5BNXA

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.3-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
b'TELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 26
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnxA00
3AZJA 3AN2B 4J8WD 3NQUA 1AOIC 3R45A 5DNNB 5DNMD 1U35C 1TZYB 3W98B 3KSYA 3MGQD 3X1VD 3LELC 2F8ND 3C1CA 5AV9D 5AV8D 3MGPB 5B1LD 4WU8B 5AY8D 3AYWB 4J8VA 4H9OA 3A6NB 3AZLB 2CV5B 5GSUA 1KX5B 2F8NK 3AZEA 1Q9CA 2IO5B 2LY8A 3W96C 3X1TA 4G91C 1ZLAD 2PYOA 3W97D 3LZ1C 4H9NA 5F99D 3B0CT 2CWEA 3VH6A 5JA4A 1P34B 4H9SC 1TAFB 4J8XA 3X1SB 4WV4B 1F66C 1ID3A 3B6GB 4Z5TC 3B0BA 1P3BD 3MGRC 5B2JB 3REJA 4LD9C 4R8PC 1M19A 4YS3C 1B67A 2YFVB 3LZ1D 3AN2C 1P3FB 5GT3A 5E5AA 2AROA 4J8UD 3KWQA 1P3MA 5B31G 3KUYD 3AZMB 4J8WA 3MGPC 4Z5TD 1M18D 4WU8C 3MGRD 4YM6D 3UT9D 1P3IB 3A6NC 3MVDB 3MGQA 5BO0B 3AZLC 2F8NA 4LD9D 4R8PD 5AV8A 5B1LA 5AY8A 4KUDD 1P3LD 4UUZB 5BNVA 1P34C 3NQUB 3W97A 5AV5C 3X1SC 5AV6A 5F99A 3B6GC 5B32B 3AFAD 3C1CB 2RVQC 3AZID 5B2JC 5B40A 2HUEB 5B31C 3UTBD 1A7WA 3UTAD 3WTPE 1P3BA 5GSUB 3AZEB 4NE5A 3AZKC 3LZ0B 3X1TB 5FUGA 5B0YC 5AV5D 3LZ1A 3V9RA 1KX4C 1F1EA 3REHB 2RVQD 4J8XB 5AVCC 4HGAB 4J8UA 4E45A 1P3IC 3KUYA 5BS7C 5B31D 2NQBB 3REIB 3B0CW 3REJB 1M18A 3MGRA 4YM6A 3X1UB 3UT9A 1H3OB 5BT1C 3AZKD 4JJNA 3NQJB 3KXBD 5B0YD 3B6FC 4QLCA 5B32C 1KX4D 4KUDA 1P3KD 3AZNB 1P3LA 4CAYB 4X23D 1S32B 5AVCD 3WA9C 3TU4C 2HIOC 3W99B 3AFAA 3MGQB 3WAAD 3AZIA 4CSRA 5BT1D 5C3IC 3O62D 3AV2D 3UTBA 2FJ7C 4M6BA 3UTAA 3B6FD 5CP6B 3REHC 5GXQA 4HGAC 4Z66C 5AV6B 5CPIC 3WA9D 3TU4D 1HQ3B 3AZGB 4WU9D 3REKB 4XUJB 2BYMA 5B40B 3X1UC 5B0ZB 5AVBC 2BYKB 4NE6A 4NFTA 3RELC 3MNNB 4EO5C 3AZKA 4KGCB 3AZHA 1P3OB 4Z66D 3KXBA 5CPID 5B0YA 3C1BC 3MGSC 5BNXA 1P3KA 1KX3B 4H9QA 4X23A 5AVCA 3B0DB 5CPJB 5BS7A 1P3AB 3RELD 4XZQB 3WTPC 5B1MC 3WAAA 4H9RB 3WKJC 4JJNB 1AOID 5CP6C 3O62A 1U35D 3AV2A 5JRGB 1BH8A 4QLCB 3LELD 1HQ3C 4H9PA 3C1BD 3AZGC 2NZDC 3B6FA 3MGSD 3REKC 3LJAB 5B0ZC 3WA9A 3VH5T 5B2IB 1P3GC 4WU9A 3W96D 3WTPD 5B1MD 5KDMA 3WKJD 3MNNC 1EQZB 5DNNC 4ZUXB 1TZYC 1P3OC 5B33B 1M1AB 3W98C 3AZFB 5G49B 3AV1B 5CPKB 1P3PB 4WNNA 5B24B 2NZDD 5GXQB 1F66D 5DNMA 4DRBA 1KX3C 3AYWC 4KHAA 4Z66A 5GT0B 5CPIA 1B6WA 3B0DC 3X1VA 2CV5C 1KX5C 1P3AC 4XZQC 5AV9A 2IO5C 4YS3D 3AN2D 5DNND 1TZYD 3AZJB 3W98D 3R45B 1ZLAA 3AZHB 3LJAC 1AOIA 3MGPD 4WU8D 3AYWD 1U35A 5BNXB 3A6ND 3AZLD 3LELA 2CV5D 4X23B 3MGSA 4J8VB 4H9OB 4DRAA 4G92B 2L5AA 1P3FC 5B32G 2PYOB 1M1AC 4H9NB 1P34D 3W96A 5B24C 4AWLB 3AZMC 3X1SD 3WKJA 1BH9A 3B6GD 5JA4B 1N1JA 4H9PB 5GT0C 5B2JD 3MVDC 1ID3B 4H9SA 1HTAA 2NZDA 1F66A 4Z5TA 1P3FD 1WWSA 1M19B 4LD9A 5KDMB 4R8PA 5GT3B 5E5AB 2AROB 5CHLB 3AZMD 3AN2A 4YS3A 1WWIA 3KWQB 1P3MB 1TZYA 3C1CC 3W98A 1P3ID 3VH5W 3MVDD 2HUEC 4J8WB 5DNMB 3MGPA 3X1VB 2F8NB 4WU8A 5GSUC 3AZEC 5AV9B 3LZ0C 5AV8B 3A6NA 5B1LB 4Z2MH 3AZLA 3X1TC 5AY8B 4AWLC 4E44A 5BNVB 5B32D 3W97B 3C1CD 1JFIA 4J8XC 1ZLAB 1P34A 5F99B 1ID3C 1AOIB 2NQBC 2HIOD 1KU5A 1TAFA 5AV5A 3X1SA 3B6GA 3REIC 3REJC 5GSUD 5B2JA 3LZ0D 3X1TD 5B31A 1P3BB 2FJ7D 5E5AC 2AROC 3KWQC 5FUGB 3AZNC 3W96B 3REHD 4G91B 1S32C 3LZ1B 3V9RB 2NQBD 3AZMA 4J8UB 3W99C 1KX4A 3REID 3MGQC 3KUYB 3REJD 3X1UD 1P3IA 5AV8C 3MVDA 5AVBD 4Z5TB 1M18B 5AY8C 3MGRB 4YM6B 3UT9B 4LD9B 4R8PB 3AZND 4UUZA 1S32D 4YS3B 5AV6C 5F99C 4KUDB 4Z2MG 1P3LB 3W99D 5B32A 4XUJC 5B40C 3TU4A 2HIOA 3AFAB 1P3BC 3AZIB 4CSRB 3UTBB 5CP6D 3LZ0A 4KGCC 3UTAB 5AV6D 2FJ7A 1R4VA 1HQ3D 3AZGD 4J8UC 1JFIB 3REKD 4XUJD 5B40D 3KUYC 3REHA 5AV5B 5B0ZD 5CPJC 2NQBA 2BYMB 4ZBJB 1M18C 1P3GD 4YM6C 3UT9C 3REIA 5B31B 4JJNC 3X1UA 3MNND 1H3OA 5AVBA 4KGCD 1P3OD 5JRGC 4QLCC 3NQJA 3VH5A 3RELA 4KUDC 3AZKB 1P3LC 3KXBB 3AZNA 5B0YB 4CAYA 1KX3D 1S32A 1KX4B 5CPJD 3AFAC 1P3KB 5B2IC 3C1BA 1KX5D 1P3AD 4H9QB 4XZQD 3AZIC 2F8NH 5AVCB 3W99A 1BFMA 4JJND 3UTBC 1EQZC 4ZUXC 3UTAC 5B33C 2YFWA 5JRGD 4WZSB 4QLCD 3AZFC 3AV1C 5CPKC 1P3PC 3WAAB 3WTPA 5B1MA 3O62B 5GXQC 3AV2B 3LJAD 1BH8B 5CP6A 3B6FB 2JSSA 4ZBJC 1HQ3A 5B2ID 3AZGA 3REKA 3VH6W 4XUJA 3WA9B 3TU4B 2HIOB 5B0ZA 1EQZD 4ZUXD 4WU9B 2BYKA 5B33D 1P3GA 3AZJC 1M1AD 3AZFD 3AV1D 5CPKD 1P3PD 5B24D 5C3IB 3AZHC 5GXQD 3MNNA 3KXBC 2FJ7B 5DNNA 4KGCA 1P3OA 4WNNB 1ULYA 5GT0D 1P3KC 4X23C 4KHAB 4Z66B 4J8VC 4G92C 5CPIB 1KX3A 3AYWA 5CPJA 2CV5A 2PYOC 3WAAC 1P3AA 3AZJD 4XZQA 1KX5A 5AVBB 4H9RA 4NE3A 3O62C 3AZHD 3AV2C 3RELB 2F8NG 5JRGA 4EO5B 1U35B 3LJAA 4J8VD 3LELB 3C1BB 3AZED 4WU9C 1M19C 3MGSB 2PYOD 5B2IA 5GT3C 2YFVA 1P3FA 2YFWB 1P3MC 1EQZA 4ZUXA 3WTPB 5B1MB 5B33A 4J8XD 1M1AA 3WKJB 4J8WC 1BH9B 5G49A 3AZFA 3AV1A 5CPKA 1P3PA 5DNMC 5B24A 1ID3D 1N1JB 3X1VC 2NZDB 5GT0A 5AV9C 1M19D 1F66B 5B1LC 5BO0A 5GT3D 5E5AD 2AROD 3VH6T 1P3GB 3KWQD 1P3MD 3W97C 1ZLAC
