W98A 4KUDA 2IO5B 3WTPE 2YFWA 3WAAD 1P3KB 3MVDB 2HIOC 4WU8B 3C1CC 3W99C 3RELA 4KGCD 4J8XB 1F66B 3O62B 3AV2C 1TZYD 5JRGC 1M18B 3VH6A 5GXQA 4J8UB 5BNVA 1KU5A 5B40A 5DNMB 4KGCB 4J8WB 3AZIC 2BYKA 1HQ3B 5G49A 5B32C 2F8NA 5GXQC 3WKJD 1P34B 1P3LB 3KWQD 1P3ID 4XZQA 1BH9A 3AZKB 3MNNB 3AZLD 5AVBD 2F8ND 5F99D 1M19A 3AZIA 2NQBA 3REJC 4XZQD 3KXBA 5B1LB 3MGSB 1P3GD 2YFVB 1KX4B 2PYOD 4WU8C 1HTAA 3LJAB 3AYWA 5GT3D 5B0ZA 5BNVB 4X23D 4H9OB 3AZKC 1M19C 1B6WA 3MGPB 3REJA 5C3IB 1P3GB 5B1LD 3MGSD 3W97A 3LJAD 4Z66B 3WAAC 1WWIA 3AYWC 3X1SC 3MGQA 4XUJB 4XZQB 3AZKA 3KUYD 3W97D 2RVQD 3AZHD 5AY8C 2CV5B 4NFTA 1BH8A 4Z5TB 3WA9C 3AZLA 4WU9D 3REKD 1HQ3D 5FUGB 5AV5B 1BFMA 3C1CB 5BNXB 1AOIB 2NQBD 3AZID 5B2JA 3UTAA 4J8XD 4E44A 4UUZA 3REKA 5GXQD 3X1UB 3WKJC 4XUJA 2L5AA 4YM6D 3X1TA 4YS3B 1P3MB 1KX3C 1P3AA 1P3KC 1BH8B 5BT1C 5KDMA 4H9RB 5GXQB 2AROA 4J8UA 3AV2D 1N1JA 5B2IA 5GT3C 5CPKB 3RELC 5B2JB 3TU4C 5AV6A 3UT9D 4ZUXC 1ZLAD 4G91C 5DNND 5B2IC 3AN2A 5BO0B 4R8PA 1S32D 4EO5C 4KUDD 5B0YD 1EQZA 1BH9B 5GSUD 3AYWB 5B32A 1S32B 3KSYA 5JA4B 1U35B 3AZKD 3REHA 3AZFD 4H9NB 3B0DB 5JRGA 3AZNB 3AV2A 2FJ7A 3LJAA 1P3OD 2NQBC 4H9PB 4QLCD 3V9RB 5AV8C 5CPIA 3W98B 3MGPA 3X1SD 5B1MA 4WU8A 5DNMC 5CPKD 5B0ZC 3RELB 4NE5A 2FJ7C 2F8NH 4DRBA 4ZUXB 5BT1D 1EQZB 4CAYB 3REHD 3AZFA 4LD9D 1P3AD 5AV8B 3A6NC 3WAAA 1F66A 5DNMA 5E5AC 3MGQC 3X1UD 3REIA 1KX3B 2FJ7B 5G49B 5BNXA 4J8XC 5B31G 3X1UA 4J8WA 5E5AA 3O62D 1HQ3A 1F66D 4YM6C 2NQBB 2HUEB 3REKB 3AZND 5AV9D 5AVCA 5B0YC 4QLCB 1ID3D 5AV5D 1P3OB 3B0CW 5B2IB 3R45B 1P3PA 2F8NK 3WTPD 5B1MD 3VH5A 4YM6A 4XUJD 1F1EA 4H9RA 1P3GA 2CV5D 1P3KA 1Q9CA 5AVCC 3TU4D 5CP6D 5AVBA 1ULYA 1P3PC 4KUDB 3WTPB 3LZ1D 4R8PB 5B24C 3B6FD 5B2JD 2PYOA 4CSRA 1ZLAB 5BS7A 3B6GB 5GT3B 5JA4A 4Z5TA 1P3AC 3C1CA 4WNNA 4WV4B 2NZDC 3AZLB 1P3MC 3MGQD 3UT9A 1KX4C 1P3OC 4E45A 3KUYA 5AV9A 1ID3A 3AV1B 3B6GC 4JJNA 1P3MA 1P3AB 5B0ZD 4ZUXA 3V9RA 4J8UD 2YFVA 1P34A 1P3LA 1KX4A 1TAFA 3W98D 5B0ZB 4HGAB 5AV9C 3AZIB 4H9OA 4XZQC 1ID3C 1N1JB 1AOID 3LZ0A 2AROB 5B1MC 3REIB 1P3FC 4Z5TD 3A6NB 4NE6A 5F99A 1M19D 3WAAB 4Z2MG 4WU9B 5B1LC 4NE3A 3MVDD 3MGSC 3LJAC 1H3OB 4WZSB 1F66C 2F8NG 5CPIC 3W97C 4H9QA 5F99C 3MGPC 1TZYA 2IO5C 3WA9D 1WWSA 5B33B 4DRAA 3AZMA 4M6BA 5DNNB 3AZGD 4WU9C 1M18A 3AZJD 1HQ3C 5B24B 3A6NA 4KGCA 1KX4D 5AVCD 4H9NA 3AZNA 3AV2B 5B1MB 3REIC 5GT0D 5B2JC 5B32G 2RVQC 3MNNA 3UTAC 4J8WD 5CHLB 3X1VD 3B0BA 1M1AD 3W96B 3X1TC 5KDMB 2NZDD 5CPJA 5B24A 1KX5A 1P3BD 3VH6W 2NZDB 3B0CT 3W96D 5BS7C 5BO0A 3LELA 1ZLAC 3AFAA 3TU4A 5E5AB 3C1BA 5CPID 1P3KD 5AVCB 3AV1A 4Z66D 1P3OA
chains in the Genus database with same CATH superfamily
3AN2C 3X1SB 1AOIC 4R8PC 3AZEA 4G91B 3LELD 4JJNC 3AFAC 5CPJB 4H9PA 1EQZC 1KX5B 3B6FB 4Z5TC 3WA9B 5B31A 3EPKA 2NZDA 1KX5D 5B33C 3UT9C 4G92C 5B31D 3AZEC 3LELB 2PYOB 1U35C 1P3FA 1S32C 5AV8A 3B6GA 2JSSA 1M19B 3AZMB 4CSRB 3MNND 5B1LA 3MGSA 3C1BD 1P34C 4J8VC 1P3LC 3WKJB 4H9QB 3AZEB 1T3UA 3A6ND 3UT9B 3FDDA 4YS3D 3AZFC 3UTBB 3VH5T 4Z2MH 3W96C 2HIOA 1JFIB 2DF4C 3X1VB 1M1AB 3AZJA 2G5IC 1M18C 4AWLB 3UTBD 2XD1A 3C1CD 3UTAD 4J8WC 4J8XA 2FJ7D 3NQUA 3W99D 4KGCC 3W96A 4Z66C 3MVDA 3B0DC 3AZNC 4LD9C 5B40C 5GT0B 1TAFB 1TZYC 2Y2MA 2JCHA 3MGRC 3AZHB 5B0YA 1EQZD 4WU9A 2Y2KA 5JRGB 3LZ0D 4J8VB 2HIOB 1JFIA 5B33D 1A7WA 2RIQA 3AZED 2BYMA 3AZJB 3C1BB 2BYKB 1U35D 3B6FC 5AVBC 3AZHC 3NQUB 4WJ3C 3REJD 4G92B 5CP6B 3MNNC 3TU4B 2PYOC 4X23A 3LELC 4JJND 4KHAB 5B31B 4HGAC 5AV9B 3KWQB 1P3IB 1ID3B 1KX5C 5CP6C 5CPJD 3EPHA 4H9SA 2BYMB 3LZ1C 3AN2B 3UTBC 3NQJA 3KUYC 1PZRA 2Y2IA 2LY8A 3LZ0B 1KX3D 5CP6A 2CWEA 3C1BC 1P34D 1P3LD 5B40D 3LZ1A 2CV5A 3AV1D 1P3MD 3UTBA 4YS3C 4YM6B 3VH5W 1U35A 2ZM5A 1AOIA 1H3OA 3LZ0C 3UTAB 5B40B 5AV5A 3RELD 4LD9B 2F2AC 3B6GD 4ZUXD 3WTPA 1TZYB 1M18D 3AZGA 3X1TB 4YS3A 5B33A 3NQJB 4J8UC 5C3IC 4UUZB 3W98C 4KUDC 3EPLA 4CAYA 3IP4C 5GT3A 3AZFB 1B67A 3AZGC 3MGRD 3AZJC 3KXBB 1P3FD 5DNNA 4J8VA 5GT0A 3AZMC 2VQRA 5AV6D 3MGRB 3W99A 2HUEC 3W97B 5GSUB 4Z66A 3MVDC 4LD9A 4QLCC 5B0YB 3REJB 3AZGB 5DNNC 5B2ID 2Y2PA 5GT0C 3KFUG 2HIOD 2AROD 3KXBC 3MGPD 2Y2JA 3X1VC 4QLCA 5GSUC 3REHC 1M1AC 3X1TD 4AWLC 1P3PB 5JRGD 5E5AD 3O62A 2F8NB 3MGRA 5B32B 3W99B 1R4VA 3X1VA 5GSUA 1M1AA 5AV8D 