5BNXB

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.3-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnxB00
5AVCA 3AZHC 5BNXA 1P34D 4WZSB 3REID 4EO5C 4Z66B 3KXBA 1M1AA 1P3GC 5GT3B 5B24D 3AV2C 5B33B 3C1CB 3REJC 3WKJD 5JRGC 3LJAA 3LELC 3REKA 3AZEC 2NZDB 3AZLB 5B1MB 5DNNB 5AV6D 4JJND 2F8NG 3MGPD 2CV5C 1A7WA 3KWQA 4AWLB 5B2IC 1P3OB 4Z66C 2YFVA 5B32G 1Q9CA 3REHA 3V9RB 5B31B 1KX3B 3WA9B 5GT3C 3LZ0B 3MGRB 5B33C 4XZQC 3C1CC 5B1LA 2BYKA 4DRAA 5AVBA 3X1UD 2BYKB 4XUJC 1U35B 2NZDC 1P3AD 3VH5W 3AZLC 1P3PA 5B1MC 5DNNC 3W96A 5B40A 4ZUXA 4YS3A 3X1TD 3AV1A 1EQZA 4J8UB 3UTAB 4AWLC 2L5AA 3LJAD 1P3OC 5GT0B 3W99B 3AFAD 3UT9C 1KX3C 5B0ZB 2IO5B 3WA9C 1KX4B 3LZ0C 3TU4A 3MGRC 4Z2MG 3X1VC 2AROA 2HUEC 3A6NB 3B6GA 3R45A 4NFTA 1ZLAB 2BYMB 4CAYB 1U35C 5GXQC 3REHD 3R45B 5AV8A 5F99B 3W97B 5B1LD 5GSUA 1P3BA 3B6FB 3UTBB 4J8UC 3UTAC 4WU9B 1AOIA 4KUDB 5C3IC 5GT0C 3AZKB 1P3KC 4YM6B 5B0ZC 4J8WB 2IO5C 4H9QB 3W96D 4R8PA 4YS3D 5B2JD 1KX4C 4H9SC 3MGQB 3W98B 4LD9A 3KUYA 2F8NK 5B0YD 3AYWC 3A6NC 5AY8D 3RELD 1KX5B 5AV9A 5AV5D 2NQBC 3NQUA 2RVQC 5AV9B 4Z5TB 2CWEA 4QLCD 3AZNB 4E44A 4J8VC 5F99C 3MNNA 3B6FC 1TZYB 3UTBC 4UUZB 1P3LC 5CPJC 2PYOB 4WU9C 3B6GD 1P3ID 3C1BA 4KUDC 3AZKC 4YM6C 1P3MD 3B0BA 3O62B 4H9NB 3AZJB 4E45A 1F1EA 4J8WC 5E5AC 1P3FB 3MVDA 1ID3D 5GSUD 3VH6W 3AZHA 4WU8B 3MGQC 4X23C 3W98C 5B32D 1M18C 1S32A 3AZID 3MGSB 3B0DC 1KX5C 3LZ1C 1HQ3A 1P3GA 3AV2A 4M6BA 3AZNC 4R8PD 3REJA 5BT1D 1F66B 5BNVA 1TZYC 5JRGA 3AZEA 3LELA 5BNVB 2PYOC 3AZGD 3X1SD 1P34B 5CP6D 3REIB 5CPID 5CPKC 3O62C 3AZJC 2CV5A 1P3FC 3MNND 4WU8C 5KDMB 3AN2C 4Z66A 3AZFC 3MGSC 5B2IB 4WV4B 5GT3A 4NE5A 5B33A 3C1CA 3MVDD 1F66C 4XZQB 4JJNB 1M19D 3MGPB 1S32D 3WTPD 2NZDA 3VH5A 1P34C 4XUJB 3REIC 3AZLA 1HQ3D 5B1MA 1N1JB 5DNNA 4KGCD 2FJ7D 3NQJB 1P3OA 4J8XD 2JSSA 3X1UB 3V9RA 5B31A 1KX3A 3AZMB 3UT9B 2HIOD 4NE3A 3WA9A 3LZ0A 3MGRA 5AV6C 4JJNC 3X1VB 5AVCD 3MGPC 2HUEB 4KHAB 1U35A 1TAFB 5GXQB 3KXBD 1M1AD 1BFMA 4J8UA 3UTAA 5GT0A 3W99A 3REKD 5C3IB 3X1UC 1P3KB 5B0ZA 5BO0B 3AZMC 1P3AC 1KX4A 3WTPE 5DNMB 4HGAB 3A6NA 3X1TC 3KWQD 1ZLAA 2BYMA 4CAYA 3AYWB 5B31D 3LJAC 2NQBB 3AFAC 5F99A 3W97A 4H9OB 3B6FA 4J8VB 3UTBA 3WAAB 5B2JB 4WU9A 4KUDA 1P3LB 5AVBD 5CPJB 3AZKA 5B0YB 4YM6A 4CSRA 3RELB 4J8WA 4H9QA 5AV5B 4CSRB 1P3PD 3VH6A 5E5AB 5B40D 5DNMC 4ZUXD 3MGQA 3W98A 4HGAC 3AV1D 1EQZD 4X23B 5B1LC 1KX5A 5GT0D 1M18B 3W99D 3B0DB 1P3IB 4Z5TA 3AZNA 3LZ1B 3VH5T 2F8NB 1KX4D 4WNNA 1TZYA 3W96C 4UUZA 3WAAC 4YS3C 5B2JC 3TU4D 1ID3B 2PYOA 4WNNB 1KU5A 1ZLAD 2AROD 5B32B 5B0YC 1BH8B 3AZIB 5AY8C 4H9NA 3O62A 3RELC 3AZJA 5AV8D 5AV5C 5CPKB 5F99D 1P3FA 3W97D 4WU8A 4QLCC 5G49B 3AN2A 1P3BD 3AZFA 3MGSA 2YFWB 3AN2B 1AOID 3AZFB 3AZGB 3B6GC 1P3IC 3X1SB 5CP6B 1P3MC 1F66A 5B31G 5JA4B 4ZBJB 1ID3C 4LD9D 5GSUC 3KUYD 1P34A 5B32C 3REIA 4H9PA 5AV9D 3AZIC 4Z5TD 3KSYA 4H9PB 5KDMA 4R8PC 1BH9B 5B24B 5BT1C 2F8NH 4NE6A 5B2IA 3C1BD 5FUGB 3WTPB 3AZGC 3WKJB 3X1SC 1JFIB 5CP6C 5CPIC 4H9RB 5AV6A 4XZQA 5CHLB 4DRBA 4JJNA 5AV6B 3MGPA 3AZHD 4ZBJC 3MNNC 2FJ7B 1HTAA 4XUJA 4J8XB 1N1JA 1P3GD 3AV2D 2HIOB 3NQJA 3REJD 1WWIA 3VH6T 3MVDC 5B24C 5JRGD 3AZED 3LELD 3X1UA 1M19C 5AVCB 1S32C 5BNXB 3AZMA 3UT9A 3WTPC 3WKJC 2LY8A 1P3AA 1HQ3C 3KXBB 1P3AB 4KGCC 1M1AB 3X1TA 3X1VA 2CV5D 4KHAA 1TAFA 4Z2MH 5B2ID 3X1TB 2FJ7C 4Z66D 5GXQA 4J8XC 3AFAA 1B6WA 3LJAB 3REKB 5BS7C 3AFAB 5GT3D 2HIOC 5B33D 4XZQD 3C1CD 1H3OA 4XUJD 3KWQB 5AVCC 1P3KA 5BO0A 1H3OB 2NZDD 3AZLD 5B1MD 3B0CW 5DNND 2YFVB 5DNMA 3REHB 3KXBC 4H9SA 1M1AC 3AYWA 1P3OD 5B1LB 5AVBB 3AZMD 2NQBA 3UT9D 3REKC 1KX3D 4H9OA 4J8VA 3WA9D 3LZ0D 3WAAA 3MGRD 5B2JA 1P3PB 3X1VD 3W96B 5B40B 4ZUXB 4YS3B 5CPJA 1P3LA 5B0YA 3AV1B 1EQZB 4G91B 5AY8A 1U35D 3RELA 5GXQD 3KWQC 5AV5A 5AY8B 5B31C 5E5AA 4QLCA 3REHC 4QLCB 4X23A 4J8UD 3UTAD 1M18A 3TU4B 1P3IA 1P3KD 2AROB 5AVBC 3LZ1A 3B6GB 5B0ZD 2F8NA 1P3MA 5DNMD 5AV8B 1P3MB 1P3PC 1ID3A 5B40C 4ZUXC 5B32A 3AYWD 3A6ND 5GSUB 1P3BB 3AV1C 1EQZC 1BH8A 1WWSA 4G91C 3AZIA 2NQBD 4G92B 3W99C 1AOIB 2RVQD 5CPKA 3B0CT 4J8VD 3WAAD 5G49A 1B67A 3B6FD 3UTBD 4R8PB 2YFWA 5CPJD 1P3LD 4WU9D 3TU4C 4KUDD 3AZGA 3KUYB 4LD9B 3X1SA 3AZKD 2AROC 1ZLAC 5CP6A 4YM6D 5CPIA 4J8WD 5E5AD 5JA4A 5CPIB 3NQUB 5AV8C 3W97C 3MGQD 4X23D 3W98D 1M18D 3MNNB 1KX5D 1P3BC 3LZ1D 4G92C 1AOIC 3C1BB 2F8ND 3AZND 1R4VA 1BH9A 5B24A 1TZYD 2PYOD 3MVDB 1M19A 3AZHB 5FUGA 3WTPA 3KUYC 1M19B 3WKJA 4EO5B 4LD9C 1JFIA 1S32B 5CPKD 3O62D 3AZJD 4H9RA 5AV9C 4Z5TC 4KGCA 1HQ3B 1P3FD 1P3GB 3AV2B 4WU8D 4KGCB 2FJ7A 3AN2D 3REJB 3AZFD 3MGSD 4J8XA 5JRGB 3AZEB 3LELB 5BS7A 3C1BC 2HIOA 1ULYA 1F66D 2CV5B