chains in the Genus database with same CATH superfamily
3AZJA 3AN2B 4J8WD 3NQUA 1AOIC 3R45A 5DNNB 5DNMD 1U35C 1TZYB 3W98B 2ZY2A 3KSYA 3MGQD 3X1VD 3LELC 2F8ND 4WJ3C 2F2AC 3C1CA 5AV9D 5AV8D 3MGPB 5B1LD 4WU8B 5AY8D 3AYWB 3WAAB 4J8VA 4H9OA 3A6NB 3AZLB 2CV5B 5GSUA 1KX5B 2F8NK 3AZEA 1Q9CA 2JCHA 2IO5B 2LY8A 3W96C 3X1TA 4G91C 1ZLAD 2PYOA 3W97D 3LZ1C 2Y2NA 4H9NA 2UWXA 5F99D 3B0CT 2CWEA 3VH6A 5JA4A 1P34B 4H9SC 3H0LC 1TAFB 4J8XA 3X1SB 4WV4B 1F66C 1ID3A 3B6GB 4Z5TC 3B0BA 1P3BD 3MGRC 5B2JB 3REJA 4LD9C 4R8PC 1M19A 4YS3C 1B67A 2YFVB 3LZ1D 3AN2C 1P3FB 5GT3A 5E5AA 2AROA 4J8UD 3KWQA 1P3MA 5B31G 3KUYD 3AZMB 4J8WA 3MGPC 4Z5TD 1M18D 4WU8C 3MGRD 4YM6D 3UT9D 1P3IB 3A6NC 3MVDB 3MGQA 5BO0B 3AZLC 2F8NA 4LD9D 4R8PD 5AV8A 5B1LA 5AY8A 2W8SA 2Y2HA 4KUDD 1P3LD 4UUZB 5BNVA 1P34C 3NQUB 3W97A 5AV5C 3X1SC 5AV6A 5F99A 3B6GC 5B32B 3AFAD 3C1CB 2RVQC 3EPKA 5B2JC 3AZID 5B40A 2HUEB 5B31C 3UTBD 1A7WA 3UTAD 3WTPE 1P3BA 5GSUB 3AZEB 4NE5A 3AZKC 3LZ0B 3X1TB 5FUGA 5B0YC 5AV5D 3LZ1A 3V9RA 1KX4C 1F1EA 3REHB 2RVQD 4J8XB 5AVCC 4HGAB 4J8UA 4E45A 1P3IC 3KUYA 3AL0C 5BS7C 5B31D 2NQBB 3REIB 3B0CW 3REJB 1M18A 3MGRA 4YM6A 3X1UB 3UT9A 1H3OB 3H0RC 5BT1C 3AZKD 4JJNA 3NQJB 3KXBD 5B0YD 3B6FC 4QLCA 5B32C 1KX4D 4KUDA 1P3KD 3AZNB 1P3LA 4CAYB 4X23D 1S32B 5AVCD 3WA9C 3TU4C 2HIOC 2Y2IA 3W99B 3AFAA 3MGQB 3WAAD 3AZIA 4CSRA 5BT1D 5C3IC 3O62D 3AV2D 3UTBA 2FJ7C 4M6BA 3UTAA 3B6FD 2BG1A 5CP6B 3REHC 5GXQA 4HGAC 4Z66C 5AV6B 5CPIC 3WA9D 3TU4D 1HQ3B 3AZGB 4WU9D 3REKB 4XUJB 2BYMA 5B40B 3X1UC 5B0ZB 5AVBC 2BYKB 4NE6A 4NFTA 3RELC 3MNNB 4EO5C 3AZKA 4KGCB 3A1IA 3AZHA 1P3OB 4Z66D 3KXBA 5CPID 5B0YA 3C1BC 2ZM5A 1Z2CB 5BNXA 3MGSC 1P3KA 1KX3B 4H9QA 4X23A 5AVCA 3B0DB 5CPJB 5BS7A 1P3AB 3RELD 4XZQB 3WTPC 5B1MC 3WAAA 4H9RB 3WKJC 4JJNB 1AOID 5CP6C 3O62A 1U35D 3AV2A 5JRGB 1BH8A 4QLCB 3LELD 1HQ3C 4H9PA 3C1BD 3AZGC 2NZDC 3B6FA 3MGSD 3REKC 3LJAB 5B0ZC 3WA9A 3VH5T 5B2IB 1P3GC 4WU9A 3W96D 3WTPD 5B1MD 2XD5A 5KDMA 1PZRA 2G5IC 3WKJD 3MNNC 1EQZB 5DNNC 4ZUXB 1TZYC 1P3OC 5B33B 1M1AB 3F6TA 3W98C 3AZFB 5G49B 3AV1B 5CPKB 1P3PB 4WNNA 5B24B 2NZDD 5GXQB 1F66D 5DNMA 4DRBA 1KX3C 3AYWC 4KHAA 4Z66A 5GT0B 5CPIA 1B6WA 3B0DC 3X1VA 2CV5C 1KX5C 1P3AC 4XZQC 5AV9A 2IO5C 4YS3D 3AN2D 5DNND 1TZYD 3AZJB 3W98D 3R45B 1ZLAA 2DQNC 3AZHB 3LJAC 1AOIA 3MGPD 4WU8D 3AYWD 1U35A 5BNXB 3A6ND 3AZLD 3LELA 2CV5D 1W2EA 4X23B 3MGSA 2Y2KA 4J8VB 4H9OB 4DRAA 4G92B 2L5AA 1P3FC 2Y2QA 5B32G 2PYOB 1M1AC 4H9NB 1P34D 3W96A 4UPKA 5B24C 4AWLB 3AZMC 3X1SD 3WKJA 1BH9A 3B6GD 5JA4B 1N1JA 4H9PB 2ZY4A 5GT0C 5B2JD 3MVDC 1ID3B 4H9SA 1HTAA 2NZDA 3A1KA 1F66A 3EG5B 4Z5TA 1P3FD 1WWSA 1M19B 4LD9A 5KDMB 4R8PA 5GT3B 5E5AB 2AROB 5CHLB 3AZMD 3AN2A 4YS3A 1WWIA 3KWQB 1P3MB 1TZYA 3C1CC 3W98A 1P3ID 3VH5W 3MVDD 2HUEC 4J8WB 5DNMB 3MGPA 3X1VB 4DQYB 2F8NB 4WU8A 2RIQA 5GSUC 3AZEC 5AV9B 3LZ0C 5AV8B 3A6NA 5B1LB 4Z2MH 3AZLA 1T3UA 3X1TC 5AY8B 4AWLC 4E44A 5BNVB 5B32D 3W97B 3C1CD 1JFIA 4J8XC 2ZY3A 1ZLAB 1P34A 5F99B 1ID3C 1AOIB 2NQBC 2HIOD 1KU5A 1TAFA 5AV5A 3X1SA 3B6GA 3REIC 3REJC 5GSUD 5B2JA 3LZ0D 3X1TD 5B31A 1P3BB 2FJ7D 5E5AC 2AROC 3KWQC 3EPLA 5FUGB 3AZNC 3W96B 2ZY5A 3REHD 4G91B 1S32C 3LZ1B 3V9RB 2NQBD 3AZMA 4J8UB 3W99C 1KX4A 3REID 3MGQC 3KUYB 3REJD 3X1UD 1P3IA 3EPJA 5AV8C 3MVDA 5AVBD 4Z5TB 1M18B 5AY8C 3MGRB 4YM6B 3UT9B 4LD9B 4R8PB 3AZND 4UUZA 1S32D 2JE5A 4YS3B 5AV6C 5F99C 4KUDB 4Z2MG 1P3LB 3W99D 5B32A 4XUJC 5B40C 3TU4A 2HIOA 3AFAB 1P3BC 3AZIB 4CSRB 2DF4C 3UTBB 5CP6D 3LZ0A 4KGCC 3UTAB 5AV6D 2FJ7A 1R4VA 1HQ3D 3AZGD 4J8UC 1JFIB 3REKD 4XUJD 5B40D 3KUYC 3REHA 5AV5B 5B0ZD 5CPJC 2NQBA 2BYMB 4ZBJB 1M18C 1P3GD 4YM6C 3UT9C 3REIA 5B31B 4JJNC 3X1UA 3MNND 1H3OA 5AVBA 4KGCD 1P3OD 5JRGC 4QLCC 3NQJA 3VH5A 3RELA 3P5JB 4KUDC 3AZKB 2Y2OA 1P3LC 3FDDA 3KXBB 3AZNA 5B0YB 4CAYA 1KX3D 1S32A 1KX4B 5CPJD 3AFAC 1P3KB 5B2IC 3C1BA 1KX5D 1P3AD 4H9QB 4XZQD 3AZIC 2F8NH 5AVCB 3W99A 1BFMA 4JJND 3UTBC 1EQZC 4ZUXC 3UTAC 5B33C 2YFWA 5JRGD 4WZSB 4QLCD 3AZFC 3H0MC 3AV1C 5CPKC 1P3PC 2VQRA 5B1MA 3WTPA 2J8PA 3O62B 5GXQC 3AV2B 3LJAD 1BH8B 5CP6A 2XD1A 2FFFB 3B6FB 2JSSA 4ZBJC 1HQ3A 5B2ID 3AZGA 3REKA 3VH6W 4XUJA 3WA9B 3TU4B 2HIOB 5B0ZA 1EQZD 4ZUXD 4WU9B 2BYKA 5B33D 1P3GA 3AZJC 1M1AD 3AZFD 3AV1D 5CPKD 1P3PD 5B24D 5C3IB 3AZHC 5GXQD 3MNNA 3KXBC 2FJ7B 5DNNA 4KGCA 1P3OA 4WNNB 1ULYA 5GT0D 1P3KC 4X23C 4KHAB 4Z66B 4J8VC 4G92C 5CPIB 2Y2GA 1KX3A 3AYWA 5CPJA 2CV5A 2PYOC 3WAAC 1P3AA 3AZJD 2G5HC 4XZQA 1KX5A 5AVBB 4H9RA 4NE3A 3O62C 3AZHD 3AV2C 3RELB 2F8NG 5JRGA 4EO5B 1U35B 3KFUG 2Y2JA 3LJAA 4J8VD 2Y2PA 3LELB 3C1BB 3AZED 4WU9C 1M19C 3MGSB 3EPHA 2PYOD 5B2IA 5GT3C 2YFVA 1P3FA 2YFWB 1P3MC 1EQZA 4ZUXA 3WTPB 5B1MB 5B33A 2Y2MA 4J8XD 1M1AA 3WKJB 4J8WC 1BH9B 5G49A 3AZFA 3AV1A 5CPKA 1P3PA 5DNMC 5B24A 1ID3D 1N1JB 2Y2LA 3X1VC 3IP4C 2NZDB 5GT0A 5AV9C 1M19D 1F66B 5B1LC 5BO0A 5GT3D 5E5AD 2AROD 3VH6T 1P3GB 3KWQD 1P3MD 3W97C 1ZLAC