3AFAB 5CPJC 3REID 3REHB 5B32D 3O62C 5DNMD 5CPKC 1P3BB 2DQNC 3AZLC 1ZLAA 2Y2GA 3B6FA 3AN2D 3AZHA 4H9SC 4WNNB 3AV1C 5CPKA 3X1SA 4WU8D 4EO5B 3AFAD 1P3BC 3X1UC 1W2EA 4X23C 5AY8A 3AZMD 3LZ1B 3VH6T 3WA9A 3MGQB 3KUYB 2YFWB 2Y2LA 5B31C 2UWXA 1P3PD 4JJNB 1KX3A 4ZBJC 5AV6B 3AYWD 3KWQC 1P3IC 1P3BA 5B24D 2AROC 3KXBD 1P3FB 5AY8D 4X23B 5AV5C 1P3GC 4R8PD 1S32A 4J8VD 3REKC 3WTPC 3KWQA 1P3IA 3WKJA 4XUJC 4KHAA 2BG1A 4ZBJB 5FUGA 5AY8B 5AV6C 2CV5C 3R45A 5F99B 5AVBB 5CPIB 3W98A 4KUDA 2IO5B 3WTPE 2YFWA 3WAAD 1P3KB 2Y2QA 3MVDB 2HIOC 4WU8B 3C1CC 3W99C 3RELA 4KGCD 4J8XB 1F66B 3O62B 3AV2C 1TZYD 5JRGC 1M18B 3VH6A 5GXQA 4J8UB 5BNVA 1KU5A 5B40A 5DNMB 2ZY5A 4KGCB 4J8WB 3AZIC 2BYKA 1HQ3B 5G49A 3H0LC 5B32C 2F8NA 5GXQC 3WKJD 1P34B 1P3LB 3KWQD 1P3ID 4XZQA 1BH9A 3AZKB 3MNNB 3AZLD 5AVBD 2F8ND 2Y2NA 5F99D 3AZIA 1M19A 2NQBA 3REJC 4XZQD 3KXBA 5B1LB 3MGSB 1P3GD 2YFVB 1KX4B 2PYOD 4WU8C 1HTAA 3LJAB 3AYWA 5GT3D 5B0ZA 5BNVB 4X23D 4H9OB 3EPJA 3AZKC 1M19C 1B6WA 3MGPB 3REJA 5C3IB 1P3GB 5B1LD 3MGSD 3W97A 3H0MC 3LJAD 4Z66B 3WAAC 1WWIA 3AYWC 3X1SC 3MGQA 4XUJB 4XZQB 3AZKA 3KUYD 3W97D 2RVQD 3AZHD 5AY8C 2CV5B 4NFTA 1BH8A 4Z5TB 3WA9C 3AZLA 4WU9D 3REKD 1HQ3D 5FUGB 5AV5B 1BFMA 3C1CB 5BNXB 2JE5A 1AOIB 2NQBD 3AZID 5B2JA 3UTAA 4J8XD 4E44A 4UUZA 3REKA 5GXQD 3X1UB 3WKJC 4XUJA 2L5AA 4YM6D 3X1TA 4YS3B 1P3MB 1KX3C 1P3AA 1P3KC 1BH8B 5BT1C 5KDMA 4H9RB 5GXQB 2AROA 4J8UA 3AV2D 1N1JA 2J8PA 5B2IA 5GT3C 5CPKB 4UPKA 3RELC 5B2JB 3TU4C 4DQYB 5AV6A 3UT9D 4ZUXC 1ZLAD 4G91C 5DNND 5B2IC 3AN2A 5BO0B 4R8PA 1S32D 4EO5C 4KUDD 5B0YD 1EQZA 1BH9B 5GSUD 3AYWB 5B32A 1S32B 3KSYA 5JA4B 1U35B 1Z2CB 3AZKD 3REHA 3AZFD 3B0DB 4H9NB 5JRGA 3AZNB 3AV2A 2FJ7A 3LJAA 1P3OD 2NQBC 4H9PB 4QLCD 3V9RB 5AV8C 5CPIA 3W98B 3MGPA 3X1SD 5B1MA 4WU8A 5DNMC 5CPKD 5B0ZC 3RELB 4NE5A 2FJ7C 2F8NH 4DRBA 4ZUXB 5BT1D 1EQZB 4CAYB 3REHD 2XD5A 3AZFA 2FFFB 4LD9D 1P3AD 5AV8B 3AL0C 3A6NC 3WAAA 1F66A 5DNMA 5E5AC 3MGQC 3A1IA 3X1UD 3REIA 1KX3B 2FJ7B 5G49B 5BNXA 4J8XC 5B31G 3X1UA 4J8WA 5E5AA 3O62D 1HQ3A 1F66D 4YM6C 2NQBB 2ZY2A 2HUEB 3REKB 3F6TA 3AZND 5AV9D 5AVCA 5B0YC 4QLCB 1ID3D 5AV5D 1P3OB 3B0CW 5B2IB 3R45B 1P3PA 2F8NK 3WTPD 5B1MD 3VH5A 4YM6A 4XUJD 1F1EA 4H9RA 1P3GA 2CV5D 1P3KA 1Q9CA 5AVCC 3TU4D 5CP6D 5AVBA 2ZY3A 1ULYA 1P3PC 4KUDB 3WTPB 3LZ1D 4R8PB 5B24C 3B6FD 5B2JD 2PYOA 4CSRA 1ZLAB 5BS7A 3B6GB 3A1KA 5GT3B 5JA4A 4Z5TA 1P3AC 3P5JB 3C1CA 4WNNA 4WV4B 2NZDC 3AZLB 1P3MC 3MGQD 3UT9A 1KX4C 1P3OC 4E45A 3KUYA 5AV9A 1ID3A 3AV1B 3B6GC 4JJNA 3EG5B 1P3MA 1P3AB 5B0ZD 2G5HC 3V9RA 4ZUXA 4J8UD 2YFVA 1P34A 1P3LA 1KX4A 1TAFA 2W8SA 3W98D 5B0ZB 2ZY4A 3H0RC 4HGAB 5AV9C 4H9OA 4XZQC 3AZIB 1N1JB 1ID3C 1AOID 3LZ0A 2AROB 5B1MC 3REIB 1P3FC 4Z5TD 3A6NB 4NE6A 5F99A 1M19D 3WAAB 4Z2MG 4WU9B 5B1LC 4NE3A 3MVDD 3MGSC 3LJAC 1H3OB 4WZSB 1F66C 2F8NG 5CPIC 3W97C 4H9QA 5F99C 3MGPC 1TZYA 2IO5C 3WA9D 1WWSA 5B33B 4DRAA 3AZMA 4M6BA 5DNNB 3AZGD 4WU9C 1M18A 3AZJD 1HQ3C 5B24B 3A6NA 4KGCA 1KX4D 5AVCD 4H9NA 3AZNA 3AV2B 5B1MB 3REIC 2Y2OA 5GT0D 5B2JC 5B32G 2RVQC 2Y2HA 3MNNA 3UTAC 4J8WD 5CHLB 3X1VD 3B0BA 1M1AD 3W96B 3X1TC 5KDMB 2NZDD 5CPJA 5B24A 1KX5A 1P3BD 3VH6W 2NZDB 3B0CT 3W96D 5BS7C 5BO0A 3LELA 1ZLAC 3AFAA 3TU4A 5E5AB 3C1BA 5CPID 1P3KD 5AVCB 3AV1A 4Z66D 1P3OA
chains in the Genus database with same CATH topology
3AN2C 3X1SB 1AOIC 4R8PC 3AZEA 4G91B 3LELD 4JJNC 3AFAC 5CPJB 4H9PA 1EQZC 1KX5B 3B6FB 4Z5TC 3WA9B 5B31A 3EPKA 2NZDA 1KX5D 5B33C 3UT9C 4G92C 5B31D 3AZEC 3LELB 2PYOB 1U35C 1P3FA 1S32C 5AV8A 3B6GA 2JSSA 1M19B 3AZMB 4CSRB 3MNND 5B1LA 3MGSA 3C1BD 1P34C 4J8VC 1P3LC 3WKJB 4H9QB 3AZEB 1T3UA 3A6ND 3UT9B 3FDDA 4YS3D 3AZFC 3UTBB 3VH5T 4Z2MH 3W96C 2HIOA 1JFIB 2DF4C 3X1VB 1M1AB 3AZJA 2G5IC 1M18C 4AWLB 3UTBD 2XD1A 3C1CD 3UTAD 4J8WC 4J8XA 2FJ7D 3NQUA 3W99D 4KGCC 3W96A 4Z66C 3MVDA 3B0DC 3AZNC 4LD9C 5B40C 5GT0B 1TAFB 1TZYC 2Y2MA 2JCHA 3MGRC 3AZHB 5B0YA 1EQZD 4WU9A 2Y2KA 5JRGB 3LZ0D 4J8VB 2HIOB 1JFIA 5B33D 1A7WA 2RIQA 3AZED 2BYMA 3AZJB 3C1BB 2BYKB 1U35D 3B6FC 5AVBC 3AZHC 3NQUB 4WJ3C 3REJD 4G92B 5CP6B 3MNNC 3TU4B 2PYOC 4X23A 3LELC 4JJND 4KHAB 5B31B 4HGAC 5AV9B 3KWQB 1P3IB 1ID3B 1KX5C 5CP6C 5CPJD 3EPHA 4H9SA 2BYMB 3LZ1C 3AN2B 3UTBC 3NQJA 3KUYC 1PZRA 