chains in the Genus database with same CATH superfamily
5AVCA 3AZHC 5BNXA 1P34D 4WZSB 3REID 4EO5C 4Z66B 3KXBA 1M1AA 2W8SA 1P3GC 5GT3B 5B24D 3AV2C 5B33B 3C1CB 3REJC 3WKJD 5JRGC 3LJAA 3LELC 3REKA 3AZEC 2NZDB 3AZLB 5B1MB 5DNNB 5AV6D 4JJND 2F8NG 3MGPD 2CV5C 1A7WA 3KWQA 4AWLB 5B2IC 1P3OB 4Z66C 2YFVA 5B32G 1Q9CA 3REHA 3V9RB 5B31B 1KX3B 3WA9B 5GT3C 3F6TA 3LZ0B 3MGRB 5B33C 4XZQC 3C1CC 5B1LA 2BYKA 2FFFB 3KFUG 4DRAA 5AVBA 3X1UD 2BYKB 4XUJC 1U35B 2NZDC 1P3AD 3VH5W 3AZLC 1P3PA 5B1MC 2Y2IA 5DNNC 3W96A 5B40A 4ZUXA 4YS3A 3X1TD 3AV1A 1EQZA 4J8UB 3UTAB 4AWLC 2L5AA 3LJAD 1P3OC 2ZY3A 5GT0B 3W99B 3AFAD 3UT9C 1KX3C 5B0ZB 2IO5B 2Y2KA 3WA9C 1KX4B 3LZ0C 3TU4A 3MGRC 4Z2MG 3X1VC 3EPHA 2AROA 2HUEC 3A6NB 3B6GA 3R45A 4NFTA 1ZLAB 2BYMB 4CAYB 1U35C 5GXQC 3EG5B 3REHD 3R45B 5AV8A 5F99B 3W97B 5B1LD 5GSUA 1P3BA 3B6FB 3UTBB 2Y2JA 4J8UC 3UTAC 4WU9B 1AOIA 4KUDB 5C3IC 5GT0C 3AZKB 1P3KC 4YM6B 5B0ZC 4J8WB 2IO5C 4H9QB 3EPLA 3W96D 4R8PA 4YS3D 5B2JD 1KX4C 4H9SC 3MGQB 3W98B 4LD9A 3KUYA 2F8NK 5B0YD 3AYWC 3A6NC 5AY8D 3RELD 2Y2NA 1KX5B 5AV9A 5AV5D 2NQBC 3NQUA 2RVQC 5AV9B 4Z5TB 2CWEA 4QLCD 3AZNB 4E44A 4J8VC 5F99C 3MNNA 3B6FC 1TZYB 3UTBC 4UUZB 1P3LC 5CPJC 2PYOB 4WU9C 3B6GD 1P3ID 3C1BA 4KUDC 3AZKC 4YM6C 1P3MD 3B0BA 3H0LC 4H9NB 3O62B 3AZJB 4E45A 1F1EA 4J8WC 5E5AC 1P3FB 3MVDA 1ID3D 5GSUD 3VH6W 3AZHA 4WU8B 3MGQC 4X23C 3W98C 5B32D 1M18C 1S32A 3AZID 3MGSB 3B0DC 1KX5C 3P5JB 3LZ1C 1HQ3A 1P3GA 3AV2A 4M6BA 3AZNC 4R8PD 2UWXA 2JE5A 3REJA 5BT1D 1F66B 5BNVA 2Y2LA 1TZYC 5JRGA 3AZEA 3LELA 5BNVB 2PYOC 2XD1A 3AZGD 3X1SD 1P34B 5CP6D 3REIB 5CPID 2G5IC 3O62C 3AZJC 5CPKC 2CV5A 1P3FC 3MNND 4WU8C 5KDMB 3AN2C 4Z66A 3AZFC 3MGSC 5B2IB 4WV4B 5GT3A 4NE5A 5B33A 3C1CA 3MVDD 1F66C 2Y2GA 4XZQB 4JJNB 1M19D 3MGPB 1S32D 3WTPD 2NZDA 3VH5A 1P34C 4XUJB 3REIC 3AZLA 1HQ3D 5B1MA 1N1JB 5DNNA 4KGCD 3H0MC 2FJ7D 3NQJB 1P3OA 4J8XD 2JSSA 3X1UB 3V9RA 5B31A 1KX3A 3AZMB 3UT9B 2HIOD 4NE3A 3WA9A 3LZ0A 3MGRA 5AV6C 4JJNC 3X1VB 5AVCD 3MGPC 2HUEB 4KHAB 1U35A 1TAFB 5GXQB 3KXBD 1M1AD 2Y2QA 1BFMA 4J8UA 3UTAA 5GT0A 3W99A 3REKD 5C3IB 3X1UC 1P3KB 5B0ZA 5BO0B 3AZMC 1P3AC 1KX4A 3WTPE 5DNMB 4HGAB 3A6NA 3X1TC 3KWQD 1ZLAA 2BYMA 4CAYA 3AYWB 3AL0C 5B31D 3LJAC 2NQBB 3AFAC 5F99A 2ZM5A 3W97A 4H9OB 3B6FA 4J8VB 3UTBA 3WAAB 5B2JB 1W2EA 4WU9A 4KUDA 1P3LB 5AVBD 5CPJB 2Y2PA 3AZKA 5B0YB 4YM6A 4CSRA 3RELB 4J8WA 2Y2OA 4H9QA 5AV5B 4CSRB 1P3PD 1Z2CB 3VH6A 5E5AB 5B40D 5DNMC 4ZUXD 3MGQA 3W98A 4HGAC 3AV1D 1EQZD 4X23B 5B1LC 1KX5A 5GT0D 1M18B 2DQNC 3W99D 3B0DB 1P3IB 4Z5TA 3AZNA 3LZ1B 3VH5T 2F8NB 1KX4D 3IP4C 1TZYA 4WNNA 3W96C 4UUZA 3WAAC 4YS3C 5B2JC 3TU4D 1ID3B 2PYOA 4WNNB 1KU5A 1ZLAD 2AROD 2JCHA 5B32B 5B0YC 1BH8B 3AZIB 5AY8C 4H9NA 3O62A 3RELC 3AZJA 5AV8D 5AV5C 5CPKB 5F99D 1P3FA 2RIQA 3W97D 4WU8A 4QLCC 5G49B 3AN2A 1T3UA 1P3BD 3AZFA 3MGSA 2YFWB 3AN2B 1AOID 3AZFB 3AZGB 3B6GC 1P3IC 3X1SB 5CP6B 1P3MC 1F66A 2DF4C 3EPKA 5B31G 5JA4B 4WJ3C 4ZBJB 1ID3C 4LD9D 5GSUC 3KUYD 1P34A 5B32C 3REIA 4H9PA 5AV9D 3AZIC 4Z5TD 3KSYA 4H9PB 5KDMA 4R8PC 1BH9B 5B24B 5BT1C 2F8NH 4NE6A 5B2IA 3C1BD 5FUGB 3WTPB 3AZGC 3WKJB 3X1SC 1JFIB 5CP6C 5CPIC 4H9RB 5AV6A 2Y2HA 4XZQA 5CHLB 4DRBA 4JJNA 5AV6B 3MGPA 3AZHD 4ZBJC 3MNNC 2FJ7B 1HTAA 4XUJA 4J8XB 1N1JA 1P3GD 3AV2D 2HIOB 3NQJA 3REJD 1WWIA 3VH6T 3MVDC 5B24C 5JRGD 3AZED 3LELD 3X1UA 1M19C 2ZY2A 5AVCB 1S32C 5BNXB 3AZMA 3UT9A 3WTPC 3WKJC 2LY8A 1P3AA 4UPKA 1HQ3C 3KXBB 1P3AB 4KGCC 1M1AB 3X1TA 3X1VA 2CV5D 4KHAA 1TAFA 4Z2MH 5B2ID 3X1TB 2FJ7C 4Z66D 5GXQA 4J8XC 3AFAA 1B6WA 3LJAB 3REKB 5BS7C 2F2AC 3A1KA 3AFAB 5GT3D 2HIOC 5B33D 3FDDA 4XZQD 3C1CD 1H3OA 4XUJD 3KWQB 5AVCC 1P3KA 5BO0A 1H3OB 2NZDD 3AZLD 5B1MD 3B0CW 5DNND 2YFVB 5DNMA 3REHB 3KXBC 3H0RC 4H9SA 3EPJA 1M1AC 3AYWA 1P3OD 5B1LB 5AVBB 3AZMD 2NQBA 3UT9D 3REKC 1KX3D 4H9OA 4J8VA 3WA9D 3LZ0D 3WAAA 3A1IA 5B2JA 3MGRD 1P3PB 3X1VD 3W96B 5B40B 4ZUXB 4YS3B 5CPJA 1P3LA 5B0YA 3AV1B 1EQZB 4G91B 5AY8A 1U35D 3RELA 5GXQD 3KWQC 5AV5A 5AY8B 5B31C 5E5AA 4QLCA 3REHC 4QLCB 4X23A 4J8UD 3UTAD 1M18A 3TU4B 2ZY5A 1P3IA 1P3KD 2AROB 5AVBC 3LZ1A 3B6GB 5B0ZD 2F8NA 1P3MA 5DNMD 5AV8B 1P3MB 1P3PC 1ID3A 5B40C 4ZUXC 5B32A 3AYWD 3A6ND 5GSUB 2ZY4A 1P3BB 3AV1C 1EQZC 1BH8A 1WWSA 2VQRA 4G91C 3AZIA 2NQBD 4G92B 3W99C 1AOIB 2RVQD 5CPKA 3B0CT 4J8VD 3WAAD 5G49A 1B67A 3B6FD 3UTBD 4R8PB 2YFWA 5CPJD 1P3LD 4WU9D 3TU4C 4KUDD 3AZGA 3KUYB 4LD9B 3X1SA 3AZKD 2AROC 1ZLAC 5CP6A 4YM6D 5CPIA 2Y2MA 4J8WD 5E5AD 5JA4A 5CPIB 3NQUB 5AV8C 3W97C 3MGQD 4X23D 3W98D 2XD5A 1M18D 3MNNB 1KX5D 1P3BC 2BG1A 2J8PA 3LZ1D 4G92C 1AOIC 3C1BB 2F8ND 4DQYB 3AZND 1R4VA 1BH9A 5B24A 1TZYD 2PYOD 3MVDB 1M19A 3AZHB 5FUGA 3WTPA 3KUYC 1M19B 3WKJA 4EO5B 4LD9C 1JFIA 1S32B 5CPKD 3O62D 3AZJD 4H9RA 5AV9C 4Z5TC 4KGCA 1HQ3B 1P3FD 1P3GB 3AV2B 4WU8D 4KGCB 2FJ7A 3AN2D 2G5HC 3REJB 3AZFD 3MGSD 4J8XA 5JRGB 3AZEB 3LELB 5BS7A 1PZRA 3C1BC 2HIOA 1ULYA 1F66D 2CV5B