chains in the Genus database with same CATH topology
3AZJA 3AN2B 4J8WD 3NQUA 1AOIC 3R45A 5DNNB 5DNMD 1U35C 1TZYB 3W98B 2ZY2A 3KSYA 3MGQD 3X1VD 3LELC 2F8ND 4WJ3C 2F2AC 3C1CA 5AV9D 5AV8D 3MGPB 5B1LD 4WU8B 5AY8D 3AYWB 3WAAB 4J8VA 4H9OA 3A6NB 3AZLB 2CV5B 5GSUA 1KX5B 2F8NK 3AZEA 1Q9CA 2JCHA 2IO5B 2LY8A 3W96C 3X1TA 4G91C 1ZLAD 2PYOA 3W97D 3LZ1C 2Y2NA 4H9NA 2UWXA 5F99D 3B0CT 2CWEA 3VH6A 5JA4A 1P34B 4H9SC 3H0LC 1TAFB 4J8XA 3X1SB 4WV4B 1F66C 1ID3A 3B6GB 4Z5TC 3B0BA 1P3BD 3MGRC 5B2JB 3REJA 4LD9C 4R8PC 1M19A 4YS3C 1B67A 2YFVB 3LZ1D 3AN2C 1P3FB 5GT3A 5E5AA 2AROA 4J8UD 3KWQA 1P3MA 5B31G 3KUYD 3AZMB 4J8WA 3MGPC 4Z5TD 1M18D 4WU8C 3MGRD 4YM6D 3UT9D 1P3IB 3A6NC 3MVDB 3MGQA 5BO0B 3AZLC 2F8NA 4LD9D 4R8PD 5AV8A 5B1LA 5AY8A 2W8SA 2Y2HA 4KUDD 1P3LD 4UUZB 5BNVA 1P34C 3NQUB 3W97A 5AV5C 3X1SC 5AV6A 5F99A 3B6GC 5B32B 3AFAD 3C1CB 2RVQC 3EPKA 5B2JC 3AZID 5B40A 2HUEB 5B31C 3UTBD 1A7WA 3UTAD 3WTPE 1P3BA 5GSUB 3AZEB 4NE5A 3AZKC 3LZ0B 3X1TB 5FUGA 5B0YC 5AV5D 3LZ1A 3V9RA 1KX4C 1F1EA 3REHB 2RVQD 4J8XB 5AVCC 4HGAB 4J8UA 4E45A 1P3IC 3KUYA 3AL0C 5BS7C 5B31D 2NQBB 3REIB 3B0CW 3REJB 1M18A 3MGRA 4YM6A 3X1UB 3UT9A 1H3OB 3H0RC 5BT1C 3AZKD 4JJNA 3NQJB 3KXBD 5B0YD 3B6FC 4QLCA 5B32C 1KX4D 4KUDA 1P3KD 3AZNB 1P3LA 4CAYB 4X23D 1S32B 5AVCD 3WA9C 3TU4C 2HIOC 2Y2IA 3W99B 3AFAA 3MGQB 3WAAD 3AZIA 4CSRA 5BT1D 5C3IC 3O62D 3AV2D 3UTBA 2FJ7C 4M6BA 3UTAA 3B6FD 2BG1A 5CP6B 3REHC 5GXQA 4HGAC 4Z66C 5AV6B 5CPIC 3WA9D 3TU4D 1HQ3B 3AZGB 4WU9D 3REKB 4XUJB 2BYMA 5B40B 3X1UC 5B0ZB 5AVBC 2BYKB 4NE6A 4NFTA 3RELC 3MNNB 4EO5C 3AZKA 4KGCB 3A1IA 3AZHA 1P3OB 4Z66D 3KXBA 5CPID 5B0YA 3C1BC 2ZM5A 1Z2CB 5BNXA 3MGSC 1P3KA 1KX3B 4H9QA 4X23A 5AVCA 3B0DB 5CPJB 5BS7A 1P3AB 3RELD 4XZQB 3WTPC 5B1MC 3WAAA 4H9RB 3WKJC 4JJNB 1AOID 5CP6C 3O62A 1U35D 3AV2A 5JRGB 1BH8A 4QLCB 3LELD 1HQ3C 4H9PA 3C1BD 3AZGC 2NZDC 3B6FA 3MGSD 3REKC 3LJAB 5B0ZC 3WA9A 3VH5T 5B2IB 1P3GC 4WU9A 3W96D 3WTPD 5B1MD 2XD5A 5KDMA 1PZRA 2G5IC 3WKJD 3MNNC 1EQZB 5DNNC 4ZUXB 1TZYC 1P3OC 5B33B 1M1AB 3F6TA 3W98C 3AZFB 5G49B 3AV1B 5CPKB 1P3PB 4WNNA 5B24B 2NZDD 5GXQB 1F66D 5DNMA 4DRBA 1KX3C 3AYWC 4KHAA 4Z66A 5GT0B 5CPIA 1B6WA 3B0DC 3X1VA 2CV5C 1KX5C 1P3AC 4XZQC 5AV9A 2IO5C 4YS3D 3AN2D 5DNND 1TZYD 3AZJB 3W98D 3R45B 1ZLAA 2DQNC 3AZHB 3LJAC 1AOIA 3MGPD 4WU8D 3AYWD 1U35A 5BNXB 3A6ND 3AZLD 3LELA 2CV5D 1W2EA 4X23B 3MGSA 2Y2KA 4J8VB 4H9OB 4DRAA 4G92B 2L5AA 1P3FC 2Y2QA 5B32G 2PYOB 1M1AC 4H9NB 1P34D 3W96A 4UPKA 5B24C 4AWLB 3AZMC 3X1SD 3WKJA 1BH9A 3B6GD 5JA4B 1N1JA 4H9PB 2ZY4A 5GT0C 5B2JD 3MVDC 1ID3B 4H9SA 1HTAA 2NZDA 3A1KA 1F66A 3EG5B 4Z5TA 1P3FD 1WWSA 1M19B 4LD9A 5KDMB 4R8PA 5GT3B 5E5AB 2AROB 5CHLB 3AZMD 3AN2A 4YS3A 1WWIA 3KWQB 1P3MB 1TZYA 3C1CC 3W98A 1P3ID 3VH5W 3MVDD 2HUEC 4J8WB 5DNMB 3MGPA 3X1VB 4DQYB 2F8NB 4WU8A 2RIQA 5GSUC 3AZEC 5AV9B 3LZ0C 5AV8B 3A6NA 5B1LB 4Z2MH 3AZLA 1T3UA 3X1TC 5AY8B 4AWLC 4E44A 5BNVB 5B32D 3W97B 3C1CD 1JFIA 4J8XC 2ZY3A 1ZLAB 1P34A 5F99B 1ID3C 1AOIB 2NQBC 2HIOD 1KU5A 1TAFA 5AV5A 3X1SA 3B6GA 3REIC 3REJC 5GSUD 5B2JA 3LZ0D 3X1TD 5B31A 1P3BB 2FJ7D 5E5AC 2AROC 3KWQC 3EPLA 5FUGB 3AZNC 3W96B 2ZY5A 3REHD 4G91B 1S32C 3LZ1B 3V9RB 2NQBD 3AZMA 4J8UB 3W99C 1KX4A 3REID 3MGQC 3KUYB 3REJD 3X1UD 1P3IA 3EPJA 5AV8C 3MVDA 5AVBD 4Z5TB 1M18B 5AY8C 3MGRB 4YM6B 3UT9B 4LD9B 4R8PB 3AZND 4UUZA 1S32D 2JE5A 4YS3B 5AV6C 5F99C 4KUDB 4Z2MG 1P3LB 3W99D 5B32A 4XUJC 5B40C 3TU4A 2HIOA 3AFAB 1P3BC 3AZIB 4CSRB 2DF4C 3UTBB 5CP6D 3LZ0A 4KGCC 3UTAB 5AV6D 2FJ7A 1R4VA 1HQ3D 3AZGD 4J8UC 1JFIB 3REKD 4XUJD 5B40D 3KUYC 3REHA 5AV5B 5B0ZD 5CPJC 2NQBA 2BYMB 4ZBJB 1M18C 1P3GD 4YM6C 3UT9C 3REIA 5B31B 4JJNC 3X1UA 3MNND 1H3OA 5AVBA 4KGCD 1P3OD 5JRGC 4QLCC 3NQJA 3VH5A 3RELA 3P5JB 4KUDC 3AZKB 2Y2OA 1P3LC 3FDDA 3KXBB 3AZNA 5B0YB 4CAYA 1KX3D 1S32A 1KX4B 5CPJD 3AFAC 1P3KB 5B2IC 3C1BA 1KX5D 1P3AD 