2Y2IA 2LY8A 3LZ0B 1KX3D 5CP6A 2CWEA 3C1BC 1P34D 1P3LD 5B40D 3LZ1A 2CV5A 3AV1D 1P3MD 3UTBA 4YS3C 4YM6B 3VH5W 1U35A 2ZM5A 1AOIA 1H3OA 3LZ0C 3UTAB 5B40B 5AV5A 3RELD 4LD9B 2F2AC 3B6GD 4ZUXD 3WTPA 1TZYB 1M18D 3AZGA 3X1TB 4YS3A 5B33A 3NQJB 4J8UC 5C3IC 4UUZB 3W98C 4KUDC 3EPLA 4CAYA 3IP4C 5GT3A 3AZFB 1B67A 3AZGC 3MGRD 3AZJC 3KXBB 1P3FD 5DNNA 4J8VA 5GT0A 3AZMC 2VQRA 5AV6D 3MGRB 3W99A 2HUEC 3W97B 5GSUB 4Z66A 3MVDC 4LD9A 4QLCC 5B0YB 3REJB 3AZGB 5DNNC 5B2ID 2Y2PA 5GT0C 3KFUG 2HIOD 2AROD 3KXBC 3MGPD 2Y2JA 3X1VC 4QLCA 5GSUC 3REHC 1M1AC 3X1TD 4AWLC 1P3PB 5JRGD 5E5AD 3O62A 2F8NB 3MGRA 5B32B 3W99B 1R4VA 3X1VA 5GSUA 1M1AA 5AV8D 3AFAB 5CPJC 3REID 3REHB 5B32D 3O62C 5DNMD 5CPKC 1P3BB 2DQNC 3AZLC 1ZLAA 2Y2GA 3B6FA 3AN2D 3AZHA 4H9SC 4WNNB 3AV1C 5CPKA 3X1SA 4WU8D 4EO5B 3AFAD 1P3BC 3X1UC 1W2EA 4X23C 5AY8A 3AZMD 3LZ1B 3VH6T 3WA9A 3MGQB 3KUYB 2YFWB 2Y2LA 5B31C 2UWXA 1P3PD 4JJNB 1KX3A 4ZBJC 5AV6B 3AYWD 3KWQC 1P3IC 1P3BA 5B24D 2AROC 3KXBD 1P3FB 5AY8D 4X23B 5AV5C 1P3GC 4R8PD 1S32A 4J8VD 3REKC 3WTPC 3KWQA 1P3IA 3WKJA 4XUJC 4KHAA 2BG1A 4ZBJB 5FUGA 5AY8B 5AV6C 2CV5C 3R45A 5F99B 5AVBB 5CPIB 3W98A 4KUDA 2IO5B 3WTPE 2YFWA 3WAAD 1P3KB 2Y2QA 3MVDB 2HIOC 4WU8B 3C1CC 3W99C 3RELA 4KGCD 4J8XB 1F66B 3O62B 3AV2C 1TZYD 5JRGC 1M18B 3VH6A 5GXQA 4J8UB 5BNVA 1KU5A 5B40A 5DNMB 2ZY5A 4KGCB 4J8WB 3AZIC 2BYKA 1HQ3B 5G49A 3H0LC 5B32C 2F8NA 5GXQC 3WKJD 1P34B 1P3LB 3KWQD 1P3ID 4XZQA 1BH9A 3AZKB 3MNNB 3AZLD 5AVBD 2F8ND 2Y2NA 5F99D 3AZIA 1M19A 2NQBA 3REJC 4XZQD 3KXBA 5B1LB 3MGSB 1P3GD 2YFVB 1KX4B 2PYOD 4WU8C 1HTAA 3LJAB 3AYWA 5GT3D 5B0ZA 5BNVB 4X23D 4H9OB 3EPJA 3AZKC 1M19C 1B6WA 3MGPB 3REJA 5C3IB 1P3GB 5B1LD 3MGSD 3W97A 3H0MC 3LJAD 4Z66B 3WAAC 1WWIA 3AYWC 3X1SC 3MGQA 4XUJB 4XZQB 3AZKA 3KUYD 3W97D 2RVQD 3AZHD 5AY8C 2CV5B 4NFTA 1BH8A 4Z5TB 3WA9C 3AZLA 4WU9D 3REKD 1HQ3D 5FUGB 5AV5B 1BFMA 3C1CB 5BNXB 2JE5A 1AOIB 2NQBD 3AZID 5B2JA 3UTAA 4J8XD 4E44A 4UUZA 3REKA 5GXQD 3X1UB 3WKJC 4XUJA 2L5AA 4YM6D 3X1TA 4YS3B 1P3MB 1KX3C 1P3AA 1P3KC 1BH8B 5BT1C 5KDMA 4H9RB 5GXQB 2AROA 4J8UA 3AV2D 1N1JA 2J8PA 5B2IA 5GT3C 5CPKB 4UPKA 3RELC 5B2JB 3TU4C 4DQYB 5AV6A 3UT9D 4ZUXC 1ZLAD 4G91C 5DNND 5B2IC 3AN2A 5BO0B 4R8PA 1S32D 4EO5C 4KUDD 5B0YD 1EQZA 1BH9B 5GSUD 3AYWB 5B32A 1S32B 3KSYA 5JA4B 1U35B 1Z2CB 3AZKD 3REHA 3AZFD 3B0DB 4H9NB 5JRGA 3AZNB 3AV2A 2FJ7A 3LJAA 1P3OD 2NQBC 4H9PB 4QLCD 3V9RB 5AV8C 5CPIA 3W98B 3MGPA 3X1SD 5B1MA 4WU8A 5DNMC 5CPKD 5B0ZC 3RELB 4NE5A 2FJ7C 2F8NH 4DRBA 4ZUXB 5BT1D 1EQZB 4CAYB 3REHD 2XD5A 3AZFA 2FFFB 4LD9D 1P3AD 5AV8B 3AL0C 3A6NC 3WAAA 1F66A 5DNMA 5E5AC 3MGQC 3A1IA 3X1UD 3REIA 1KX3B 2FJ7B 5G49B 5BNXA 4J8XC 5B31G 3X1UA 4J8WA 5E5AA 3O62D 1HQ3A 1F66D 4YM6C 2NQBB 2ZY2A 2HUEB 3REKB 3F6TA 3AZND 5AV9D 5AVCA 5B0YC 4QLCB 1ID3D 5AV5D 1P3OB 3B0CW 5B2IB 3R45B 1P3PA 2F8NK 3WTPD 5B1MD 3VH5A 4YM6A 4XUJD 1F1EA 4H9RA 1P3GA 2CV5D 1P3KA 1Q9CA 5AVCC 3TU4D 5CP6D 5AVBA 2ZY3A 1ULYA 1P3PC 4KUDB 3WTPB 3LZ1D 4R8PB 5B24C 3B6FD 5B2JD 2PYOA 4CSRA 1ZLAB 5BS7A 3B6GB 3A1KA 5GT3B 5JA4A 4Z5TA 1P3AC 3P5JB 3C1CA 4WNNA 4WV4B 2NZDC 3AZLB 1P3MC 3MGQD 3UT9A 1KX4C 1P3OC 4E45A 3KUYA 5AV9A 1ID3A 3AV1B 3B6GC 4JJNA 3EG5B 1P3MA 1P3AB 5B0ZD 2G5HC 3V9RA 4ZUXA 4J8UD 2YFVA 1P34A 1P3LA 1KX4A 1TAFA 2W8SA 3W98D 5B0ZB 2ZY4A 3H0RC 4HGAB 5AV9C 4H9OA 4XZQC 3AZIB 1N1JB 1ID3C 1AOID 3LZ0A 2AROB 5B1MC 3REIB 1P3FC 4Z5TD 3A6NB 4NE6A 5F99A 1M19D 3WAAB 4Z2MG 4WU9B 5B1LC 4NE3A 3MVDD 3MGSC 3LJAC 1H3OB 4WZSB 1F66C 2F8NG 5CPIC 3W97C 4H9QA 5F99C 3MGPC 1TZYA 2IO5C 3WA9D 1WWSA 5B33B 4DRAA 3AZMA 4M6BA 5DNNB 3AZGD 4WU9C 1M18A 3AZJD 1HQ3C 5B24B 3A6NA 4KGCA 1KX4D 5AVCD 4H9NA 3AZNA 3AV2B 5B1MB 3REIC 2Y2OA 5GT0D 5B2JC 5B32G 2RVQC 2Y2HA 3MNNA 3UTAC 4J8WD 5CHLB 3X1VD 3B0BA 1M1AD 3W96B 3X1TC 5KDMB 2NZDD 5CPJA 5B24A 1KX5A 1P3BD 3VH6W 2NZDB 3B0CT 3W96D 5BS7C 5BO0A 3LELA 1ZLAC 3AFAA 3TU4A 5E5AB 3C1BA 5CPID 1P3KD 5AVCB 3AV1A 4Z66D 1P3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 C;  3X1S B;  1AOI C;  4R8P C;  3AZE A;  4G91 B;  3LEL D;  4JJN C;  3AFA C;  5CPJ B;  4H9P A;  1EQZ C;  1KX5 B;  3B6F B;  4Z5T C;  3WA9 B;  5B31 A;  2NZD A;  1KX5 D;  5B33 C;  3UT9 C;  4G92 C;  5B31 D;  3AZE C;  3LEL B;  2PYO