chains in the Genus database with same CATH topology
5AVCA 3AZHC 5BNXA 1P34D 4WZSB 3REID 4EO5C 4Z66B 3KXBA 1M1AA 2W8SA 1P3GC 5GT3B 5B24D 3AV2C 5B33B 3C1CB 3REJC 3WKJD 5JRGC 3LJAA 3LELC 3REKA 3AZEC 2NZDB 3AZLB 5B1MB 5DNNB 5AV6D 4JJND 2F8NG 3MGPD 2CV5C 1A7WA 3KWQA 4AWLB 5B2IC 1P3OB 4Z66C 2YFVA 5B32G 1Q9CA 3REHA 3V9RB 5B31B 1KX3B 3WA9B 5GT3C 3F6TA 3LZ0B 3MGRB 5B33C 4XZQC 3C1CC 5B1LA 2BYKA 2FFFB 3KFUG 4DRAA 5AVBA 3X1UD 2BYKB 4XUJC 1U35B 2NZDC 1P3AD 3VH5W 3AZLC 1P3PA 5B1MC 2Y2IA 5DNNC 3W96A 5B40A 4ZUXA 4YS3A 3X1TD 3AV1A 1EQZA 4J8UB 3UTAB 4AWLC 2L5AA 3LJAD 1P3OC 2ZY3A 5GT0B 3W99B 3AFAD 3UT9C 1KX3C 5B0ZB 2IO5B 2Y2KA 3WA9C 1KX4B 3LZ0C 3TU4A 3MGRC 4Z2MG 3X1VC 3EPHA 2AROA 2HUEC 3A6NB 3B6GA 3R45A 4NFTA 1ZLAB 2BYMB 4CAYB 1U35C 5GXQC 3EG5B 3REHD 3R45B 5AV8A 5F99B 3W97B 5B1LD 5GSUA 1P3BA 3B6FB 3UTBB 2Y2JA 4J8UC 3UTAC 4WU9B 1AOIA 4KUDB 5C3IC 5GT0C 3AZKB 1P3KC 4YM6B 5B0ZC 4J8WB 2IO5C 4H9QB 3EPLA 3W96D 4R8PA 4YS3D 5B2JD 1KX4C 4H9SC 3MGQB 3W98B 4LD9A 3KUYA 2F8NK 5B0YD 3AYWC 3A6NC 5AY8D 3RELD 2Y2NA 1KX5B 5AV9A 5AV5D 2NQBC 3NQUA 2RVQC 5AV9B 4Z5TB 2CWEA 4QLCD 3AZNB 4E44A 4J8VC 5F99C 3MNNA 3B6FC 1TZYB 3UTBC 4UUZB 1P3LC 5CPJC 2PYOB 4WU9C 3B6GD 1P3ID 3C1BA 4KUDC 3AZKC 4YM6C 1P3MD 3B0BA 3H0LC 4H9NB 3O62B 3AZJB 4E45A 1F1EA 4J8WC 5E5AC 1P3FB 3MVDA 1ID3D 5GSUD 3VH6W 3AZHA 4WU8B 3MGQC 4X23C 3W98C 5B32D 1M18C 1S32A 3AZID 3MGSB 3B0DC 1KX5C 3P5JB 3LZ1C 1HQ3A 1P3GA 3AV2A 4M6BA 3AZNC 4R8PD 2UWXA 2JE5A 3REJA 5BT1D 1F66B 5BNVA 2Y2LA 1TZYC 5JRGA 3AZEA 3LELA 5BNVB 2PYOC 2XD1A 3AZGD 3X1SD 1P34B 5CP6D 3REIB 5CPID 2G5IC 3O62C 3AZJC 5CPKC 2CV5A 1P3FC 3MNND 4WU8C 5KDMB 3AN2C 4Z66A 3AZFC 3MGSC 5B2IB 4WV4B 5GT3A 4NE5A 5B33A 3C1CA 3MVDD 1F66C 2Y2GA 4XZQB 4JJNB 1M19D 3MGPB 1S32D 3WTPD 2NZDA 3VH5A 1P34C 4XUJB 3REIC 3AZLA 1HQ3D 5B1MA 1N1JB 5DNNA 4KGCD 3H0MC 2FJ7D 3NQJB 1P3OA 4J8XD 2JSSA 3X1UB 3V9RA 5B31A 1KX3A 3AZMB 3UT9B 2HIOD 4NE3A 3WA9A 3LZ0A 3MGRA 5AV6C 4JJNC 3X1VB 5AVCD 3MGPC 2HUEB 4KHAB 1U35A 1TAFB 5GXQB 3KXBD 1M1AD 2Y2QA 1BFMA 4J8UA 3UTAA 5GT0A 3W99A 3REKD 5C3IB 3X1UC 1P3KB 5B0ZA 5BO0B 3AZMC 1P3AC 1KX4A 3WTPE 5DNMB 4HGAB 3A6NA 3X1TC 3KWQD 1ZLAA 2BYMA 4CAYA 3AYWB 3AL0C 5B31D 3LJAC 2NQBB 3AFAC 5F99A 2ZM5A 3W97A 4H9OB 3B6FA 4J8VB 3UTBA 3WAAB 5B2JB 1W2EA 4WU9A 4KUDA 1P3LB 5AVBD 5CPJB 2Y2PA 3AZKA 5B0YB 4YM6A 4CSRA 3RELB 4J8WA 2Y2OA 4H9QA 5AV5B 4CSRB 1P3PD 1Z2CB 3VH6A 5E5AB 5B40D 5DNMC 4ZUXD 3MGQA 3W98A 4HGAC 3AV1D 1EQZD 4X23B 5B1LC 1KX5A 5GT0D 1M18B 2DQNC 3W99D 3B0DB 1P3IB 4Z5TA 3AZNA 3LZ1B 3VH5T 2F8NB 1KX4D 3IP4C 1TZYA 4WNNA 3W96C 4UUZA 3WAAC 4YS3C 5B2JC 3TU4D 1ID3B 2PYOA 4WNNB 1KU5A 1ZLAD 2AROD 2JCHA 5B32B 5B0YC 1BH8B 3AZIB 5AY8C 4H9NA 3O62A 3RELC 3AZJA 5AV8D 5AV5C 5CPKB 5F99D 1P3FA 2RIQA 3W97D 4WU8A 4QLCC 5G49B 3AN2A 1T3UA 1P3BD 3AZFA 3MGSA 2YFWB 3AN2B 1AOID 3AZFB 3AZGB 3B6GC 1P3IC 3X1SB 5CP6B 1P3MC 1F66A 2DF4C 3EPKA 5B31G 5JA4B 4WJ3C 4ZBJB 1ID3C 4LD9D 5GSUC 3KUYD 1P34A 5B32C 3REIA 4H9PA 5AV9D 3AZIC 4Z5TD 3KSYA 4H9PB 5KDMA 4R8PC 1BH9B 5B24B 5BT1C 2F8NH 4NE6A 5B2IA 3C1BD 5FUGB 3WTPB 3AZGC 3WKJB 3X1SC 1JFIB 5CP6C 5CPIC 4H9RB 5AV6A 2Y2HA 4XZQA 5CHLB 4DRBA 4JJNA 5AV6B 3MGPA 3AZHD 4ZBJC 3MNNC 2FJ7B 1HTAA 4XUJA 4J8XB 1N1JA 1P3GD 3AV2D 2HIOB 3NQJA 3REJD 1WWIA 3VH6T 3MVDC 5B24C 5JRGD 3AZED 3LELD 3X1UA 1M19C 2ZY2A 5AVCB 1S32C 5BNXB 3AZMA 3UT9A 3WTPC 3WKJC 2LY8A 1P3AA 4UPKA 1HQ3C 3KXBB 1P3AB 4KGCC 1M1AB 3X1TA 3X1VA 2CV5D 4KHAA 1TAFA 4Z2MH 5B2ID 3X1TB 2FJ7C 4Z66D 5GXQA 4J8XC 3AFAA 1B6WA 3LJAB 3REKB 5BS7C 2F2AC 3A1KA 3AFAB 5GT3D 2HIOC 5B33D 3FDDA 4XZQD 3C1CD 1H3OA 4XUJD 3KWQB 5AVCC 1P3KA 5BO0A 1H3OB 2NZDD 3AZLD 5B1MD 3B0CW 5DNND 2YFVB 5DNMA 3REHB 3KXBC 3H0RC 4H9SA 3EPJA 1M1AC 3AYWA 1P3OD 5B1LB 5AVBB 3AZMD 2NQBA 3UT9D 3REKC 1KX3D 4H9OA 4J8VA 3WA9D 3LZ0D 3WAAA 3A1IA 5B2JA 3MGRD 1P3PB 3X1VD 3W96B 5B40B 4ZUXB 4YS3B 5CPJA 1P3LA 5B0YA 3AV1B 1EQZB 4G91B 5AY8A 