4H9QB 4XZQD 3AZIC 2F8NH 5AVCB 3W99A 1BFMA 4JJND 3UTBC 1EQZC 4ZUXC 3UTAC 5B33C 2YFWA 5JRGD 4WZSB 4QLCD 3AZFC 3H0MC 3AV1C 5CPKC 1P3PC 2VQRA 5B1MA 3WTPA 2J8PA 3O62B 5GXQC 3AV2B 3LJAD 1BH8B 5CP6A 2XD1A 2FFFB 3B6FB 2JSSA 4ZBJC 1HQ3A 5B2ID 3AZGA 3REKA 3VH6W 4XUJA 3WA9B 3TU4B 2HIOB 5B0ZA 1EQZD 4ZUXD 4WU9B 2BYKA 5B33D 1P3GA 3AZJC 1M1AD 3AZFD 3AV1D 5CPKD 1P3PD 5B24D 5C3IB 3AZHC 5GXQD 3MNNA 3KXBC 2FJ7B 5DNNA 4KGCA 1P3OA 4WNNB 1ULYA 5GT0D 1P3KC 4X23C 4KHAB 4Z66B 4J8VC 4G92C 5CPIB 2Y2GA 1KX3A 3AYWA 5CPJA 2CV5A 2PYOC 3WAAC 1P3AA 3AZJD 2G5HC 4XZQA 1KX5A 5AVBB 4H9RA 4NE3A 3O62C 3AZHD 3AV2C 3RELB 2F8NG 5JRGA 4EO5B 1U35B 3KFUG 2Y2JA 3LJAA 4J8VD 2Y2PA 3LELB 3C1BB 3AZED 4WU9C 1M19C 3MGSB 3EPHA 2PYOD 5B2IA 5GT3C 2YFVA 1P3FA 2YFWB 1P3MC 1EQZA 4ZUXA 3WTPB 5B1MB 5B33A 2Y2MA 4J8XD 1M1AA 3WKJB 4J8WC 1BH9B 5G49A 3AZFA 3AV1A 5CPKA 1P3PA 5DNMC 5B24A 1ID3D 1N1JB 2Y2LA 3X1VC 3IP4C 2NZDB 5GT0A 5AV9C 1M19D 1F66B 5B1LC 5BO0A 5GT3D 5E5AD 2AROD 3VH6T 1P3GB 3KWQD 1P3MD 3W97C 1ZLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ A;  3AN2 B;  4J8W D;  3NQU A;  1AOI C;  3R45 A;  5DNN B;  5DNM D;  1U35 C;  1TZY B;  3W98 B;  3KSY A;  3MGQ D;  3X1V D;  3LEL C;  2F8N D;  3C1C A;  5AV9 D;  5AV8 D;  3MGP B;  5B1L D;  4WU8 B;  5AY8 D;  3AYW B;  4J8V A;  4H9O A;  3A6N B;  3AZL B;  2CV5 B;  5GSU A;  1KX5 B;  2F8N K;  3AZE A;  1Q9C A;  2IO5 B;  2LY8 A;  3W96 C;  3X1T A;  4G91 C;  1ZLA D;  2PYO A;  3W97 D;  3LZ1 C;  4H9N A;  5F99 D;  3B0C T;  2CWE A;  3VH6 A;  5JA4 A;  1P34 B;  4H9S C;  1TAF B;  4J8X A;  3X1S B;  4WV4 B;  1F66 C;  1ID3 A;  3B6G B;  4Z5T C;  3B0B A;  1P3B D;  3MGR C;  5B2J B;  3REJ A;  4LD9 C;  4R8P C;  1M19 A;  4YS3 C;  1B67 A;  2YFV B;  3LZ1 D;  3AN2 C;  1P3F B;  5GT3 A;  5E5A A;  2ARO A;  4J8U D;  3KWQ A;  1P3M A;  5B31 G;  3KUY D;  3AZM B;  4J8W A;  3MGP C;  4Z5T D;  1M18 D;  4WU8 C;  3MGR D;  4YM6 D;  3UT9 D;  1P3I B;  3A6N C;  3MVD B;  3MGQ A;  5BO0 B;  3AZL C;  2F8N A;  4LD9 D;  4R8P D;  5AV8 A;  5B1L A;  5AY8 A;  4KUD D;  1P3L D;  4UUZ B;  5BNV A;  1P34 C;  3NQU B;  3W97 A;  5AV5 C;  3X1S C;  5AV6 A;  5F99 A;  3B6G C;  5B32 B;  3AFA D;  3C1C B;  2RVQ C;  3AZI D;  5B2J C;  5B40 A;  2HUE B;  5B31 C;  3UTB D;  1A7W A;  3UTA D;  3WTP E;  1P3B A;  5GSU B;  3AZE B;  4NE5 A;  3AZK C;  3LZ0 B;  3X1T B;  5FUG A;  5B0Y C;  5AV5 D;  3LZ1 A;  3V9R A;  1KX4 C;  1F1E A;  3REH B;  2RVQ D;  4J8X B;  5AVC C;  4HGA B;  4J8U A;  4E45 A;  1P3I C;  3KUY A;  5BS7 C;  5B31 D;  2NQB B;  3REI B;  3B0C W;  3REJ B;  1M18 A;  3MGR A;  4YM6 A;  3X1U B;  3UT9 A;  1H3O B;  5BT1 C;  3AZK D;  4JJN A;  3NQJ B;  3KXB D;  5B0Y D;  3B6F C;  4QLC A;  5B32 C;  1KX4 D;  4KUD A;  1P3K D;  3AZN B;  1P3L A;  4CAY B;  4X23 D;  1S32 B;  5AVC D;  3WA9 C;  3TU4 C;  2HIO C;  3W99 B;  3AFA A;  3MGQ B;  3WAA D;  3AZI A;  4CSR A;  5BT1 D;  5C3I C;  3O62 D;  3AV2 D;  3UTB A;  2FJ7 C;  4M6B A;  3UTA A;  3B6F D;  5CP6 B;  3REH C;  5GXQ A;  4HGA C;  4Z66 C;  5AV6 B;  5CPI C;  3WA9 D;  3TU4 D;  1HQ3 B;  3AZG B;  4WU9 D;  3REK B;  4XUJ B;  2BYM A;  5B40 B;  3X1U C;  5B0Z B;  5AVB C;  2BYK B;  4NE6 A;  4NFT A;  3REL C;  3MNN B;  4EO5 C;  3AZK A;  4KGC B;  3AZH A;  1P3O B;  4Z66 D;  3KXB A;  5CPI D;  5B0Y A;  3C1B C;  3MGS C;  5BNX A;  1P3K A;  1KX3 B;  4H9Q A;  4X23 A;  5AVC A;  3B0D B;  5CPJ B;  5BS7 A;  1P3A B;  3REL D;  4XZQ B;  3WTP C;  5B1M C;  3WAA A;  4H9R B;  3WKJ C;  4JJN B;  1AOI D;  5CP6 C;  3O62 A;  1U35 D;  3AV2 A;  5JRG B;  1BH8 A;  4QLC B;  3LEL D;  1HQ3 C;  4H9P A;  3C1B D;  3AZG C;  2NZD C;  3B6F A;  3MGS D;  3REK C;  3LJA B;  5B0Z C;  3WA9 A;  3VH5 T;  5B2I B;  1P3G C;  4WU9 A;  3W96 D;  3WTP D;  5B1M D;  5KDM A;  3WKJ D;  3MNN C;  1EQZ B;  5DNN C;  4ZUX B;  1TZY C;  1P3O C;  5B33 B;  1M1A B;  3W98 C;  3AZF B;  5G49 B;  3AV1 B;  5CPK B;  1P3P B;  4WNN A;  5B24 B;  2NZD D;  5GXQ B;  1F66 D;  5DNM A;  4DRB A;  1KX3 C;  3AYW C;  4KHA A;  4Z66 A;  5GT0 B;  5CPI A;  1B6W A;  3B0D C;  3X1V A;  2CV5 C;  1KX5 C;  1P3A C;  4XZQ C;  5AV9 A;  2IO5 C;  4YS3 D;  3AN2 D;  5DNN D;  1TZY D;  3AZJ B;  3W98 D;  3R45 B;  1ZLA A;  3AZH B;  3LJA C;  1AOI A;  3MGP D;  4WU8 D;  3AYW D;  1U35 A;  5BNX B;  3A6N D;  3AZL D;  3LEL A;  2CV5 D;  4X23 B;  3MGS A;  4J8V B;  4H9O B;  4DRA A;  4G92 B;  2L5A A;  1P3F C;  5B32 G;  2PYO B;  1M1A C;  4H9N B;  1P34 D;  3W96 A;  5B24 C;  4AWL B;  3AZM C;  