B;  1U35 C;  1P3F A;  1S32 C;  5AV8 A;  3B6G A;  2JSS A;  1M19 B;  3AZM B;  4CSR B;  3MNN D;  5B1L A;  3MGS A;  3C1B D;  1P34 C;  4J8V C;  1P3L C;  3WKJ B;  4H9Q B;  3AZE B;  3A6N D;  3UT9 B;  4YS3 D;  3AZF C;  3UTB B;  3VH5 T;  4Z2M H;  3W96 C;  2HIO A;  1JFI B;  3X1V B;  1M1A B;  3AZJ A;  1M18 C;  4AWL B;  3UTB D;  3C1C D;  3UTA D;  4J8W C;  4J8X A;  2FJ7 D;  3NQU A;  3W99 D;  4KGC C;  3W96 A;  4Z66 C;  3MVD A;  3B0D C;  3AZN C;  4LD9 C;  5B40 C;  5GT0 B;  1TAF B;  1TZY C;  3MGR C;  3AZH B;  5B0Y A;  1EQZ D;  4WU9 A;  5JRG B;  3LZ0 D;  4J8V B;  2HIO B;  1JFI A;  5B33 D;  1A7W A;  3AZE D;  2BYM A;  3AZJ B;  3C1B B;  2BYK B;  1U35 D;  3B6F C;  5AVB C;  3AZH C;  3NQU B;  3REJ D;  4G92 B;  5CP6 B;  3MNN C;  3TU4 B;  2PYO C;  4X23 A;  3LEL C;  4JJN D;  4KHA B;  5B31 B;  4HGA C;  5AV9 B;  3KWQ B;  1P3I B;  1ID3 B;  1KX5 C;  5CP6 C;  5CPJ D;  4H9S A;  2BYM B;  3LZ1 C;  3AN2 B;  3UTB C;  3NQJ A;  3KUY C;  2LY8 A;  3LZ0 B;  1KX3 D;  5CP6 A;  2CWE A;  3C1B C;  1P34 D;  1P3L D;  5B40 D;  3LZ1 A;  2CV5 A;  3AV1 D;  1P3M D;  3UTB A;  4YS3 C;  4YM6 B;  3VH5 W;  1U35 A;  1AOI A;  1H3O A;  3LZ0 C;  3UTA B;  5B40 B;  5AV5 A;  3REL D;  4LD9 B;  3B6G D;  4ZUX D;  3WTP A;  1TZY B;  1M18 D;  3AZG A;  3X1T B;  4YS3 A;  5B33 A;  3NQJ B;  4J8U C;  5C3I C;  4UUZ B;  3W98 C;  4KUD C;  4CAY A;  3AZF B;  5GT3 A;  1B67 A;  3AZG C;  3MGR D;  3AZJ C;  3KXB B;  1P3F D;  5DNN A;  4J8V A;  5GT0 A;  3AZM C;  5AV6 D;  3MGR B;  3W99 A;  2HUE C;  3W97 B;  5GSU B;  4Z66 A;  3MVD C;  4LD9 A;  4QLC C;  5B0Y B;  3REJ B;  3AZG B;  5DNN C;  5B2I D;  5GT0 C;  2HIO D;  2ARO D;  3KXB C;  3MGP D;  3X1V C;  4QLC A;  5GSU C;  3REH C;  1M1A C;  3X1T D;  4AWL C;  1P3P B;  5JRG D;  5E5A D;  3O62 A;  2F8N B;  3MGR A;  5B32 B;  3W99 B;  1R4V A;  3X1V A;  5GSU A;  1M1A A;  5AV8 D;  3AFA B;  5CPJ C;  3REI D;  3REH B;  5B32 D;  3O62 C;  5DNM D;  5CPK C;  1P3B B;  3AZL C;  1ZLA A;  3B6F A;  3AN2 D;  3AZH A;  4H9S C;  4WNN B;  3AV1 C;  5CPK A;  3X1S A;  4WU8 D;  4EO5 B;  3AFA D;  1P3B C;  3X1U C;  4X23 C;  5AY8 A;  3AZM D;  3LZ1 B;  3VH6 T;  3WA9 A;  3MGQ B;  3KUY B;  2YFW B;  5B31 C;  1P3P D;  4JJN B;  1KX3 A;  4ZBJ C;  5AV6 B;  3AYW D;  3KWQ C;  1P3I C;  1P3B A;  5B24 D;  2ARO C;  3KXB D;  1P3F B;  5AY8 D;  4X23 B;  5AV5 C;  1P3G C;  4R8P D;  1S32 A;  4J8V D;  3REK C;  3WTP C;  3KWQ A;  1P3I A;  3WKJ A;  4XUJ C;  4KHA A;  4ZBJ B;  5FUG A;  5AY8 B;  5AV6 C;  2CV5 C;  3R45 A;  5F99 B;  5AVB B;  5CPI B;  3W98 A;  4KUD A;  2IO5 B;  3WTP E;  2YFW A;  3WAA D;  1P3K B;  3MVD B;  2HIO C;  4WU8 B;  3C1C C;  3W99 C;  3REL A;  4KGC D;  4J8X B;  1F66 B;  3O62 B;  3AV2 C;  1TZY D;  5JRG C;  1M18 B;  3VH6 A;  5GXQ A;  4J8U B;  5BNV A;  1KU5 A;  5B40 A;  5DNM B;  4KGC B;  4J8W B;  3AZI C;  2BYK A;  1HQ3 B;  5G49 A;  5B32 C;  2F8N A;  5GXQ C;  3WKJ D;  1P34 B;  1P3L B;  3KWQ D;  1P3I D;  4XZQ A;  1BH9 A;  3AZK B;  3MNN B;  3AZL D;  5AVB D;  2F8N D;  5F99 D;  1M19 A;  3AZI A;  2NQB A;  3REJ C;  4XZQ D;  3KXB A;  5B1L B;  3MGS B;  1P3G D;  2YFV B;  1KX4 B;  2PYO D;  4WU8 C;  1HTA A;  3LJA B;  3AYW A;  5GT3 D;  5B0Z A;  5BNV B;  4X23 D;  4H9O B;  3AZK C;  1M19 C;  1B6W A;  3MGP B;  3REJ A;  5C3I B;  1P3G B;  5B1L D;  3MGS D;  3W97 A;  3LJA D;  4Z66 B;  3WAA C;  1WWI A;  3AYW C;  3X1S C;  3MGQ A;  4XUJ B;  4XZQ B;  3AZK A;  3KUY D;  3W97 D;  2RVQ D;  3AZH D;  5AY8 C;  2CV5 B;  4NFT A;  1BH8 A;  4Z5T B;  3WA9 C;  3AZL A;  4WU9 D;  3REK D;  1HQ3 D;  5FUG B;  5AV5 B;  1BFM A;  3C1C B;  5BNX B;  1AOI B;  2NQB D;  3AZI D;  5B2J A;  3UTA A;  4J8X D;  4E44 A;  4UUZ A;  3REK A;  5GXQ D;  3X1U B;  3WKJ C;  4XUJ A;  2L5A A;  4YM6 D;  3X1T A;  4YS3 B;  1P3M B;  1KX3 C;  1P3A A;  1P3K C;  1BH8 B;  5BT1 C;  5KDM A;  4H9R B;  5GXQ B;  2ARO A;  4J8U A;  3AV2 D;  1N1J A;  5B2I A;  5GT3 C;  5CPK B;  3REL C;  5B2J B;  3TU4 C;  5AV6 A;  3UT9 D;  4ZUX C;  1ZLA D;  4G91 C;  5DNN D;  5B2I C;  3AN2 A;  5BO0 B;  4R8P A;  1S32 D;  4EO5 C;  4KUD D;  5B0Y D;  1EQZ A;  1BH9 B;  5GSU D;  3AYW B;  5B32 A;  1S32 B;  3KSY A;  5JA4 B;  1U35 B;  3AZK D;  3REH A;  3AZF D;  