1U35D 3RELA 5GXQD 3KWQC 5AV5A 5AY8B 5B31C 5E5AA 4QLCA 3REHC 4QLCB 4X23A 4J8UD 3UTAD 1M18A 3TU4B 2ZY5A 1P3IA 1P3KD 2AROB 5AVBC 3LZ1A 3B6GB 5B0ZD 2F8NA 1P3MA 5DNMD 5AV8B 1P3MB 1P3PC 1ID3A 5B40C 4ZUXC 5B32A 3AYWD 3A6ND 5GSUB 2ZY4A 1P3BB 3AV1C 1EQZC 1BH8A 1WWSA 2VQRA 4G91C 3AZIA 2NQBD 4G92B 3W99C 1AOIB 2RVQD 5CPKA 3B0CT 4J8VD 3WAAD 5G49A 1B67A 3B6FD 3UTBD 4R8PB 2YFWA 5CPJD 1P3LD 4WU9D 3TU4C 4KUDD 3AZGA 3KUYB 4LD9B 3X1SA 3AZKD 2AROC 1ZLAC 5CP6A 4YM6D 5CPIA 2Y2MA 4J8WD 5E5AD 5JA4A 5CPIB 3NQUB 5AV8C 3W97C 3MGQD 4X23D 3W98D 2XD5A 1M18D 3MNNB 1KX5D 1P3BC 2BG1A 2J8PA 3LZ1D 4G92C 1AOIC 3C1BB 2F8ND 4DQYB 3AZND 1R4VA 1BH9A 5B24A 1TZYD 2PYOD 3MVDB 1M19A 3AZHB 5FUGA 3WTPA 3KUYC 1M19B 3WKJA 4EO5B 4LD9C 1JFIA 1S32B 5CPKD 3O62D 3AZJD 4H9RA 5AV9C 4Z5TC 4KGCA 1HQ3B 1P3FD 1P3GB 3AV2B 4WU8D 4KGCB 2FJ7A 3AN2D 2G5HC 3REJB 3AZFD 3MGSD 4J8XA 5JRGB 3AZEB 3LELB 5BS7A 1PZRA 3C1BC 2HIOA 1ULYA 1F66D 2CV5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC A;  3AZH C;  5BNX A;  1P34 D;  4WZS B;  3REI D;  4EO5 C;  4Z66 B;  3KXB A;  1M1A A;  1P3G C;  5GT3 B;  5B24 D;  3AV2 C;  5B33 B;  3C1C B;  3REJ C;  3WKJ D;  5JRG C;  3LJA A;  3LEL C;  3REK A;  3AZE C;  2NZD B;  3AZL B;  5B1M B;  5DNN B;  5AV6 D;  4JJN D;  2F8N G;  3MGP D;  2CV5 C;  1A7W A;  3KWQ A;  4AWL B;  5B2I C;  1P3O B;  4Z66 C;  2YFV A;  5B32 G;  1Q9C A;  3REH A;  3V9R B;  5B31 B;  1KX3 B;  3WA9 B;  5GT3 C;  3LZ0 B;  3MGR B;  5B33 C;  4XZQ C;  3C1C C;  5B1L A;  2BYK A;  4DRA A;  5AVB A;  3X1U D;  2BYK B;  4XUJ C;  1U35 B;  2NZD C;  1P3A D;  3VH5 W;  3AZL C;  1P3P A;  5B1M C;  5DNN C;  3W96 A;  5B40 A;  4ZUX A;  4YS3 A;  3X1T D;  3AV1 A;  1EQZ A;  4J8U B;  3UTA B;  4AWL C;  2L5A A;  3LJA D;  1P3O C;  5GT0 B;  3W99 B;  3AFA D;  3UT9 C;  1KX3 C;  5B0Z B;  2IO5 B;  3WA9 C;  1KX4 B;  3LZ0 C;  3TU4 A;  3MGR C;  4Z2M G;  3X1V C;  2ARO A;  2HUE C;  3A6N B;  3B6G A;  3R45 A;  4NFT A;  1ZLA B;  2BYM B;  4CAY B;  1U35 C;  5GXQ C;  3REH D;  3R45 B;  5AV8 A;  5F99 B;  3W97 B;  5B1L D;  5GSU A;  1P3B A;  3B6F B;  3UTB B;  4J8U C;  3UTA C;  4WU9 B;  1AOI A;  4KUD B;  5C3I C;  5GT0 C;  3AZK B;  1P3K C;  4YM6 B;  5B0Z C;  4J8W B;  2IO5 C;  4H9Q B;  3W96 D;  4R8P A;  4YS3 D;  5B2J D;  1KX4 C;  4H9S C;  3MGQ B;  3W98 B;  4LD9 A;  3KUY A;  2F8N K;  5B0Y D;  3AYW C;  3A6N C;  5AY8 D;  3REL D;  1KX5 B;  5AV9 A;  5AV5 D;  2NQB C;  3NQU A;  2RVQ C;  5AV9 B;  4Z5T B;  2CWE A;  4QLC D;  3AZN B;  4E44 A;  4J8V C;  5F99 C;  3MNN A;  3B6F C;  1TZY B;  3UTB C;  4UUZ B;  1P3L C;  5CPJ C;  2PYO B;  4WU9 C;  3B6G D;  1P3I D;  3C1B A;  4KUD C;  3AZK C;  4YM6 C;  1P3M D;  3B0B A;  3O62 B;  4H9N B;  3AZJ B;  4E45 A;  1F1E A;  4J8W C;  5E5A C;  1P3F B;  3MVD A;  1ID3 D;  5GSU D;  3VH6 W;  3AZH A;  4WU8 B;  3MGQ C;  4X23 C;  3W98 C;  5B32 D;  1M18 C;  1S32 A;  3AZI D;  3MGS B;  3B0D C;  1KX5 C;  3LZ1 C;  1HQ3 A;  1P3G A;  3AV2 A;  4M6B A;  3AZN C;  4R8P D;  3REJ A;  5BT1 D;  1F66 B;  5BNV A;  1TZY C;  5JRG A;  3AZE A;  3LEL A;  5BNV B;  2PYO C;  3AZG D;  3X1S D;  1P34 B;  5CP6 D;  3REI B;  5CPI D;  5CPK C;  3O62 C;  3AZJ C;  2CV5 A;  1P3F C;  3MNN D;  4WU8 C;  5KDM B;  3AN2 C;  4Z66 A;  3AZF C;  3MGS C;  5B2I B;  4WV4 B;  5GT3 A;  4NE5 A;  5B33 A;  3C1C A;  3MVD D;  1F66 C;  4XZQ B;  4JJN B;  1M19 D;  3MGP B;  1S32 D;  3WTP D;  2NZD A;  3VH5 A;  1P34 C;  4XUJ B;  3REI C;  3AZL A;  1HQ3 D;  5B1M A;  1N1J B;  5DNN A;  4KGC D;  2FJ7 D;  3NQJ B;  1P3O A;  4J8X D;  2JSS A;  3X1U B;  3V9R A;  5B31 A;  1KX3 A;  3AZM B;  3UT9 B;  2HIO D;  4NE3 A;  3WA9 A;  3LZ0 A;  3MGR A;  5AV6 C;  4JJN C;  3X1V B;  5AVC D;  3MGP C;  2HUE B;  4KHA B;  1U35 A;  1TAF B;  5GXQ B;  3KXB D;  1M1A D;  1BFM A;  4J8U A;  3UTA A;  5GT0 A;  3W99 A;  3REK D;  5C3I B;  3X1U C;  1P3K B;  5B0Z A;  5BO0 B;  3AZM C;  1P3A C;  1KX4 A;  3WTP E;  5DNM B;  4HGA B;  3A6N A;  3X1T C;  3KWQ D;  1ZLA A;  2BYM A;  4CAY A;  3AYW B;  5B31 D;  3LJA C;  2NQB B;  3AFA C;  5F99 A;  3W97 A;  4H9O B;  3B6F A;  4J8V B;  3UTB A;  3WAA B;  5B2J B;  4WU9 A;  4KUD A;  1P3L B;  5AVB D;  5CPJ B;  3AZK A;  5B0Y B;  4YM6 A;  4CSR A;  3REL B;  4J8W A;  4H9Q A;  5AV5 B;  4CSR B;  1P3P D;  3VH6 A;  5E5A B;  5B40 D;  5DNM C;  4ZUX D;  3MGQ A;  3W98 A;  4HGA C;  3AV1 D;  1EQZ D;  4X23 B;  5B1L C;  1KX5 A;  5GT0 D;  1M18 B;  3W99 D;  3B0D B;  1P3I B;  4Z5T A;  3AZN A;  