3X1S D;  3WKJ A;  1BH9 A;  3B6G D;  5JA4 B;  1N1J A;  4H9P B;  5GT0 C;  5B2J D;  3MVD C;  1ID3 B;  4H9S A;  1HTA A;  2NZD A;  1F66 A;  4Z5T A;  1P3F D;  1WWS A;  1M19 B;  4LD9 A;  5KDM B;  4R8P A;  5GT3 B;  5E5A B;  2ARO B;  5CHL B;  3AZM D;  3AN2 A;  4YS3 A;  1WWI A;  3KWQ B;  1P3M B;  1TZY A;  3C1C C;  3W98 A;  1P3I D;  3VH5 W;  3MVD D;  2HUE C;  4J8W B;  5DNM B;  3MGP A;  3X1V B;  2F8N B;  4WU8 A;  5GSU C;  3AZE C;  5AV9 B;  3LZ0 C;  5AV8 B;  3A6N A;  5B1L B;  4Z2M H;  3AZL A;  3X1T C;  5AY8 B;  4AWL C;  4E44 A;  5BNV B;  5B32 D;  3W97 B;  3C1C D;  1JFI A;  4J8X C;  1ZLA B;  1P34 A;  5F99 B;  1ID3 C;  1AOI B;  2NQB C;  2HIO D;  1KU5 A;  1TAF A;  5AV5 A;  3X1S A;  3B6G A;  3REI C;  3REJ C;  5GSU D;  5B2J A;  3LZ0 D;  3X1T D;  5B31 A;  1P3B B;  2FJ7 D;  5E5A C;  2ARO C;  3KWQ C;  5FUG B;  3AZN C;  3W96 B;  3REH D;  4G91 B;  1S32 C;  3LZ1 B;  3V9R B;  2NQB D;  3AZM A;  4J8U B;  3W99 C;  1KX4 A;  3REI D;  3MGQ C;  3KUY B;  3REJ D;  3X1U D;  1P3I A;  5AV8 C;  3MVD A;  5AVB D;  4Z5T B;  1M18 B;  5AY8 C;  3MGR B;  4YM6 B;  3UT9 B;  4LD9 B;  4R8P B;  3AZN D;  4UUZ A;  1S32 D;  4YS3 B;  5AV6 C;  5F99 C;  4KUD B;  4Z2M G;  1P3L B;  3W99 D;  5B32 A;  4XUJ C;  5B40 C;  3TU4 A;  2HIO A;  3AFA B;  1P3B C;  3AZI B;  4CSR B;  3UTB B;  5CP6 D;  3LZ0 A;  4KGC C;  3UTA B;  5AV6 D;  2FJ7 A;  1R4V A;  1HQ3 D;  3AZG D;  4J8U C;  1JFI B;  3REK D;  4XUJ D;  5B40 D;  3KUY C;  3REH A;  5AV5 B;  5B0Z D;  5CPJ C;  2NQB A;  2BYM B;  4ZBJ B;  1M18 C;  1P3G D;  4YM6 C;  3UT9 C;  3REI A;  5B31 B;  4JJN C;  3X1U A;  3MNN D;  1H3O A;  5AVB A;  4KGC D;  1P3O D;  5JRG C;  4QLC C;  3NQJ A;  3VH5 A;  3REL A;  4KUD C;  3AZK B;  1P3L C;  3KXB B;  3AZN A;  5B0Y B;  4CAY A;  1KX3 D;  1S32 A;  1KX4 B;  5CPJ D;  3AFA C;  1P3K B;  5B2I C;  3C1B A;  1KX5 D;  1P3A D;  4H9Q B;  4XZQ D;  3AZI C;  2F8N H;  5AVC B;  3W99 A;  1BFM A;  4JJN D;  3UTB C;  1EQZ C;  4ZUX C;  3UTA C;  5B33 C;  2YFW A;  5JRG D;  4WZS B;  4QLC D;  3AZF C;  3AV1 C;  5CPK C;  1P3P C;  3WAA B;  3WTP A;  5B1M A;  3O62 B;  5GXQ C;  3AV2 B;  3LJA D;  1BH8 B;  5CP6 A;  3B6F B;  2JSS A;  4ZBJ C;  1HQ3 A;  5B2I D;  3AZG A;  3REK A;  3VH6 W;  4XUJ A;  3WA9 B;  3TU4 B;  2HIO B;  5B0Z A;  1EQZ D;  4ZUX D;  4WU9 B;  2BYK A;  5B33 D;  1P3G A;  3AZJ C;  1M1A D;  3AZF D;  3AV1 D;  5CPK D;  1P3P D;  5B24 D;  5C3I B;  3AZH C;  5GXQ D;  3MNN A;  3KXB C;  2FJ7 B;  5DNN A;  4KGC A;  1P3O A;  4WNN B;  1ULY A;  5GT0 D;  1P3K C;  4X23 C;  4KHA B;  4Z66 B;  4J8V C;  4G92 C;  5CPI B;  1KX3 A;  3AYW A;  5CPJ A;  2CV5 A;  2PYO C;  3WAA C;  1P3A A;  3AZJ D;  4XZQ A;  1KX5 A;  5AVB B;  4H9R A;  4NE3 A;  3O62 C;  3AZH D;  3AV2 C;  3REL B;  2F8N G;  5JRG A;  4EO5 B;  1U35 B;  3LJA A;  4J8V D;  3LEL B;  3C1B B;  3AZE D;  4WU9 C;  1M19 C;  3MGS B;  2PYO D;  5B2I A;  5GT3 C;  2YFV A;  1P3F A;  2YFW B;  1P3M C;  1EQZ A;  4ZUX A;  3WTP B;  5B1M B;  5B33 A;  4J8X D;  1M1A A;  3WKJ B;  4J8W C;  1BH9 B;  5G49 A;  3AZF A;  3AV1 A;  5CPK A;  1P3P A;  5DNM C;  5B24 A;  1ID3 D;  1N1J B;  3X1V C;  2NZD B;  5GT0 A;  5AV9 C;  1M19 D;  1F66 B;  5B1L C;  5BO0 A;  5GT3 D;  5E5A D;  2ARO D;  3VH6 T;  1P3G B;  3KWQ D;  1P3M D;  3W97 C;  1ZLA C; 
#chains in the Genus database with same CATH topology
 3AZJ A;  3AN2 B;  4J8W D;  3NQU A;  1AOI C;  3R45 A;  5DNN B;  5DNM D;  1U35 C;  1TZY B;  3W98 B;  2ZY2 A;  3KSY A;  3MGQ D;  3X1V D;  3LEL C;  2F8N D;  4WJ3 C;  2F2A C;  3C1C A;  5AV9 D;  5AV8 D;  3MGP B;  5B1L D;  4WU8 B;  5AY8 D;  3AYW B;  3WAA B;  4J8V A;  4H9O A;  3A6N B;  3AZL B;  2CV5 B;  5GSU A;  1KX5 B;  2F8N K;  3AZE A;  1Q9C A;  2JCH A;  2IO5 B;  2LY8 A;  3W96 C;  3X1T A;  4G91 C;  1ZLA D;  2PYO A;  3W97 D;  3LZ1 C;  2Y2N A;  4H9N A;  2UWX A;  5F99 D;  3B0C T;  2CWE A;  3VH6 A;  5JA4 A;  1P34 B;  4H9S C;  3H0L C;  1TAF B;  4J8X A;  3X1S B;  4WV4 B;  1F66 C;  1ID3 A;  3B6G B;  4Z5T C;  3B0B A;  1P3B D;  3MGR C;  5B2J B;  3REJ A;  4LD9 C;  4R8P C;  1M19 A;  4YS3 C;  1B67 A;  2YFV B;  3LZ1 D;  3AN2 C;  1P3F B;  5GT3 A;  5E5A A;  2ARO A;  4J8U D;  3KWQ A;  1P3M A;  5B31 G;  3KUY D;  3AZM B;  4J8W A;  3MGP C;  4Z5T D;  1M18 D;  4WU8 C;  3MGR D;  4YM6 D;  3UT9 D;  1P3I B;  3A6N C;  3MVD B;  3MGQ A;  5BO0 B;  3AZL C;  2F8N A;  4LD9 D;  4R8P D;  5AV8 A;  5B1L A;  5AY8 A;  2W8S A;  2Y2H A;  4KUD D;  1P3L D;  4UUZ B;  5BNV A;  1P34 