4H9N B;  3B0D B;  5JRG A;  3AZN B;  3AV2 A;  2FJ7 A;  3LJA A;  1P3O D;  2NQB C;  4H9P B;  4QLC D;  3V9R B;  5AV8 C;  5CPI A;  3W98 B;  3MGP A;  3X1S D;  5B1M A;  4WU8 A;  5DNM C;  5CPK D;  5B0Z C;  3REL B;  4NE5 A;  2FJ7 C;  2F8N H;  4DRB A;  4ZUX B;  5BT1 D;  1EQZ B;  4CAY B;  3REH D;  3AZF A;  4LD9 D;  1P3A D;  5AV8 B;  3A6N C;  3WAA A;  1F66 A;  5DNM A;  5E5A C;  3MGQ C;  3X1U D;  3REI A;  1KX3 B;  2FJ7 B;  5G49 B;  5BNX A;  4J8X C;  5B31 G;  3X1U A;  4J8W A;  5E5A A;  3O62 D;  1HQ3 A;  1F66 D;  4YM6 C;  2NQB B;  2HUE B;  3REK B;  3AZN D;  5AV9 D;  5AVC A;  5B0Y C;  4QLC B;  1ID3 D;  5AV5 D;  1P3O B;  3B0C W;  5B2I B;  3R45 B;  1P3P A;  2F8N K;  3WTP D;  5B1M D;  3VH5 A;  4YM6 A;  4XUJ D;  1F1E A;  4H9R A;  1P3G A;  2CV5 D;  1P3K A;  1Q9C A;  5AVC C;  3TU4 D;  5CP6 D;  5AVB A;  1ULY A;  1P3P C;  4KUD B;  3WTP B;  3LZ1 D;  4R8P B;  5B24 C;  3B6F D;  5B2J D;  2PYO A;  4CSR A;  1ZLA B;  5BS7 A;  3B6G B;  5GT3 B;  5JA4 A;  4Z5T A;  1P3A C;  3C1C A;  4WNN A;  4WV4 B;  2NZD C;  3AZL B;  1P3M C;  3MGQ D;  3UT9 A;  1KX4 C;  1P3O C;  4E45 A;  3KUY A;  5AV9 A;  1ID3 A;  3AV1 B;  3B6G C;  4JJN A;  1P3M A;  1P3A B;  5B0Z D;  4ZUX A;  3V9R A;  4J8U D;  2YFV A;  1P34 A;  1P3L A;  1KX4 A;  1TAF A;  3W98 D;  5B0Z B;  4HGA B;  5AV9 C;  3AZI B;  4H9O A;  4XZQ C;  1ID3 C;  1N1J B;  1AOI D;  3LZ0 A;  2ARO B;  5B1M C;  3REI B;  1P3F C;  4Z5T D;  3A6N B;  4NE6 A;  5F99 A;  1M19 D;  3WAA B;  4Z2M G;  4WU9 B;  5B1L C;  4NE3 A;  3MVD D;  3MGS C;  3LJA C;  1H3O B;  4WZS B;  1F66 C;  2F8N G;  5CPI C;  3W97 C;  4H9Q A;  5F99 C;  3MGP C;  1TZY A;  2IO5 C;  3WA9 D;  1WWS A;  5B33 B;  4DRA A;  3AZM A;  4M6B A;  5DNN B;  3AZG D;  4WU9 C;  1M18 A;  3AZJ D;  1HQ3 C;  5B24 B;  3A6N A;  4KGC A;  1KX4 D;  5AVC D;  4H9N A;  3AZN A;  3AV2 B;  5B1M B;  3REI C;  5GT0 D;  5B2J C;  5B32 G;  2RVQ C;  3MNN A;  3UTA C;  4J8W D;  5CHL B;  3X1V D;  3B0B A;  1M1A D;  3W96 B;  3X1T C;  5KDM B;  2NZD D;  5CPJ A;  5B24 A;  1KX5 A;  1P3B D;  3VH6 W;  2NZD B;  3B0C T;  3W96 D;  5BS7 C;  5BO0 A;  3LEL A;  1ZLA C;  3AFA A;  3TU4 A;  5E5A B;  3C1B A;  5CPI D;  1P3K D;  5AVC B;  3AV1 A;  4Z66 D;  1P3O A; 
#chains in the Genus database with same CATH topology
 3AN2 C;  3X1S B;  1AOI C;  4R8P C;  3AZE A;  4G91 B;  3LEL D;  4JJN C;  3AFA C;  5CPJ B;  4H9P A;  1EQZ C;  1KX5 B;  3B6F B;  4Z5T C;  3WA9 B;  5B31 A;  3EPK A;  2NZD A;  1KX5 D;  5B33 C;  3UT9 C;  4G92 C;  5B31 D;  3AZE C;  3LEL B;  2PYO B;  1U35 C;  1P3F A;  1S32 C;  5AV8 A;  3B6G A;  2JSS A;  1M19 B;  3AZM B;  4CSR B;  3MNN D;  5B1L A;  3MGS A;  3C1B D;  1P34 C;  4J8V C;  1P3L C;  3WKJ B;  4H9Q B;  3AZE B;  1T3U A;  3A6N D;  3UT9 B;  3FDD A;  4YS3 D;  3AZF C;  3UTB B;  3VH5 T;  4Z2M H;  3W96 C;  2HIO A;  1JFI B;  2DF4 C;  3X1V B;  1M1A B;  3AZJ A;  2G5I C;  1M18 C;  4AWL B;  3UTB D;  2XD1 A;  3C1C D;  3UTA D;  4J8W C;  4J8X A;  2FJ7 D;  3NQU A;  3W99 D;  4KGC C;  3W96 A;  4Z66 C;  3MVD A;  3B0D C;  3AZN C;  4LD9 C;  5B40 C;  5GT0 B;  1TAF B;  1TZY C;  2Y2M A;  2JCH A;  3MGR C;  3AZH B;  5B0Y A;  1EQZ D;  4WU9 A;  2Y2K A;  5JRG B;  3LZ0 D;  4J8V B;  2HIO B;  1JFI A;  5B33 D;  1A7W A;  2RIQ A;  3AZE D;  2BYM A;  3AZJ B;  3C1B B;  2BYK B;  1U35 D;  3B6F C;  5AVB C;  3AZH C;  3NQU B;  4WJ3 C;  3REJ D;  4G92 B;  5CP6 B;  3MNN C;  3TU4 B;  2PYO C;  4X23 A;  3LEL C;  4JJN D;  4KHA B;  5B31 B;  4HGA C;  5AV9 B;  3KWQ B;  1P3I B;  1ID3 B;  1KX5 C;  5CP6 C;  5CPJ D;  3EPH A;  4H9S A;  2BYM B;  3LZ1 C;  3AN2 B;  3UTB C;  3NQJ A;  3KUY C;  1PZR A;  2Y2I A;  2LY8 A;  3LZ0 B;  1KX3 D;  5CP6 A;  2CWE A;  3C1B C;  1P34 D;  1P3L D;  5B40 D;  3LZ1 A;  2CV5 A;  3AV1 D;  1P3M D;  3UTB A;  4YS3 C;  4YM6 B;  3VH5 W;  1U35 A;  2ZM5 A;  1AOI A;  1H3O A;  3LZ0 C;  3UTA B;  5B40 B;  5AV5 A;  3REL D;  4LD9 B;  2F2A C;  3B6G D;  4ZUX D;  3WTP A;  1TZY B;  1M18 D;  3AZG A;  3X1T B;  4YS3 A;  5B33 A;  3NQJ B;  4J8U C;  5C3I C;  4UUZ B;  3W98 C;  4KUD C;  3EPL A;  4CAY A;  3IP4 C;  5GT3 A;  3AZF B;  1B67 A;  3AZG C;  3MGR D;  3AZJ C;  3KXB B;  1P3F D;  5DNN A;  4J8V A;  5GT0 A;  3AZM C;  2VQR