3LZ1 B;  3VH5 T;  2F8N B;  1KX4 D;  4WNN A;  1TZY A;  3W96 C;  4UUZ A;  3WAA C;  4YS3 C;  5B2J C;  3TU4 D;  1ID3 B;  2PYO A;  4WNN B;  1KU5 A;  1ZLA D;  2ARO D;  5B32 B;  5B0Y C;  1BH8 B;  3AZI B;  5AY8 C;  4H9N A;  3O62 A;  3REL C;  3AZJ A;  5AV8 D;  5AV5 C;  5CPK B;  5F99 D;  1P3F A;  3W97 D;  4WU8 A;  4QLC C;  5G49 B;  3AN2 A;  1P3B D;  3AZF A;  3MGS A;  2YFW B;  3AN2 B;  1AOI D;  3AZF B;  3AZG B;  3B6G C;  1P3I C;  3X1S B;  5CP6 B;  1P3M C;  1F66 A;  5B31 G;  5JA4 B;  4ZBJ B;  1ID3 C;  4LD9 D;  5GSU C;  3KUY D;  1P34 A;  5B32 C;  3REI A;  4H9P A;  5AV9 D;  3AZI C;  4Z5T D;  3KSY A;  4H9P B;  5KDM A;  4R8P C;  1BH9 B;  5B24 B;  5BT1 C;  2F8N H;  4NE6 A;  5B2I A;  3C1B D;  5FUG B;  3WTP B;  3AZG C;  3WKJ B;  3X1S C;  1JFI B;  5CP6 C;  5CPI C;  4H9R B;  5AV6 A;  4XZQ A;  5CHL B;  4DRB A;  4JJN A;  5AV6 B;  3MGP A;  3AZH D;  4ZBJ C;  3MNN C;  2FJ7 B;  1HTA A;  4XUJ A;  4J8X B;  1N1J A;  1P3G D;  3AV2 D;  2HIO B;  3NQJ A;  3REJ D;  1WWI A;  3VH6 T;  3MVD C;  5B24 C;  5JRG D;  3AZE D;  3LEL D;  3X1U A;  1M19 C;  5AVC B;  1S32 C;  5BNX B;  3AZM A;  3UT9 A;  3WTP C;  3WKJ C;  2LY8 A;  1P3A A;  1HQ3 C;  3KXB B;  1P3A B;  4KGC C;  1M1A B;  3X1T A;  3X1V A;  2CV5 D;  4KHA A;  1TAF A;  4Z2M H;  5B2I D;  3X1T B;  2FJ7 C;  4Z66 D;  5GXQ A;  4J8X C;  3AFA A;  1B6W A;  3LJA B;  3REK B;  5BS7 C;  3AFA B;  5GT3 D;  2HIO C;  5B33 D;  4XZQ D;  3C1C D;  1H3O A;  4XUJ D;  3KWQ B;  5AVC C;  1P3K A;  5BO0 A;  1H3O B;  2NZD D;  3AZL D;  5B1M D;  3B0C W;  5DNN D;  2YFV B;  5DNM A;  3REH B;  3KXB C;  4H9S A;  1M1A C;  3AYW A;  1P3O D;  5B1L B;  5AVB B;  3AZM D;  2NQB A;  3UT9 D;  3REK C;  1KX3 D;  4H9O A;  4J8V A;  3WA9 D;  3LZ0 D;  3WAA A;  3MGR D;  5B2J A;  1P3P B;  3X1V D;  3W96 B;  5B40 B;  4ZUX B;  4YS3 B;  5CPJ A;  1P3L A;  5B0Y A;  3AV1 B;  1EQZ B;  4G91 B;  5AY8 A;  1U35 D;  3REL A;  5GXQ D;  3KWQ C;  5AV5 A;  5AY8 B;  5B31 C;  5E5A A;  4QLC A;  3REH C;  4QLC B;  4X23 A;  4J8U D;  3UTA D;  1M18 A;  3TU4 B;  1P3I A;  1P3K D;  2ARO B;  5AVB C;  3LZ1 A;  3B6G B;  5B0Z D;  2F8N A;  1P3M A;  5DNM D;  5AV8 B;  1P3M B;  1P3P C;  1ID3 A;  5B40 C;  4ZUX C;  5B32 A;  3AYW D;  3A6N D;  5GSU B;  1P3B B;  3AV1 C;  1EQZ C;  1BH8 A;  1WWS A;  4G91 C;  3AZI A;  2NQB D;  4G92 B;  3W99 C;  1AOI B;  2RVQ D;  5CPK A;  3B0C T;  4J8V D;  3WAA D;  5G49 A;  1B67 A;  3B6F D;  3UTB D;  4R8P B;  2YFW A;  5CPJ D;  1P3L D;  4WU9 D;  3TU4 C;  4KUD D;  3AZG A;  3KUY B;  4LD9 B;  3X1S A;  3AZK D;  2ARO C;  1ZLA C;  5CP6 A;  4YM6 D;  5CPI A;  4J8W D;  5E5A D;  5JA4 A;  5CPI B;  3NQU B;  5AV8 C;  3W97 C;  3MGQ D;  4X23 D;  3W98 D;  1M18 D;  3MNN B;  1KX5 D;  1P3B C;  3LZ1 D;  4G92 C;  1AOI C;  3C1B B;  2F8N D;  3AZN D;  1R4V A;  1BH9 A;  5B24 A;  1TZY D;  2PYO D;  3MVD B;  1M19 A;  3AZH B;  5FUG A;  3WTP A;  3KUY C;  1M19 B;  3WKJ A;  4EO5 B;  4LD9 C;  1JFI A;  1S32 B;  5CPK D;  3O62 D;  3AZJ D;  4H9R A;  5AV9 C;  4Z5T C;  4KGC A;  1HQ3 B;  1P3F D;  1P3G B;  3AV2 B;  4WU8 D;  4KGC B;  2FJ7 A;  3AN2 D;  3REJ B;  3AZF D;  3MGS D;  4J8X A;  5JRG B;  3AZE B;  3LEL B;  5BS7 A;  3C1B C;  2HIO A;  1ULY A;  1F66 D;  2CV5 B; 
#chains in the Genus database with same CATH topology
 5AVC A;  3AZH C;  5BNX A;  1P34 D;  4WZS B;  3REI D;  4EO5 C;  4Z66 B;  3KXB A;  1M1A A;  2W8S A;  1P3G C;  5GT3 B;  5B24 D;  3AV2 C;  5B33 B;  3C1C B;  3REJ C;  3WKJ D;  5JRG C;  3LJA A;  3LEL C;  3REK A;  3AZE C;  2NZD B;  3AZL B;  5B1M B;  5DNN B;  5AV6 D;  4JJN D;  2F8N G;  3MGP D;  2CV5 C;  1A7W A;  3KWQ A;  4AWL B;  5B2I C;  1P3O B;  4Z66 C;  2YFV A;  5B32 G;  1Q9C A;  3REH A;  3V9R B;  5B31 B;  1KX3 B;  3WA9 B;  5GT3 C;  3F6T A;  3LZ0 B;  3MGR B;  5B33 C;  4XZQ C;  3C1C C;  5B1L A;  2BYK A;  2FFF B;  3KFU G;  4DRA A;  5AVB A;  3X1U D;  2BYK B;  4XUJ C;  1U35 B;  2NZD C;  1P3A D;  3VH5 W;  3AZL C;  1P3P A;  5B1M C;  2Y2I A;  5DNN C;  3W96 A;  5B40 A;  4ZUX A;  4YS3 A;  3X1T D;  3AV1 A;  1EQZ A;  4J8U B;  3UTA B;  4AWL C;  2L5A A;  3LJA D;  1P3O C;  2ZY3 A;  5GT0 B;  3W99 B;  3AFA D;  3UT9 C;  1KX3 C;  5B0Z B;  2IO5 B;  2Y2K A;  3WA9 C;  1KX4 B;  3LZ0 C;  3TU4 A;  3MGR C;  4Z2M G;  3X1V C;  3EPH A;  2ARO A;  2HUE C;  3A6N B;  3B6G A;  3R45 A;  4NFT A;  1ZLA B;  2BYM B;  4CAY B;  1U35 C;  5GXQ C;  3EG5 B;  3REH D;  3R45 B;  5AV8 A;  5F99 B;  3W97 B;  5B1L D;  5GSU A;  1P3B