C;  3NQU B;  3W97 A;  5AV5 C;  3X1S C;  5AV6 A;  5F99 A;  3B6G C;  5B32 B;  3AFA D;  3C1C B;  2RVQ C;  3EPK A;  5B2J C;  3AZI D;  5B40 A;  2HUE B;  5B31 C;  3UTB D;  1A7W A;  3UTA D;  3WTP E;  1P3B A;  5GSU B;  3AZE B;  4NE5 A;  3AZK C;  3LZ0 B;  3X1T B;  5FUG A;  5B0Y C;  5AV5 D;  3LZ1 A;  3V9R A;  1KX4 C;  1F1E A;  3REH B;  2RVQ D;  4J8X B;  5AVC C;  4HGA B;  4J8U A;  4E45 A;  1P3I C;  3KUY A;  3AL0 C;  5BS7 C;  5B31 D;  2NQB B;  3REI B;  3B0C W;  3REJ B;  1M18 A;  3MGR A;  4YM6 A;  3X1U B;  3UT9 A;  1H3O B;  3H0R C;  5BT1 C;  3AZK D;  4JJN A;  3NQJ B;  3KXB D;  5B0Y D;  3B6F C;  4QLC A;  5B32 C;  1KX4 D;  4KUD A;  1P3K D;  3AZN B;  1P3L A;  4CAY B;  4X23 D;  1S32 B;  5AVC D;  3WA9 C;  3TU4 C;  2HIO C;  2Y2I A;  3W99 B;  3AFA A;  3MGQ B;  3WAA D;  3AZI A;  4CSR A;  5BT1 D;  5C3I C;  3O62 D;  3AV2 D;  3UTB A;  2FJ7 C;  4M6B A;  3UTA A;  3B6F D;  2BG1 A;  5CP6 B;  3REH C;  5GXQ A;  4HGA C;  4Z66 C;  5AV6 B;  5CPI C;  3WA9 D;  3TU4 D;  1HQ3 B;  3AZG B;  4WU9 D;  3REK B;  4XUJ B;  2BYM A;  5B40 B;  3X1U C;  5B0Z B;  5AVB C;  2BYK B;  4NE6 A;  4NFT A;  3REL C;  3MNN B;  4EO5 C;  3AZK A;  4KGC B;  3A1I A;  3AZH A;  1P3O B;  4Z66 D;  3KXB A;  5CPI D;  5B0Y A;  3C1B C;  2ZM5 A;  1Z2C B;  5BNX A;  3MGS C;  1P3K A;  1KX3 B;  4H9Q A;  4X23 A;  5AVC A;  3B0D B;  5CPJ B;  5BS7 A;  1P3A B;  3REL D;  4XZQ B;  3WTP C;  5B1M C;  3WAA A;  4H9R B;  3WKJ C;  4JJN B;  1AOI D;  5CP6 C;  3O62 A;  1U35 D;  3AV2 A;  5JRG B;  1BH8 A;  4QLC B;  3LEL D;  1HQ3 C;  4H9P A;  3C1B D;  3AZG C;  2NZD C;  3B6F A;  3MGS D;  3REK C;  3LJA B;  5B0Z C;  3WA9 A;  3VH5 T;  5B2I B;  1P3G C;  4WU9 A;  3W96 D;  3WTP D;  5B1M D;  2XD5 A;  5KDM A;  1PZR A;  2G5I C;  3WKJ D;  3MNN C;  1EQZ B;  5DNN C;  4ZUX B;  1TZY C;  1P3O C;  5B33 B;  1M1A B;  3F6T A;  3W98 C;  3AZF B;  5G49 B;  3AV1 B;  5CPK B;  1P3P B;  4WNN A;  5B24 B;  2NZD D;  5GXQ B;  1F66 D;  5DNM A;  4DRB A;  1KX3 C;  3AYW C;  4KHA A;  4Z66 A;  5GT0 B;  5CPI A;  1B6W A;  3B0D C;  3X1V A;  2CV5 C;  1KX5 C;  1P3A C;  4XZQ C;  5AV9 A;  2IO5 C;  4YS3 D;  3AN2 D;  5DNN D;  1TZY D;  3AZJ B;  3W98 D;  3R45 B;  1ZLA A;  2DQN C;  3AZH B;  3LJA C;  1AOI A;  3MGP D;  4WU8 D;  3AYW D;  1U35 A;  5BNX B;  3A6N D;  3AZL D;  3LEL A;  2CV5 D;  1W2E A;  4X23 B;  3MGS A;  2Y2K A;  4J8V B;  4H9O B;  4DRA A;  4G92 B;  2L5A A;  1P3F C;  2Y2Q A;  5B32 G;  2PYO B;  1M1A C;  4H9N B;  1P34 D;  3W96 A;  4UPK A;  5B24 C;  4AWL B;  3AZM C;  3X1S D;  3WKJ A;  1BH9 A;  3B6G D;  5JA4 B;  1N1J A;  4H9P B;  2ZY4 A;  5GT0 C;  5B2J D;  3MVD C;  1ID3 B;  4H9S A;  1HTA A;  2NZD A;  3A1K A;  1F66 A;  3EG5 B;  4Z5T A;  1P3F D;  1WWS A;  1M19 B;  4LD9 A;  5KDM B;  4R8P A;  5GT3 B;  5E5A B;  2ARO B;  5CHL B;  3AZM D;  3AN2 A;  4YS3 A;  1WWI A;  3KWQ B;  1P3M B;  1TZY A;  3C1C C;  3W98 A;  1P3I D;  3VH5 W;  3MVD D;  2HUE C;  4J8W B;  5DNM B;  3MGP A;  3X1V B;  4DQY B;  2F8N B;  4WU8 A;  2RIQ A;  5GSU C;  3AZE C;  5AV9 B;  3LZ0 C;  5AV8 B;  3A6N A;  5B1L B;  4Z2M H;  3AZL A;  1T3U A;  3X1T C;  5AY8 B;  4AWL C;  4E44 A;  5BNV B;  5B32 D;  3W97 B;  3C1C D;  1JFI A;  4J8X C;  2ZY3 A;  1ZLA B;  1P34 A;  5F99 B;  1ID3 C;  1AOI B;  2NQB C;  2HIO D;  1KU5 A;  1TAF A;  5AV5 A;  3X1S A;  3B6G A;  3REI C;  3REJ C;  5GSU D;  5B2J A;  3LZ0 D;  3X1T D;  5B31 A;  1P3B B;  2FJ7 D;  5E5A C;  2ARO C;  3KWQ C;  3EPL A;  5FUG B;  3AZN C;  3W96 B;  2ZY5 A;  3REH D;  4G91 B;  1S32 C;  3LZ1 B;  3V9R B;  2NQB D;  3AZM A;  4J8U B;  3W99 C;  1KX4 A;  3REI D;  3MGQ C;  3KUY B;  3REJ D;  3X1U D;  1P3I A;  3EPJ A;  5AV8 C;  3MVD A;  5AVB D;  4Z5T B;  1M18 B;  5AY8 C;  3MGR B;  4YM6 B;  3UT9 B;  4LD9 B;  4R8P B;  3AZN D;  4UUZ A;  1S32 D;  2JE5 A;  4YS3 B;  5AV6 C;  5F99 C;  4KUD B;  4Z2M G;  1P3L B;  3W99 D;  5B32 A;  4XUJ C;  5B40 C;  3TU4 A;  2HIO A;  3AFA B;  1P3B C;  3AZI B;  4CSR B;  2DF4 C;  3UTB B;  5CP6 D;  3LZ0 A;  4KGC C;  3UTA B;  5AV6 D;  2FJ7 A;  1R4V A;  1HQ3 D;  3AZG D;  4J8U C;  1JFI B;  3REK D;  4XUJ D;  5B40 D;  3KUY C;  3REH A;  5AV5 B;  5B0Z D;  5CPJ C;  2NQB A;  2BYM B;  4ZBJ B;  1M18 C;  1P3G D;  4YM6 C;  3UT9 C;  3REI A;  5B31 B;  4JJN C;  3X1U A;  3MNN D;  1H3O A;  5AVB A;  4KGC D;  1P3O D;  5JRG C;  4QLC C;  3NQJ A;  3VH5 A;  3REL A;  3P5J B;  4KUD C;  3AZK B;  2Y2O A;  1P3L C;  3FDD A;  3KXB B;  3AZN A;  5B0Y B;  4CAY A;  1KX3 D;  1S32 