A;  5AV6 D;  3MGR B;  3W99 A;  2HUE C;  3W97 B;  5GSU B;  4Z66 A;  3MVD C;  4LD9 A;  4QLC C;  5B0Y B;  3REJ B;  3AZG B;  5DNN C;  5B2I D;  2Y2P A;  5GT0 C;  3KFU G;  2HIO D;  2ARO D;  3KXB C;  3MGP D;  2Y2J A;  3X1V C;  4QLC A;  5GSU C;  3REH C;  1M1A C;  3X1T D;  4AWL C;  1P3P B;  5JRG D;  5E5A D;  3O62 A;  2F8N B;  3MGR A;  5B32 B;  3W99 B;  1R4V A;  3X1V A;  5GSU A;  1M1A A;  5AV8 D;  3AFA B;  5CPJ C;  3REI D;  3REH B;  5B32 D;  3O62 C;  5DNM D;  5CPK C;  1P3B B;  2DQN C;  3AZL C;  1ZLA A;  2Y2G A;  3B6F A;  3AN2 D;  3AZH A;  4H9S C;  4WNN B;  3AV1 C;  5CPK A;  3X1S A;  4WU8 D;  4EO5 B;  3AFA D;  1P3B C;  3X1U C;  1W2E A;  4X23 C;  5AY8 A;  3AZM D;  3LZ1 B;  3VH6 T;  3WA9 A;  3MGQ B;  3KUY B;  2YFW B;  2Y2L A;  5B31 C;  2UWX A;  1P3P D;  4JJN B;  1KX3 A;  4ZBJ C;  5AV6 B;  3AYW D;  3KWQ C;  1P3I C;  1P3B A;  5B24 D;  2ARO C;  3KXB D;  1P3F B;  5AY8 D;  4X23 B;  5AV5 C;  1P3G C;  4R8P D;  1S32 A;  4J8V D;  3REK C;  3WTP C;  3KWQ A;  1P3I A;  3WKJ A;  4XUJ C;  4KHA A;  2BG1 A;  4ZBJ B;  5FUG A;  5AY8 B;  5AV6 C;  2CV5 C;  3R45 A;  5F99 B;  5AVB B;  5CPI B;  3W98 A;  4KUD A;  2IO5 B;  3WTP E;  2YFW A;  3WAA D;  1P3K B;  2Y2Q A;  3MVD B;  2HIO C;  4WU8 B;  3C1C C;  3W99 C;  3REL A;  4KGC D;  4J8X B;  1F66 B;  3O62 B;  3AV2 C;  1TZY D;  5JRG C;  1M18 B;  3VH6 A;  5GXQ A;  4J8U B;  5BNV A;  1KU5 A;  5B40 A;  5DNM B;  2ZY5 A;  4KGC B;  4J8W B;  3AZI C;  2BYK A;  1HQ3 B;  5G49 A;  3H0L C;  5B32 C;  2F8N A;  5GXQ C;  3WKJ D;  1P34 B;  1P3L B;  3KWQ D;  1P3I D;  4XZQ A;  1BH9 A;  3AZK B;  3MNN B;  3AZL D;  5AVB D;  2F8N D;  2Y2N A;  5F99 D;  3AZI A;  1M19 A;  2NQB A;  3REJ C;  4XZQ D;  3KXB A;  5B1L B;  3MGS B;  1P3G D;  2YFV B;  1KX4 B;  2PYO D;  4WU8 C;  1HTA A;  3LJA B;  3AYW A;  5GT3 D;  5B0Z A;  5BNV B;  4X23 D;  4H9O B;  3EPJ A;  3AZK C;  1M19 C;  1B6W A;  3MGP B;  3REJ A;  5C3I B;  1P3G B;  5B1L D;  3MGS D;  3W97 A;  3H0M C;  3LJA D;  4Z66 B;  3WAA C;  1WWI A;  3AYW C;  3X1S C;  3MGQ A;  4XUJ B;  4XZQ B;  3AZK A;  3KUY D;  3W97 D;  2RVQ D;  3AZH D;  5AY8 C;  2CV5 B;  4NFT A;  1BH8 A;  4Z5T B;  3WA9 C;  3AZL A;  4WU9 D;  3REK D;  1HQ3 D;  5FUG B;  5AV5 B;  1BFM A;  3C1C B;  5BNX B;  2JE5 A;  1AOI B;  2NQB D;  3AZI D;  5B2J A;  3UTA A;  4J8X D;  4E44 A;  4UUZ A;  3REK A;  5GXQ D;  3X1U B;  3WKJ C;  4XUJ A;  2L5A A;  4YM6 D;  3X1T A;  4YS3 B;  1P3M B;  1KX3 C;  1P3A A;  1P3K C;  1BH8 B;  5BT1 C;  5KDM A;  4H9R B;  5GXQ B;  2ARO A;  4J8U A;  3AV2 D;  1N1J A;  2J8P A;  5B2I A;  5GT3 C;  5CPK B;  4UPK A;  3REL C;  5B2J B;  3TU4 C;  4DQY B;  5AV6 A;  3UT9 D;  4ZUX C;  1ZLA D;  4G91 C;  5DNN D;  5B2I C;  3AN2 A;  5BO0 B;  4R8P A;  1S32 D;  4EO5 C;  4KUD D;  5B0Y D;  1EQZ A;  1BH9 B;  5GSU D;  3AYW B;  5B32 A;  1S32 B;  3KSY A;  5JA4 B;  1U35 B;  1Z2C B;  3AZK D;  3REH A;  3AZF D;  3B0D B;  4H9N B;  5JRG A;  3AZN B;  3AV2 A;  2FJ7 A;  3LJA A;  1P3O D;  2NQB C;  4H9P B;  4QLC D;  3V9R B;  5AV8 C;  5CPI A;  3W98 B;  3MGP A;  3X1S D;  5B1M A;  4WU8 A;  5DNM C;  5CPK D;  5B0Z C;  3REL B;  4NE5 A;  2FJ7 C;  2F8N H;  4DRB A;  4ZUX B;  5BT1 D;  1EQZ B;  4CAY B;  3REH D;  2XD5 A;  3AZF A;  2FFF B;  4LD9 D;  1P3A D;  5AV8 B;  3AL0 C;  3A6N C;  3WAA A;  1F66 A;  5DNM A;  5E5A C;  3MGQ C;  3A1I A;  3X1U D;  3REI A;  1KX3 B;  2FJ7 B;  5G49 B;  5BNX A;  4J8X C;  5B31 G;  3X1U A;  4J8W A;  5E5A A;  3O62 D;  1HQ3 A;  1F66 D;  4YM6 C;  2NQB B;  2ZY2 A;  2HUE B;  3REK B;  3F6T A;  3AZN D;  5AV9 D;  5AVC A;  5B0Y C;  4QLC B;  1ID3 D;  5AV5 D;  1P3O B;  3B0C W;  5B2I B;  3R45 B;  1P3P A;  2F8N K;  3WTP D;  5B1M D;  3VH5 A;  4YM6 A;  4XUJ D;  1F1E A;  4H9R A;  1P3G A;  2CV5 D;  1P3K A;  1Q9C A;  5AVC C;  3TU4 D;  5CP6 D;  5AVB A;  2ZY3 A;  1ULY A;  1P3P C;  4KUD B;  3WTP B;  3LZ1 D;  4R8P B;  5B24 C;  3B6F D;  5B2J D;  2PYO A;  4CSR A;  1ZLA B;  5BS7 A;  3B6G B;  3A1K A;  5GT3 B;  5JA4 A;  4Z5T A;  1P3A C;  3P5J B;  3C1C A;  4WNN A;  4WV4 B;  2NZD C;  3AZL B;  1P3M C;  3MGQ D;  3UT9 A;  1KX4 C;  1P3O C;  4E45 A;  3KUY A;  5AV9 A;  1ID3 A;  3AV1 B;  3B6G C;  4JJN A;  3EG5 B;  1P3M A;  1P3A B;  