A;  3B6F B;  3UTB B;  2Y2J A;  4J8U C;  3UTA C;  4WU9 B;  1AOI A;  4KUD B;  5C3I C;  5GT0 C;  3AZK B;  1P3K C;  4YM6 B;  5B0Z C;  4J8W B;  2IO5 C;  4H9Q B;  3EPL A;  3W96 D;  4R8P A;  4YS3 D;  5B2J D;  1KX4 C;  4H9S C;  3MGQ B;  3W98 B;  4LD9 A;  3KUY A;  2F8N K;  5B0Y D;  3AYW C;  3A6N C;  5AY8 D;  3REL D;  2Y2N A;  1KX5 B;  5AV9 A;  5AV5 D;  2NQB C;  3NQU A;  2RVQ C;  5AV9 B;  4Z5T B;  2CWE A;  4QLC D;  3AZN B;  4E44 A;  4J8V C;  5F99 C;  3MNN A;  3B6F C;  1TZY B;  3UTB C;  4UUZ B;  1P3L C;  5CPJ C;  2PYO B;  4WU9 C;  3B6G D;  1P3I D;  3C1B A;  4KUD C;  3AZK C;  4YM6 C;  1P3M D;  3B0B A;  3H0L C;  4H9N B;  3O62 B;  3AZJ B;  4E45 A;  1F1E A;  4J8W C;  5E5A C;  1P3F B;  3MVD A;  1ID3 D;  5GSU D;  3VH6 W;  3AZH A;  4WU8 B;  3MGQ C;  4X23 C;  3W98 C;  5B32 D;  1M18 C;  1S32 A;  3AZI D;  3MGS B;  3B0D C;  1KX5 C;  3P5J B;  3LZ1 C;  1HQ3 A;  1P3G A;  3AV2 A;  4M6B A;  3AZN C;  4R8P D;  2UWX A;  2JE5 A;  3REJ A;  5BT1 D;  1F66 B;  5BNV A;  2Y2L A;  1TZY C;  5JRG A;  3AZE A;  3LEL A;  5BNV B;  2PYO C;  2XD1 A;  3AZG D;  3X1S D;  1P34 B;  5CP6 D;  3REI B;  5CPI D;  2G5I C;  3O62 C;  3AZJ C;  5CPK C;  2CV5 A;  1P3F C;  3MNN D;  4WU8 C;  5KDM B;  3AN2 C;  4Z66 A;  3AZF C;  3MGS C;  5B2I B;  4WV4 B;  5GT3 A;  4NE5 A;  5B33 A;  3C1C A;  3MVD D;  1F66 C;  2Y2G A;  4XZQ B;  4JJN B;  1M19 D;  3MGP B;  1S32 D;  3WTP D;  2NZD A;  3VH5 A;  1P34 C;  4XUJ B;  3REI C;  3AZL A;  1HQ3 D;  5B1M A;  1N1J B;  5DNN A;  4KGC D;  3H0M C;  2FJ7 D;  3NQJ B;  1P3O A;  4J8X D;  2JSS A;  3X1U B;  3V9R A;  5B31 A;  1KX3 A;  3AZM B;  3UT9 B;  2HIO D;  4NE3 A;  3WA9 A;  3LZ0 A;  3MGR A;  5AV6 C;  4JJN C;  3X1V B;  5AVC D;  3MGP C;  2HUE B;  4KHA B;  1U35 A;  1TAF B;  5GXQ B;  3KXB D;  1M1A D;  2Y2Q A;  1BFM A;  4J8U A;  3UTA A;  5GT0 A;  3W99 A;  3REK D;  5C3I B;  3X1U C;  1P3K B;  5B0Z A;  5BO0 B;  3AZM C;  1P3A C;  1KX4 A;  3WTP E;  5DNM B;  4HGA B;  3A6N A;  3X1T C;  3KWQ D;  1ZLA A;  2BYM A;  4CAY A;  3AYW B;  3AL0 C;  5B31 D;  3LJA C;  2NQB B;  3AFA C;  5F99 A;  2ZM5 A;  3W97 A;  4H9O B;  3B6F A;  4J8V B;  3UTB A;  3WAA B;  5B2J B;  1W2E A;  4WU9 A;  4KUD A;  1P3L B;  5AVB D;  5CPJ B;  2Y2P A;  3AZK A;  5B0Y B;  4YM6 A;  4CSR A;  3REL B;  4J8W A;  2Y2O A;  4H9Q A;  5AV5 B;  4CSR B;  1P3P D;  1Z2C B;  3VH6 A;  5E5A B;  5B40 D;  5DNM C;  4ZUX D;  3MGQ A;  3W98 A;  4HGA C;  3AV1 D;  1EQZ D;  4X23 B;  5B1L C;  1KX5 A;  5GT0 D;  1M18 B;  2DQN C;  3W99 D;  3B0D B;  1P3I B;  4Z5T A;  3AZN A;  3LZ1 B;  3VH5 T;  2F8N B;  1KX4 D;  3IP4 C;  1TZY A;  4WNN A;  3W96 C;  4UUZ A;  3WAA C;  4YS3 C;  5B2J C;  3TU4 D;  1ID3 B;  2PYO A;  4WNN B;  1KU5 A;  1ZLA D;  2ARO D;  2JCH A;  5B32 B;  5B0Y C;  1BH8 B;  3AZI B;  5AY8 C;  4H9N A;  3O62 A;  3REL C;  3AZJ A;  5AV8 D;  5AV5 C;  5CPK B;  5F99 D;  1P3F A;  2RIQ A;  3W97 D;  4WU8 A;  4QLC C;  5G49 B;  3AN2 A;  1T3U A;  1P3B D;  3AZF A;  3MGS A;  2YFW B;  3AN2 B;  1AOI D;  3AZF B;  3AZG B;  3B6G C;  1P3I C;  3X1S B;  5CP6 B;  1P3M C;  1F66 A;  2DF4 C;  3EPK A;  5B31 G;  5JA4 B;  4WJ3 C;  4ZBJ B;  1ID3 C;  4LD9 D;  5GSU C;  3KUY D;  1P34 A;  5B32 C;  3REI A;  4H9P A;  5AV9 D;  3AZI C;  4Z5T D;  3KSY A;  4H9P B;  5KDM A;  4R8P C;  1BH9 B;  5B24 B;  5BT1 C;  2F8N H;  4NE6 A;  5B2I A;  3C1B D;  5FUG B;  3WTP B;  3AZG C;  3WKJ B;  3X1S C;  1JFI B;  5CP6 C;  5CPI C;  4H9R B;  5AV6 A;  2Y2H A;  4XZQ A;  5CHL B;  4DRB A;  4JJN A;  5AV6 B;  3MGP A;  3AZH D;  4ZBJ C;  3MNN C;  2FJ7 B;  1HTA A;  4XUJ A;  4J8X B;  1N1J A;  1P3G D;  3AV2 D;  2HIO B;  3NQJ A;  3REJ D;  1WWI A;  3VH6 T;  3MVD C;  5B24 C;  5JRG D;  3AZE D;  3LEL D;  3X1U A;  1M19 C;  2ZY2 A;  5AVC B;  1S32 C;  5BNX B;  3AZM A;  3UT9 A;  3WTP C;  3WKJ C;  2LY8 A;  1P3A A;  4UPK A;  1HQ3 C;  3KXB B;  1P3A B;  4KGC C;  1M1A B;  3X1T A;  3X1V A;  2CV5 D;  4KHA A;  1TAF A;  4Z2M H;  5B2I D;  3X1T B;  2FJ7 C;  4Z66 D;  5GXQ A;  4J8X C;  3AFA A;  1B6W A;  3LJA B;  3REK B;  5BS7 C;  2F2A C;  3A1K A;  3AFA B;  5GT3 D;  2HIO C;  5B33 D;  3FDD A;  4XZQ D;  3C1C D;  1H3O A;  4XUJ D;  3KWQ B;  5AVC C;  1P3K A;  5BO0 A;  1H3O B;  2NZD D;  3AZL D;  5B1M D;  3B0C W;  5DNN D;  2YFV B;  5DNM A;  3REH B;  3KXB C;  3H0R C;  4H9S A;  3EPJ A;  1M1A C;  3AYW A;  1P3O D;  5B1L B;  5AVB B;  3AZM D;  2NQB A;  3UT9 D;  3REK C;  1KX3 D;  4H9O A;  4J8V A;  3WA9 D;  3LZ0 D;  