A;  1KX4 B;  5CPJ D;  3AFA C;  1P3K B;  5B2I C;  3C1B A;  1KX5 D;  1P3A D;  4H9Q B;  4XZQ D;  3AZI C;  2F8N H;  5AVC B;  3W99 A;  1BFM A;  4JJN D;  3UTB C;  1EQZ C;  4ZUX C;  3UTA C;  5B33 C;  2YFW A;  5JRG D;  4WZS B;  4QLC D;  3AZF C;  3H0M C;  3AV1 C;  5CPK C;  1P3P C;  2VQR A;  5B1M A;  3WTP A;  2J8P A;  3O62 B;  5GXQ C;  3AV2 B;  3LJA D;  1BH8 B;  5CP6 A;  2XD1 A;  2FFF B;  3B6F B;  2JSS A;  4ZBJ C;  1HQ3 A;  5B2I D;  3AZG A;  3REK A;  3VH6 W;  4XUJ A;  3WA9 B;  3TU4 B;  2HIO B;  5B0Z A;  1EQZ D;  4ZUX D;  4WU9 B;  2BYK A;  5B33 D;  1P3G A;  3AZJ C;  1M1A D;  3AZF D;  3AV1 D;  5CPK D;  1P3P D;  5B24 D;  5C3I B;  3AZH C;  5GXQ D;  3MNN A;  3KXB C;  2FJ7 B;  5DNN A;  4KGC A;  1P3O A;  4WNN B;  1ULY A;  5GT0 D;  1P3K C;  4X23 C;  4KHA B;  4Z66 B;  4J8V C;  4G92 C;  5CPI B;  2Y2G A;  1KX3 A;  3AYW A;  5CPJ A;  2CV5 A;  2PYO C;  3WAA C;  1P3A A;  3AZJ D;  2G5H C;  4XZQ A;  1KX5 A;  5AVB B;  4H9R A;  4NE3 A;  3O62 C;  3AZH D;  3AV2 C;  3REL B;  2F8N G;  5JRG A;  4EO5 B;  1U35 B;  3KFU G;  2Y2J A;  3LJA A;  4J8V D;  2Y2P A;  3LEL B;  3C1B B;  3AZE D;  4WU9 C;  1M19 C;  3MGS B;  3EPH A;  2PYO D;  5B2I A;  5GT3 C;  2YFV A;  1P3F A;  2YFW B;  1P3M C;  1EQZ A;  4ZUX A;  3WTP B;  5B1M B;  5B33 A;  2Y2M A;  4J8X D;  1M1A A;  3WKJ B;  4J8W C;  1BH9 B;  5G49 A;  3AZF A;  3AV1 A;  5CPK A;  1P3P A;  5DNM C;  5B24 A;  1ID3 D;  1N1J B;  2Y2L A;  3X1V C;  3IP4 C;  2NZD B;  5GT0 A;  5AV9 C;  1M19 D;  1F66 B;  5B1L C;  5BO0 A;  5GT3 D;  5E5A D;  2ARO D;  3VH6 T;  1P3G B;  3KWQ D;  1P3M D;  3W97 C;  1ZLA C; 
#chains in the Genus database with same CATH homology
 3AZJ A;  3AN2 B;  4J8W D;  3NQU A;  1AOI C;  3R45 A;  5DNN B;  5DNM D;  1U35 C;  1TZY B;  3W98 B;  2ZY2 A;  3KSY A;  3MGQ D;  3X1V D;  3LEL C;  2F8N D;  4WJ3 C;  2F2A C;  3C1C A;  5AV9 D;  5AV8 D;  3MGP B;  5B1L D;  4WU8 B;  5AY8 D;  3AYW B;  3WAA B;  4J8V A;  4H9O A;  3A6N B;  3AZL B;  2CV5 B;  5GSU A;  1KX5 B;  2F8N K;  3AZE A;  1Q9C A;  2JCH A;  2IO5 B;  2LY8 A;  3W96 C;  3X1T A;  4G91 C;  1ZLA D;  2PYO A;  3W97 D;  3LZ1 C;  2Y2N A;  4H9N A;  2UWX A;  5F99 D;  3B0C T;  2CWE A;  3VH6 A;  5JA4 A;  1P34 B;  4H9S C;  3H0L C;  1TAF B;  4J8X A;  3X1S B;  4WV4 B;  1F66 C;  1ID3 A;  3B6G B;  4Z5T C;  3B0B A;  1P3B D;  3MGR C;  5B2J B;  3REJ A;  4LD9 C;  4R8P C;  1M19 A;  4YS3 C;  1B67 A;  2YFV B;  3LZ1 D;  3AN2 C;  1P3F B;  5GT3 A;  5E5A A;  2ARO A;  4J8U D;  3KWQ A;  1P3M A;  5B31 G;  3KUY D;  3AZM B;  4J8W A;  3MGP C;  4Z5T D;  1M18 D;  4WU8 C;  3MGR D;  4YM6 D;  3UT9 D;  1P3I B;  3A6N C;  3MVD B;  3MGQ A;  5BO0 B;  3AZL C;  2F8N A;  4LD9 D;  4R8P D;  5AV8 A;  5B1L A;  5AY8 A;  2W8S A;  2Y2H A;  4KUD D;  1P3L D;  4UUZ B;  5BNV A;  1P34 C;  3NQU B;  3W97 A;  5AV5 C;  3X1S C;  5AV6 A;  5F99 A;  3B6G C;  5B32 B;  3AFA D;  3C1C B;  2RVQ C;  3EPK A;  5B2J C;  3AZI D;  5B40 A;  2HUE B;  5B31 C;  3UTB D;  1A7W A;  3UTA D;  3WTP E;  1P3B A;  5GSU B;  3AZE B;  4NE5 A;  3AZK C;  3LZ0 B;  3X1T B;  5FUG A;  5B0Y C;  5AV5 D;  3LZ1 A;  3V9R A;  1KX4 C;  1F1E A;  3REH B;  2RVQ D;  4J8X B;  5AVC C;  4HGA B;  4J8U A;  4E45 A;  1P3I C;  3KUY A;  3AL0 C;  5BS7 C;  5B31 D;  2NQB B;  3REI B;  3B0C W;  3REJ B;  1M18 A;  3MGR A;  4YM6 A;  3X1U B;  3UT9 A;  1H3O B;  3H0R C;  5BT1 C;  3AZK D;  4JJN A;  3NQJ B;  3KXB D;  5B0Y D;  3B6F C;  4QLC A;  5B32 C;  1KX4 D;  4KUD A;  1P3K D;  3AZN B;  1P3L A;  4CAY B;  4X23 D;  1S32 B;  5AVC D;  3WA9 C;  3TU4 C;  2HIO C;  2Y2I A;  3W99 B;  3AFA A;  3MGQ B;  3WAA D;  3AZI A;  4CSR A;  5BT1 D;  5C3I C;  3O62 D;  3AV2 D;  3UTB A;  2FJ7 C;  4M6B A;  3UTA A;  3B6F D;  2BG1 A;  5CP6 B;  3REH C;  5GXQ A;  4HGA C;  4Z66 C;  5AV6 B;  5CPI C;  3WA9 D;  3TU4 D;  1HQ3 B;  3AZG B;  4WU9 D;  3REK B;  4XUJ B;  2BYM A;  5B40 B;  3X1U C;  5B0Z B;  5AVB C;  2BYK B;  4NE6 A;  4NFT A;  3REL C;  3MNN B;  4EO5 C;  3AZK A;  4KGC B;  3A1I A;  3AZH A;  1P3O B;  4Z66 D;  3KXB A;  5CPI D;  5B0Y A;  3C1B C;  2ZM5 A;  1Z2C B;  5BNX A;  3MGS C;  1P3K A;  1KX3 B;  4H9Q A;  4X23 A;  5AVC A;  3B0D B;  5CPJ B;  5BS7 A;  1P3A B;  3REL D;  4XZQ B;  3WTP C;  5B1M C;  3WAA A;  4H9R B;  3WKJ C;  4JJN B;  1AOI D;  5CP6 C;  3O62 A;  1U35 D;  3AV2 A;  5JRG B;  1BH8 A;  4QLC B;  3LEL D;  1HQ3 C;  4H9P A;  3C1B D;  3AZG C;  2NZD C;  3B6F A;  3MGS D;  3REK C;  3LJA B;  5B0Z C;  3WA9 A;  3VH5 T;  5B2I