5B0Z D;  2G5H C;  3V9R A;  4ZUX A;  4J8U D;  2YFV A;  1P34 A;  1P3L A;  1KX4 A;  1TAF A;  2W8S A;  3W98 D;  5B0Z B;  2ZY4 A;  3H0R C;  4HGA B;  5AV9 C;  4H9O A;  4XZQ C;  3AZI B;  1N1J B;  1ID3 C;  1AOI D;  3LZ0 A;  2ARO B;  5B1M C;  3REI B;  1P3F C;  4Z5T D;  3A6N B;  4NE6 A;  5F99 A;  1M19 D;  3WAA B;  4Z2M G;  4WU9 B;  5B1L C;  4NE3 A;  3MVD D;  3MGS C;  3LJA C;  1H3O B;  4WZS B;  1F66 C;  2F8N G;  5CPI C;  3W97 C;  4H9Q A;  5F99 C;  3MGP C;  1TZY A;  2IO5 C;  3WA9 D;  1WWS A;  5B33 B;  4DRA A;  3AZM A;  4M6B A;  5DNN B;  3AZG D;  4WU9 C;  1M18 A;  3AZJ D;  1HQ3 C;  5B24 B;  3A6N A;  4KGC A;  1KX4 D;  5AVC D;  4H9N A;  3AZN A;  3AV2 B;  5B1M B;  3REI C;  2Y2O A;  5GT0 D;  5B2J C;  5B32 G;  2RVQ C;  2Y2H A;  3MNN A;  3UTA C;  4J8W D;  5CHL B;  3X1V D;  3B0B A;  1M1A D;  3W96 B;  3X1T C;  5KDM B;  2NZD D;  5CPJ A;  5B24 A;  1KX5 A;  1P3B D;  3VH6 W;  2NZD B;  3B0C T;  3W96 D;  5BS7 C;  5BO0 A;  3LEL A;  1ZLA C;  3AFA A;  3TU4 A;  5E5A B;  3C1B A;  5CPI D;  1P3K D;  5AVC B;  3AV1 A;  4Z66 D;  1P3O A; 
#chains in the Genus database with same CATH homology
 3AN2 C;  3X1S B;  1AOI C;  4R8P C;  3AZE A;  4G91 B;  3LEL D;  4JJN C;  3AFA C;  5CPJ B;  4H9P A;  1EQZ C;  1KX5 B;  3B6F B;  4Z5T C;  3WA9 B;  5B31 A;  3EPK A;  2NZD A;  1KX5 D;  5B33 C;  3UT9 C;  4G92 C;  5B31 D;  3AZE C;  3LEL B;  2PYO B;  1U35 C;  1P3F A;  1S32 C;  5AV8 A;  3B6G A;  2JSS A;  1M19 B;  3AZM B;  4CSR B;  3MNN D;  5B1L A;  3MGS A;  3C1B D;  1P34 C;  4J8V C;  1P3L C;  3WKJ B;  4H9Q B;  3AZE B;  1T3U A;  3A6N D;  3UT9 B;  3FDD A;  4YS3 D;  3AZF C;  3UTB B;  3VH5 T;  4Z2M H;  3W96 C;  2HIO A;  1JFI B;  2DF4 C;  3X1V B;  1M1A B;  3AZJ A;  2G5I C;  1M18 C;  4AWL B;  3UTB D;  2XD1 A;  3C1C D;  3UTA D;  4J8W C;  4J8X A;  2FJ7 D;  3NQU A;  3W99 D;  4KGC C;  3W96 A;  4Z66 C;  3MVD A;  3B0D C;  3AZN C;  4LD9 C;  5B40 C;  5GT0 B;  1TAF B;  1TZY C;  2Y2M A;  2JCH A;  3MGR C;  3AZH B;  5B0Y A;  1EQZ D;  4WU9 A;  2Y2K A;  5JRG B;  3LZ0 D;  4J8V B;  2HIO B;  1JFI A;  5B33 D;  1A7W A;  2RIQ A;  3AZE D;  2BYM A;  3AZJ B;  3C1B B;  2BYK B;  1U35 D;  3B6F C;  5AVB C;  3AZH C;  3NQU B;  4WJ3 C;  3REJ D;  4G92 B;  5CP6 B;  3MNN C;  3TU4 B;  2PYO C;  4X23 A;  3LEL C;  4JJN D;  4KHA B;  5B31 B;  4HGA C;  5AV9 B;  3KWQ B;  1P3I B;  1ID3 B;  1KX5 C;  5CP6 C;  5CPJ D;  3EPH A;  4H9S A;  2BYM B;  3LZ1 C;  3AN2 B;  3UTB C;  3NQJ A;  3KUY C;  1PZR A;  2Y2I A;  2LY8 A;  3LZ0 B;  1KX3 D;  5CP6 A;  2CWE A;  3C1B C;  1P34 D;  1P3L D;  5B40 D;  3LZ1 A;  2CV5 A;  3AV1 D;  1P3M D;  3UTB A;  4YS3 C;  4YM6 B;  3VH5 W;  1U35 A;  2ZM5 A;  1AOI A;  1H3O A;  3LZ0 C;  3UTA B;  5B40 B;  5AV5 A;  3REL D;  4LD9 B;  2F2A C;  3B6G D;  4ZUX D;  3WTP A;  1TZY B;  1M18 D;  3AZG A;  3X1T B;  4YS3 A;  5B33 A;  3NQJ B;  4J8U C;  5C3I C;  4UUZ B;  3W98 C;  4KUD C;  3EPL A;  4CAY A;  3IP4 C;  5GT3 A;  3AZF B;  1B67 A;  3AZG C;  3MGR D;  3AZJ C;  3KXB B;  1P3F D;  5DNN A;  4J8V A;  5GT0 A;  3AZM C;  2VQR A;  5AV6 D;  3MGR B;  3W99 A;  2HUE C;  3W97 B;  5GSU B;  4Z66 A;  3MVD C;  4LD9 A;  4QLC C;  5B0Y B;  3REJ B;  3AZG B;  5DNN C;  5B2I D;  2Y2P A;  5GT0 C;  3KFU G;  2HIO D;  2ARO D;  3KXB C;  3MGP D;  2Y2J A;  3X1V C;  4QLC A;  5GSU C;  3REH C;  1M1A C;  3X1T D;  4AWL C;  1P3P B;  5JRG D;  5E5A D;  3O62 A;  2F8N B;  3MGR A;  5B32 B;  3W99 B;  1R4V A;  3X1V A;  5GSU A;  1M1A A;  5AV8 D;  3AFA B;  5CPJ C;  3REI D;  3REH B;  5B32 D;  3O62 C;  5DNM D;  5CPK C;  1P3B B;  2DQN C;  3AZL C;  1ZLA A;  2Y2G A;  3B6F A;  3AN2 D;  3AZH A;  4H9S C;  4WNN B;  3AV1 C;  5CPK A;  3X1S A;  4WU8 D;  4EO5 B;  3AFA D;  1P3B C;  3X1U C;  1W2E A;  4X23 C;  5AY8 A;  3AZM D;  3LZ1 B;  3VH6 T;  3WA9 A;  3MGQ B;  3KUY B;  2YFW B;  2Y2L A;  5B31 C;  2UWX A;  1P3P D;  4JJN B;  1KX3 A;  4ZBJ C;  5AV6 B;  3AYW D;  3KWQ C;  1P3I C;  1P3B A;  5B24 D;  2ARO C;  3KXB D;  1P3F B;  5AY8 D;  4X23 B;  5AV5 C;  1P3G C;  4R8P D;  1S32 A;  4J8V D;  3REK C;  3WTP C;  3KWQ A;  1P3I A;  3WKJ A;  4XUJ C;  4KHA A;  2BG1 A;  4ZBJ B;  5FUG A;  5AY8 B;  5AV6 C;  2CV5 C;  3R45 A;  5F99 B;  5AVB B;  