3WAA A;  3A1I A;  5B2J A;  3MGR D;  1P3P B;  3X1V D;  3W96 B;  5B40 B;  4ZUX B;  4YS3 B;  5CPJ A;  1P3L A;  5B0Y A;  3AV1 B;  1EQZ B;  4G91 B;  5AY8 A;  1U35 D;  3REL A;  5GXQ D;  3KWQ C;  5AV5 A;  5AY8 B;  5B31 C;  5E5A A;  4QLC A;  3REH C;  4QLC B;  4X23 A;  4J8U D;  3UTA D;  1M18 A;  3TU4 B;  2ZY5 A;  1P3I A;  1P3K D;  2ARO B;  5AVB C;  3LZ1 A;  3B6G B;  5B0Z D;  2F8N A;  1P3M A;  5DNM D;  5AV8 B;  1P3M B;  1P3P C;  1ID3 A;  5B40 C;  4ZUX C;  5B32 A;  3AYW D;  3A6N D;  5GSU B;  2ZY4 A;  1P3B B;  3AV1 C;  1EQZ C;  1BH8 A;  1WWS A;  2VQR A;  4G91 C;  3AZI A;  2NQB D;  4G92 B;  3W99 C;  1AOI B;  2RVQ D;  5CPK A;  3B0C T;  4J8V D;  3WAA D;  5G49 A;  1B67 A;  3B6F D;  3UTB D;  4R8P B;  2YFW A;  5CPJ D;  1P3L D;  4WU9 D;  3TU4 C;  4KUD D;  3AZG A;  3KUY B;  4LD9 B;  3X1S A;  3AZK D;  2ARO C;  1ZLA C;  5CP6 A;  4YM6 D;  5CPI A;  2Y2M A;  4J8W D;  5E5A D;  5JA4 A;  5CPI B;  3NQU B;  5AV8 C;  3W97 C;  3MGQ D;  4X23 D;  3W98 D;  2XD5 A;  1M18 D;  3MNN B;  1KX5 D;  1P3B C;  2BG1 A;  2J8P A;  3LZ1 D;  4G92 C;  1AOI C;  3C1B B;  2F8N D;  4DQY B;  3AZN D;  1R4V A;  1BH9 A;  5B24 A;  1TZY D;  2PYO D;  3MVD B;  1M19 A;  3AZH B;  5FUG A;  3WTP A;  3KUY C;  1M19 B;  3WKJ A;  4EO5 B;  4LD9 C;  1JFI A;  1S32 B;  5CPK D;  3O62 D;  3AZJ D;  4H9R A;  5AV9 C;  4Z5T C;  4KGC A;  1HQ3 B;  1P3F D;  1P3G B;  3AV2 B;  4WU8 D;  4KGC B;  2FJ7 A;  3AN2 D;  2G5H C;  3REJ B;  3AZF D;  3MGS D;  4J8X A;  5JRG B;  3AZE B;  3LEL B;  5BS7 A;  1PZR A;  3C1B C;  2HIO A;  1ULY A;  1F66 D;  2CV5 B; 
#chains in the Genus database with same CATH homology
 5AVC A;  3AZH C;  5BNX A;  1P34 D;  4WZS B;  3REI D;  4EO5 C;  4Z66 B;  3KXB A;  1M1A A;  2W8S A;  1P3G C;  5GT3 B;  5B24 D;  3AV2 C;  5B33 B;  3C1C B;  3REJ C;  3WKJ D;  5JRG C;  3LJA A;  3LEL C;  3REK A;  3AZE C;  2NZD B;  3AZL B;  5B1M B;  5DNN B;  5AV6 D;  4JJN D;  2F8N G;  3MGP D;  2CV5 C;  1A7W A;  3KWQ A;  4AWL B;  5B2I C;  1P3O B;  4Z66 C;  2YFV A;  5B32 G;  1Q9C A;  3REH A;  3V9R B;  5B31 B;  1KX3 B;  3WA9 B;  5GT3 C;  3F6T A;  3LZ0 B;  3MGR B;  5B33 C;  4XZQ C;  3C1C C;  5B1L A;  2BYK A;  2FFF B;  3KFU G;  4DRA A;  5AVB A;  3X1U D;  2BYK B;  4XUJ C;  1U35 B;  2NZD C;  1P3A D;  3VH5 W;  3AZL C;  1P3P A;  5B1M C;  2Y2I A;  5DNN C;  3W96 A;  5B40 A;  4ZUX A;  4YS3 A;  3X1T D;  3AV1 A;  1EQZ A;  4J8U B;  3UTA B;  4AWL C;  2L5A A;  3LJA D;  1P3O C;  2ZY3 A;  5GT0 B;  3W99 B;  3AFA D;  3UT9 C;  1KX3 C;  5B0Z B;  2IO5 B;  2Y2K A;  3WA9 C;  1KX4 B;  3LZ0 C;  3TU4 A;  3MGR C;  4Z2M G;  3X1V C;  3EPH A;  2ARO A;  2HUE C;  3A6N B;  3B6G A;  3R45 A;  4NFT A;  1ZLA B;  2BYM B;  4CAY B;  1U35 C;  5GXQ C;  3EG5 B;  3REH D;  3R45 B;  5AV8 A;  5F99 B;  3W97 B;  5B1L D;  5GSU A;  1P3B A;  3B6F B;  3UTB B;  2Y2J A;  4J8U C;  3UTA C;  4WU9 B;  1AOI A;  4KUD B;  5C3I C;  5GT0 C;  3AZK B;  1P3K C;  4YM6 B;  5B0Z C;  4J8W B;  2IO5 C;  4H9Q B;  3EPL A;  3W96 D;  4R8P A;  4YS3 D;  5B2J D;  1KX4 C;  4H9S C;  3MGQ B;  3W98 B;  4LD9 A;  3KUY A;  2F8N K;  5B0Y D;  3AYW C;  3A6N C;  5AY8 D;  3REL D;  2Y2N A;  1KX5 B;  5AV9 A;  5AV5 D;  2NQB C;  3NQU A;  2RVQ C;  5AV9 B;  4Z5T B;  2CWE A;  4QLC D;  3AZN B;  4E44 A;  4J8V C;  5F99 C;  3MNN A;  3B6F C;  1TZY B;  3UTB C;  4UUZ B;  1P3L C;  5CPJ C;  2PYO B;  4WU9 C;  3B6G D;  1P3I D;  3C1B A;  4KUD C;  3AZK C;  4YM6 C;  1P3M D;  3B0B A;  3H0L C;  4H9N B;  3O62 B;  3AZJ B;  4E45 A;  1F1E A;  4J8W C;  5E5A C;  1P3F B;  3MVD A;  1ID3 D;  5GSU D;  3VH6 W;  3AZH A;  4WU8 B;  3MGQ C;  4X23 C;  3W98 C;  5B32 D;  1M18 C;  1S32 A;  3AZI D;  3MGS B;  3B0D C;  1KX5 C;  3P5J B;  3LZ1 C;  1HQ3 A;  1P3G A;  3AV2 A;  4M6B A;  3AZN C;  4R8P D;  2UWX A;  2JE5 A;  3REJ A;  5BT1 D;  1F66 B;  5BNV A;  2Y2L A;  1TZY C;  5JRG A;  3AZE A;  3LEL A;  5BNV B;  2PYO C;  2XD1 A;  3AZG D;  3X1S D;  1P34 B;  5CP6 D;  3REI B;  5CPI D;  2G5I C;  3O62 C;  3AZJ C;  5CPK C;  2CV5 A;  1P3F C;  3MNN D;  4WU8 C;  5KDM B;  3AN2 C;  4Z66 A;  3AZF C;  3MGS C;  5B2I B;  4WV4 B;  5GT3 A;  4NE5 A;  5B33 A;  3C1C A;  3MVD D;  1F66 C;  2Y2G A;  4XZQ B;  4JJN B;  1M19 D;  3MGP B;  1S32 D;  3WTP D;  2NZD A;  3VH5 A;  1P34 C;  4XUJ B;  3REI C;  3AZL A;  1HQ3 D;  5B1M A;  1N1J B;  5DNN A;  4KGC D;  3H0M C;  2FJ7 D;  3NQJ B;  1P3O A;  4J8X D;  2JSS A;  3X1U B;  3V9R A;  5B31 A;  1KX3 A;  3AZM B;  3UT9 B;  