B;  1P3G C;  4WU9 A;  3W96 D;  3WTP D;  5B1M D;  2XD5 A;  5KDM A;  1PZR A;  2G5I C;  3WKJ D;  3MNN C;  1EQZ B;  5DNN C;  4ZUX B;  1TZY C;  1P3O C;  5B33 B;  1M1A B;  3F6T A;  3W98 C;  3AZF B;  5G49 B;  3AV1 B;  5CPK B;  1P3P B;  4WNN A;  5B24 B;  2NZD D;  5GXQ B;  1F66 D;  5DNM A;  4DRB A;  1KX3 C;  3AYW C;  4KHA A;  4Z66 A;  5GT0 B;  5CPI A;  1B6W A;  3B0D C;  3X1V A;  2CV5 C;  1KX5 C;  1P3A C;  4XZQ C;  5AV9 A;  2IO5 C;  4YS3 D;  3AN2 D;  5DNN D;  1TZY D;  3AZJ B;  3W98 D;  3R45 B;  1ZLA A;  2DQN C;  3AZH B;  3LJA C;  1AOI A;  3MGP D;  4WU8 D;  3AYW D;  1U35 A;  5BNX B;  3A6N D;  3AZL D;  3LEL A;  2CV5 D;  1W2E A;  4X23 B;  3MGS A;  2Y2K A;  4J8V B;  4H9O B;  4DRA A;  4G92 B;  2L5A A;  1P3F C;  2Y2Q A;  5B32 G;  2PYO B;  1M1A C;  4H9N B;  1P34 D;  3W96 A;  4UPK A;  5B24 C;  4AWL B;  3AZM C;  3X1S D;  3WKJ A;  1BH9 A;  3B6G D;  5JA4 B;  1N1J A;  4H9P B;  2ZY4 A;  5GT0 C;  5B2J D;  3MVD C;  1ID3 B;  4H9S A;  1HTA A;  2NZD A;  3A1K A;  1F66 A;  3EG5 B;  4Z5T A;  1P3F D;  1WWS A;  1M19 B;  4LD9 A;  5KDM B;  4R8P A;  5GT3 B;  5E5A B;  2ARO B;  5CHL B;  3AZM D;  3AN2 A;  4YS3 A;  1WWI A;  3KWQ B;  1P3M B;  1TZY A;  3C1C C;  3W98 A;  1P3I D;  3VH5 W;  3MVD D;  2HUE C;  4J8W B;  5DNM B;  3MGP A;  3X1V B;  4DQY B;  2F8N B;  4WU8 A;  2RIQ A;  5GSU C;  3AZE C;  5AV9 B;  3LZ0 C;  5AV8 B;  3A6N A;  5B1L B;  4Z2M H;  3AZL A;  1T3U A;  3X1T C;  5AY8 B;  4AWL C;  4E44 A;  5BNV B;  5B32 D;  3W97 B;  3C1C D;  1JFI A;  4J8X C;  2ZY3 A;  1ZLA B;  1P34 A;  5F99 B;  1ID3 C;  1AOI B;  2NQB C;  2HIO D;  1KU5 A;  1TAF A;  5AV5 A;  3X1S A;  3B6G A;  3REI C;  3REJ C;  5GSU D;  5B2J A;  3LZ0 D;  3X1T D;  5B31 A;  1P3B B;  2FJ7 D;  5E5A C;  2ARO C;  3KWQ C;  3EPL A;  5FUG B;  3AZN C;  3W96 B;  2ZY5 A;  3REH D;  4G91 B;  1S32 C;  3LZ1 B;  3V9R B;  2NQB D;  3AZM A;  4J8U B;  3W99 C;  1KX4 A;  3REI D;  3MGQ C;  3KUY B;  3REJ D;  3X1U D;  1P3I A;  3EPJ A;  5AV8 C;  3MVD A;  5AVB D;  4Z5T B;  1M18 B;  5AY8 C;  3MGR B;  4YM6 B;  3UT9 B;  4LD9 B;  4R8P B;  3AZN D;  4UUZ A;  1S32 D;  2JE5 A;  4YS3 B;  5AV6 C;  5F99 C;  4KUD B;  4Z2M G;  1P3L B;  3W99 D;  5B32 A;  4XUJ C;  5B40 C;  3TU4 A;  2HIO A;  3AFA B;  1P3B C;  3AZI B;  4CSR B;  2DF4 C;  3UTB B;  5CP6 D;  3LZ0 A;  4KGC C;  3UTA B;  5AV6 D;  2FJ7 A;  1R4V A;  1HQ3 D;  3AZG D;  4J8U C;  1JFI B;  3REK D;  4XUJ D;  5B40 D;  3KUY C;  3REH A;  5AV5 B;  5B0Z D;  5CPJ C;  2NQB A;  2BYM B;  4ZBJ B;  1M18 C;  1P3G D;  4YM6 C;  3UT9 C;  3REI A;  5B31 B;  4JJN C;  3X1U A;  3MNN D;  1H3O A;  5AVB A;  4KGC D;  1P3O D;  5JRG C;  4QLC C;  3NQJ A;  3VH5 A;  3REL A;  3P5J B;  4KUD C;  3AZK B;  2Y2O A;  1P3L C;  3FDD A;  3KXB B;  3AZN A;  5B0Y B;  4CAY A;  1KX3 D;  1S32 A;  1KX4 B;  5CPJ D;  3AFA C;  1P3K B;  5B2I C;  3C1B A;  1KX5 D;  1P3A D;  4H9Q B;  4XZQ D;  3AZI C;  2F8N H;  5AVC B;  3W99 A;  1BFM A;  4JJN D;  3UTB C;  1EQZ C;  4ZUX C;  3UTA C;  5B33 C;  2YFW A;  5JRG D;  4WZS B;  4QLC D;  3AZF C;  3H0M C;  3AV1 C;  5CPK C;  1P3P C;  2VQR A;  5B1M A;  3WTP A;  2J8P A;  3O62 B;  5GXQ C;  3AV2 B;  3LJA D;  1BH8 B;  5CP6 A;  2XD1 A;  2FFF B;  3B6F B;  2JSS A;  4ZBJ C;  1HQ3 A;  5B2I D;  3AZG A;  3REK A;  3VH6 W;  4XUJ A;  3WA9 B;  3TU4 B;  2HIO B;  5B0Z A;  1EQZ D;  4ZUX D;  4WU9 B;  2BYK A;  5B33 D;  1P3G A;  3AZJ C;  1M1A D;  3AZF D;  3AV1 D;  5CPK D;  1P3P D;  5B24 D;  5C3I B;  3AZH C;  5GXQ D;  3MNN A;  3KXB C;  2FJ7 B;  5DNN A;  4KGC A;  1P3O A;  4WNN B;  1ULY A;  5GT0 D;  1P3K C;  4X23 C;  4KHA B;  4Z66 B;  4J8V C;  4G92 C;  5CPI B;  2Y2G A;  1KX3 A;  3AYW A;  5CPJ A;  2CV5 A;  2PYO C;  3WAA C;  1P3A A;  3AZJ D;  2G5H C;  4XZQ A;  1KX5 A;  5AVB B;  4H9R A;  4NE3 A;  3O62 C;  3AZH D;  3AV2 C;  3REL B;  2F8N G;  5JRG A;  4EO5 B;  1U35 B;  3KFU G;  2Y2J A;  3LJA A;  4J8V D;  2Y2P A;  3LEL B;  3C1B B;  3AZE D;  4WU9 C;  1M19 C;  3MGS B;  3EPH A;  2PYO D;  5B2I A;  5GT3 C;  2YFV A;  1P3F A;  2YFW B;  1P3M C;  1EQZ A;  4ZUX A;  3WTP B;  5B1M B;  5B33 A;  2Y2M A;  4J8X D;  1M1A A;  3WKJ B;  4J8W C;  1BH9 B;  5G49 A;  3AZF A;  3AV1 A;  5CPK A;  1P3P A;  5DNM C;  5B24 A;  1ID3 D;  1N1J B;  2Y2L A;  3X1V C;  3IP4 C;  2NZD B;  5GT0 A;  5AV9 C;  1M19 D;  1F66 B;  5B1L C;  5BO0 A;  5GT3 D;  5E5A D;  2ARO D;  3VH6 T;  1P3G B;  3KWQ D;  1P3M D;  3W97 C;  1ZLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...