5CPI B;  3W98 A;  4KUD A;  2IO5 B;  3WTP E;  2YFW A;  3WAA D;  1P3K B;  2Y2Q A;  3MVD B;  2HIO C;  4WU8 B;  3C1C C;  3W99 C;  3REL A;  4KGC D;  4J8X B;  1F66 B;  3O62 B;  3AV2 C;  1TZY D;  5JRG C;  1M18 B;  3VH6 A;  5GXQ A;  4J8U B;  5BNV A;  1KU5 A;  5B40 A;  5DNM B;  2ZY5 A;  4KGC B;  4J8W B;  3AZI C;  2BYK A;  1HQ3 B;  5G49 A;  3H0L C;  5B32 C;  2F8N A;  5GXQ C;  3WKJ D;  1P34 B;  1P3L B;  3KWQ D;  1P3I D;  4XZQ A;  1BH9 A;  3AZK B;  3MNN B;  3AZL D;  5AVB D;  2F8N D;  2Y2N A;  5F99 D;  3AZI A;  1M19 A;  2NQB A;  3REJ C;  4XZQ D;  3KXB A;  5B1L B;  3MGS B;  1P3G D;  2YFV B;  1KX4 B;  2PYO D;  4WU8 C;  1HTA A;  3LJA B;  3AYW A;  5GT3 D;  5B0Z A;  5BNV B;  4X23 D;  4H9O B;  3EPJ A;  3AZK C;  1M19 C;  1B6W A;  3MGP B;  3REJ A;  5C3I B;  1P3G B;  5B1L D;  3MGS D;  3W97 A;  3H0M C;  3LJA D;  4Z66 B;  3WAA C;  1WWI A;  3AYW C;  3X1S C;  3MGQ A;  4XUJ B;  4XZQ B;  3AZK A;  3KUY D;  3W97 D;  2RVQ D;  3AZH D;  5AY8 C;  2CV5 B;  4NFT A;  1BH8 A;  4Z5T B;  3WA9 C;  3AZL A;  4WU9 D;  3REK D;  1HQ3 D;  5FUG B;  5AV5 B;  1BFM A;  3C1C B;  5BNX B;  2JE5 A;  1AOI B;  2NQB D;  3AZI D;  5B2J A;  3UTA A;  4J8X D;  4E44 A;  4UUZ A;  3REK A;  5GXQ D;  3X1U B;  3WKJ C;  4XUJ A;  2L5A A;  4YM6 D;  3X1T A;  4YS3 B;  1P3M B;  1KX3 C;  1P3A A;  1P3K C;  1BH8 B;  5BT1 C;  5KDM A;  4H9R B;  5GXQ B;  2ARO A;  4J8U A;  3AV2 D;  1N1J A;  2J8P A;  5B2I A;  5GT3 C;  5CPK B;  4UPK A;  3REL C;  5B2J B;  3TU4 C;  4DQY B;  5AV6 A;  3UT9 D;  4ZUX C;  1ZLA D;  4G91 C;  5DNN D;  5B2I C;  3AN2 A;  5BO0 B;  4R8P A;  1S32 D;  4EO5 C;  4KUD D;  5B0Y D;  1EQZ A;  1BH9 B;  5GSU D;  3AYW B;  5B32 A;  1S32 B;  3KSY A;  5JA4 B;  1U35 B;  1Z2C B;  3AZK D;  3REH A;  3AZF D;  3B0D B;  4H9N B;  5JRG A;  3AZN B;  3AV2 A;  2FJ7 A;  3LJA A;  1P3O D;  2NQB C;  4H9P B;  4QLC D;  3V9R B;  5AV8 C;  5CPI A;  3W98 B;  3MGP A;  3X1S D;  5B1M A;  4WU8 A;  5DNM C;  5CPK D;  5B0Z C;  3REL B;  4NE5 A;  2FJ7 C;  2F8N H;  4DRB A;  4ZUX B;  5BT1 D;  1EQZ B;  4CAY B;  3REH D;  2XD5 A;  3AZF A;  2FFF B;  4LD9 D;  1P3A D;  5AV8 B;  3AL0 C;  3A6N C;  3WAA A;  1F66 A;  5DNM A;  5E5A C;  3MGQ C;  3A1I A;  3X1U D;  3REI A;  1KX3 B;  2FJ7 B;  5G49 B;  5BNX A;  4J8X C;  5B31 G;  3X1U A;  4J8W A;  5E5A A;  3O62 D;  1HQ3 A;  1F66 D;  4YM6 C;  2NQB B;  2ZY2 A;  2HUE B;  3REK B;  3F6T A;  3AZN D;  5AV9 D;  5AVC A;  5B0Y C;  4QLC B;  1ID3 D;  5AV5 D;  1P3O B;  3B0C W;  5B2I B;  3R45 B;  1P3P A;  2F8N K;  3WTP D;  5B1M D;  3VH5 A;  4YM6 A;  4XUJ D;  1F1E A;  4H9R A;  1P3G A;  2CV5 D;  1P3K A;  1Q9C A;  5AVC C;  3TU4 D;  5CP6 D;  5AVB A;  2ZY3 A;  1ULY A;  1P3P C;  4KUD B;  3WTP B;  3LZ1 D;  4R8P B;  5B24 C;  3B6F D;  5B2J D;  2PYO A;  4CSR A;  1ZLA B;  5BS7 A;  3B6G B;  3A1K A;  5GT3 B;  5JA4 A;  4Z5T A;  1P3A C;  3P5J B;  3C1C A;  4WNN A;  4WV4 B;  2NZD C;  3AZL B;  1P3M C;  3MGQ D;  3UT9 A;  1KX4 C;  1P3O C;  4E45 A;  3KUY A;  5AV9 A;  1ID3 A;  3AV1 B;  3B6G C;  4JJN A;  3EG5 B;  1P3M A;  1P3A B;  5B0Z D;  2G5H C;  3V9R A;  4ZUX A;  4J8U D;  2YFV A;  1P34 A;  1P3L A;  1KX4 A;  1TAF A;  2W8S A;  3W98 D;  5B0Z B;  2ZY4 A;  3H0R C;  4HGA B;  5AV9 C;  4H9O A;  4XZQ C;  3AZI B;  1N1J B;  1ID3 C;  1AOI D;  3LZ0 A;  2ARO B;  5B1M C;  3REI B;  1P3F C;  4Z5T D;  3A6N B;  4NE6 A;  5F99 A;  1M19 D;  3WAA B;  4Z2M G;  4WU9 B;  5B1L C;  4NE3 A;  3MVD D;  3MGS C;  3LJA C;  1H3O B;  4WZS B;  1F66 C;  2F8N G;  5CPI C;  3W97 C;  4H9Q A;  5F99 C;  3MGP C;  1TZY A;  2IO5 C;  3WA9 D;  1WWS A;  5B33 B;  4DRA A;  3AZM A;  4M6B A;  5DNN B;  3AZG D;  4WU9 C;  1M18 A;  3AZJ D;  1HQ3 C;  5B24 B;  3A6N A;  4KGC A;  1KX4 D;  5AVC D;  4H9N A;  3AZN A;  3AV2 B;  5B1M B;  3REI C;  2Y2O A;  5GT0 D;  5B2J C;  5B32 G;  2RVQ C;  2Y2H A;  3MNN A;  3UTA C;  4J8W D;  5CHL B;  3X1V D;  3B0B A;  1M1A D;  3W96 B;  3X1T C;  5KDM B;  2NZD D;  5CPJ A;  5B24 A;  1KX5 A;  1P3B D;  3VH6 W;  2NZD B;  3B0C T;  3W96 D;  5BS7 C;  5BO0 A;  3LEL A;  1ZLA C;  3AFA A;  3TU4 A;  5E5A B;  3C1B A;  5CPI D;  1P3K D;  5AVC B;  3AV1 A;  4Z66 D;  1P3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...