2HIO D;  4NE3 A;  3WA9 A;  3LZ0 A;  3MGR A;  5AV6 C;  4JJN C;  3X1V B;  5AVC D;  3MGP C;  2HUE B;  4KHA B;  1U35 A;  1TAF B;  5GXQ B;  3KXB D;  1M1A D;  2Y2Q A;  1BFM A;  4J8U A;  3UTA A;  5GT0 A;  3W99 A;  3REK D;  5C3I B;  3X1U C;  1P3K B;  5B0Z A;  5BO0 B;  3AZM C;  1P3A C;  1KX4 A;  3WTP E;  5DNM B;  4HGA B;  3A6N A;  3X1T C;  3KWQ D;  1ZLA A;  2BYM A;  4CAY A;  3AYW B;  3AL0 C;  5B31 D;  3LJA C;  2NQB B;  3AFA C;  5F99 A;  2ZM5 A;  3W97 A;  4H9O B;  3B6F A;  4J8V B;  3UTB A;  3WAA B;  5B2J B;  1W2E A;  4WU9 A;  4KUD A;  1P3L B;  5AVB D;  5CPJ B;  2Y2P A;  3AZK A;  5B0Y B;  4YM6 A;  4CSR A;  3REL B;  4J8W A;  2Y2O A;  4H9Q A;  5AV5 B;  4CSR B;  1P3P D;  1Z2C B;  3VH6 A;  5E5A B;  5B40 D;  5DNM C;  4ZUX D;  3MGQ A;  3W98 A;  4HGA C;  3AV1 D;  1EQZ D;  4X23 B;  5B1L C;  1KX5 A;  5GT0 D;  1M18 B;  2DQN C;  3W99 D;  3B0D B;  1P3I B;  4Z5T A;  3AZN A;  3LZ1 B;  3VH5 T;  2F8N B;  1KX4 D;  3IP4 C;  1TZY A;  4WNN A;  3W96 C;  4UUZ A;  3WAA C;  4YS3 C;  5B2J C;  3TU4 D;  1ID3 B;  2PYO A;  4WNN B;  1KU5 A;  1ZLA D;  2ARO D;  2JCH A;  5B32 B;  5B0Y C;  1BH8 B;  3AZI B;  5AY8 C;  4H9N A;  3O62 A;  3REL C;  3AZJ A;  5AV8 D;  5AV5 C;  5CPK B;  5F99 D;  1P3F A;  2RIQ A;  3W97 D;  4WU8 A;  4QLC C;  5G49 B;  3AN2 A;  1T3U A;  1P3B D;  3AZF A;  3MGS A;  2YFW B;  3AN2 B;  1AOI D;  3AZF B;  3AZG B;  3B6G C;  1P3I C;  3X1S B;  5CP6 B;  1P3M C;  1F66 A;  2DF4 C;  3EPK A;  5B31 G;  5JA4 B;  4WJ3 C;  4ZBJ B;  1ID3 C;  4LD9 D;  5GSU C;  3KUY D;  1P34 A;  5B32 C;  3REI A;  4H9P A;  5AV9 D;  3AZI C;  4Z5T D;  3KSY A;  4H9P B;  5KDM A;  4R8P C;  1BH9 B;  5B24 B;  5BT1 C;  2F8N H;  4NE6 A;  5B2I A;  3C1B D;  5FUG B;  3WTP B;  3AZG C;  3WKJ B;  3X1S C;  1JFI B;  5CP6 C;  5CPI C;  4H9R B;  5AV6 A;  2Y2H A;  4XZQ A;  5CHL B;  4DRB A;  4JJN A;  5AV6 B;  3MGP A;  3AZH D;  4ZBJ C;  3MNN C;  2FJ7 B;  1HTA A;  4XUJ A;  4J8X B;  1N1J A;  1P3G D;  3AV2 D;  2HIO B;  3NQJ A;  3REJ D;  1WWI A;  3VH6 T;  3MVD C;  5B24 C;  5JRG D;  3AZE D;  3LEL D;  3X1U A;  1M19 C;  2ZY2 A;  5AVC B;  1S32 C;  5BNX B;  3AZM A;  3UT9 A;  3WTP C;  3WKJ C;  2LY8 A;  1P3A A;  4UPK A;  1HQ3 C;  3KXB B;  1P3A B;  4KGC C;  1M1A B;  3X1T A;  3X1V A;  2CV5 D;  4KHA A;  1TAF A;  4Z2M H;  5B2I D;  3X1T B;  2FJ7 C;  4Z66 D;  5GXQ A;  4J8X C;  3AFA A;  1B6W A;  3LJA B;  3REK B;  5BS7 C;  2F2A C;  3A1K A;  3AFA B;  5GT3 D;  2HIO C;  5B33 D;  3FDD A;  4XZQ D;  3C1C D;  1H3O A;  4XUJ D;  3KWQ B;  5AVC C;  1P3K A;  5BO0 A;  1H3O B;  2NZD D;  3AZL D;  5B1M D;  3B0C W;  5DNN D;  2YFV B;  5DNM A;  3REH B;  3KXB C;  3H0R C;  4H9S A;  3EPJ A;  1M1A C;  3AYW A;  1P3O D;  5B1L B;  5AVB B;  3AZM D;  2NQB A;  3UT9 D;  3REK C;  1KX3 D;  4H9O A;  4J8V A;  3WA9 D;  3LZ0 D;  3WAA A;  3A1I A;  5B2J A;  3MGR D;  1P3P B;  3X1V D;  3W96 B;  5B40 B;  4ZUX B;  4YS3 B;  5CPJ A;  1P3L A;  5B0Y A;  3AV1 B;  1EQZ B;  4G91 B;  5AY8 A;  1U35 D;  3REL A;  5GXQ D;  3KWQ C;  5AV5 A;  5AY8 B;  5B31 C;  5E5A A;  4QLC A;  3REH C;  4QLC B;  4X23 A;  4J8U D;  3UTA D;  1M18 A;  3TU4 B;  2ZY5 A;  1P3I A;  1P3K D;  2ARO B;  5AVB C;  3LZ1 A;  3B6G B;  5B0Z D;  2F8N A;  1P3M A;  5DNM D;  5AV8 B;  1P3M B;  1P3P C;  1ID3 A;  5B40 C;  4ZUX C;  5B32 A;  3AYW D;  3A6N D;  5GSU B;  2ZY4 A;  1P3B B;  3AV1 C;  1EQZ C;  1BH8 A;  1WWS A;  2VQR A;  4G91 C;  3AZI A;  2NQB D;  4G92 B;  3W99 C;  1AOI B;  2RVQ D;  5CPK A;  3B0C T;  4J8V D;  3WAA D;  5G49 A;  1B67 A;  3B6F D;  3UTB D;  4R8P B;  2YFW A;  5CPJ D;  1P3L D;  4WU9 D;  3TU4 C;  4KUD D;  3AZG A;  3KUY B;  4LD9 B;  3X1S A;  3AZK D;  2ARO C;  1ZLA C;  5CP6 A;  4YM6 D;  5CPI A;  2Y2M A;  4J8W D;  5E5A D;  5JA4 A;  5CPI B;  3NQU B;  5AV8 C;  3W97 C;  3MGQ D;  4X23 D;  3W98 D;  2XD5 A;  1M18 D;  3MNN B;  1KX5 D;  1P3B C;  2BG1 A;  2J8P A;  3LZ1 D;  4G92 C;  1AOI C;  3C1B B;  2F8N D;  4DQY B;  3AZN D;  1R4V A;  1BH9 A;  5B24 A;  1TZY D;  2PYO D;  3MVD B;  1M19 A;  3AZH B;  5FUG A;  3WTP A;  3KUY C;  1M19 B;  3WKJ A;  4EO5 B;  4LD9 C;  1JFI A;  1S32 B;  5CPK D;  3O62 D;  3AZJ D;  4H9R A;  5AV9 C;  4Z5T C;  4KGC A;  1HQ3 B;  1P3F D;  1P3G B;  3AV2 B;  4WU8 D;  4KGC B;  2FJ7 A;  3AN2 D;  2G5H C;  3REJ B;  3AZF D;  3MGS D;  4J8X A;  5JRG B;  3AZE B;  3LEL B;  5BS7 A;  1PZR A;  3C1B C;  2HIO A;  1ULY A;  1F66 D;  2CV5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...