5BNXB

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.3-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
b'RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnxB00
2FJ7C 5BO0A 5B1LB 3LJAA 5BNVA 3UT9C 5B33B 3KWQA 3X1SA 5B2JB 5E5AD 5JA4B 5AV6A 4J8XA 5JRGC 3W98B 5B31A 4KUDB 5AV9D 4WNNB 5AV5C 1P3OC 5KDMB 3NQJB 5AV8D 3WTPD 5GSUD 3UTAC 3REKB 1P3GA 4Z2MG 1P3BC 3AZGC 1U35B 1P3IA 3AN2A 5AY8B 1N1JA 3B0CW 2NQBA 4R8PB 2IO5C 3AYWD 5AV9B 1JFIA 3B6FC 2FJ7B 1WWIA 1P3PA 3WTPB 1P3AC 3UT9B 1ZLAD 3W99D 4XUJD 5JRGB 2AROB 2CV5A 1P3OB 4HGAC 3MGQA 1M19A 5B40A 5B2IA 1P3MA 1KX5C 3X1SC 2F8NK 5AV6C 4J8XC 3UTAB 1P3BB 3AZGB 5B31C 4H9PA 5B24A 1F66A 5AVBC 3REIA 2IO5B 5F99D 3VH6A 1P3GC 1P3KA 3B6FB 3AN2C 5FUGB 4Z5TD 1P3AB 3W97A 5CPJA 2NQBC 4XZQD 4CAYA 3AZLA 4J8UD 5BO0B 1P3PC 4YS3D 4HGAB 5BNVB 1EQZB 1KX5B 5AV6B 4LD9D 5CP6D 5GT0D 3AV2D 4J8WC 3WKJA 3AZJD 3MGQC 3C1CC 5AVBB 4YM6D 5B40C 5B2IC 1P3MC 2F8NA 5AVCC 4J8UB 1P3GB 3NQUB 1BFMA 3AZED 3B0DC 3AN2B 1P3LA 3C1BA 5B24C 3AZFD 2NQBB 3W96A 3AZKA 1M1AB 1P3PB 4G92B 3TU4A 5CPKD 3AV1C 1P3FA 3W97C 4WU8A 1HQ3A 3X1TB 3WAAD 3LELA 3AZLC 3AFAB 1TAFA 3LZ0D 4J8WB 2BYMA 3MVDA 5G49B 3C1CB 3KUYD 5AVCB 3MGSD 3B6GD 3B0DB 3X1VD 3WKJC 3KXBA 3AZID 2PYOA 5BS7A 1KX3D 4J8VA 3VH6T 3UTBA 5GXQC 3LZ1A 1P3LC 3AV1B 3C1BC 3MGSB 3REHD 5GT3C 3B6GB 5B0YA 3MGPB 3W96C 5B0ZD 3AZKC 3R45A 4ZUXD 1TZYD 4CAYB 4KGCC 1BH9B 5DNNA 3TU4C 3MGRC 3RELD 5DNMD 3O62A 1KX3B 5B32A 3REJD 5E5AA 5B1MD 4WU8C 1HQ3C 3X1UD 2LY8A 5B1LD 4QLCD 4NE5A 1KX4A 5B33D 5AV8A 5B2JD 4G91C 3W98D 5GXQB 5CPIC 3WA9C 1B6WA 1P3LB 4KUDD 3C1BB 5GT3B 1P34A 4H9SA 2PYOC 4J8VC 1S32B 4ZBJC 3MNNA 3REKD 3UTBC 4QLCB 4KGCB 1U35D 3TU4B 3MGRB 5AY8D 1ZLAA 4R8PD 4WU8B 4XUJA 1HQ3B 4CSRA 1AOIA 2FJ7D 5DNNC 3O62C 3UT9D 5B32C 5JRGD 4G91B 2AROD 1M18A 5CPIB 4JJNA 3WA9B 1P3OD 1KX4C 5F99A 3VH5A 5BNXB 2PYOB 4J8VB 3UTAD 4ZBJB 4WZSB 3UTBB 2L5AA 2HIOA 1P3BD 3AZGD 2NZDC 4Z5TA 1P34C 3AZHA 4XZQA 4H9SC 4E45A 3MNNC 4Z66A 5AV5B 3LJAC 4YS3A 3KWQC 3B6FD 3O62B 1P3AD 1ZLAC 5B32B 4LD9A 5CP6A 4XUJC 4UUZA 2BYKB 5GT0A 5CHLB 3AV2A 1AOIC 3AZJA 1ULYA 1KX4B 4YM6A 1EQZD 5BT1D 4NE6A 3WTPE 3VH5W 3A6NA 1P3IC 1KX5D 5AV6D 3B0CT 1M18C 2NZDB 4JJNC 1P34B 5AVBD 3AZNA 1P3GD 3LJAB 4WU9A 2HIOC 3KWQB 3AN2D 3X1SB 4J8XB 3AZMA 3AZHC 2NQBD 3WAAA 5B31B 2CV5C 4X23A 4Z66C 3LZ0A 1M1AD 1M19C 1AOIB 1P3PD 3KUYA 1P3IB 3X1TD 2HUEC 1N1JB 3AFAD 3X1VA 4J8WD 3REIC 1M18B 1F66C 3C1CD 3AZIA 1P3MD 1JFIB 3A6NC 1P3KC 5AVCD 3B0BA 2YFWA 5CPJC 2YFVA 4WV4B 5B24D 3AZHB 1ID3A 5B0ZA 4DRBA 2CV5B 2F8NH 1TZYA 3AZNC 4WU9C 4KHAA 2RVQC 3MGQB 1M19B 5B40B 5B2IB 3RELA 5DNMA 1P3MB 3AV1D 4H9OA 3AZMC 5B1MA 1H3OA 3MGPD 2HUEB 4X23C 4H9PB 3X1UA 4NE3A 5B24B 3AZLD 1F66B 3REIB 4AWLC 5B32G 5JA4A 3A6NB 1P3KB 1A7WA 3W97B 5CPJB 5KDMA 3WKJD 3AZLB 3REKA 3AZNB 1P3FC 5GXQD 1P3LD 3C1BD 5GT3D 3LELC 1ID3C 5AV9A 1S32D 3AZKD 4H9RA 1TZYC 4X23B 3MVDC 3WKJB 4KGCD 2F8NB 3WTPA 5DNMC 5GSUA 4AWLB 3MGRD 3TU4D 3UT9A 5B1MC 4WU8D 1HQ3D 5B31G 2AROA 3KXBC 3AYWA 3W96B 5BS7C 3AZKB 3LZ1C 1P3BA 1P3FB 3W99A 5B0YC 5CPID 3WA9D 3LELB 1ID3B 1BH8A 1TAFB 2PYOD 2BYMB 4J8VD 3UTBD 4EO5C 3MVDB 3B6FA 5E5AC 4H9OB 5AV9C 4NFTA 5AV5D 3KXBB 5AV8C 3WTPC 5GSUC 5DNND 1EQZA 3O62D 1KX5A 5B32D 3LZ1B 2AROC 3AYWC 5B0YB 1KX4D 5AVBA 3R45B 4J8UA 5DNNB 3NQUA 4EO5B 3W99C 2NZDD 5E5AB 1P34D 4M6BA 4H9RB 3MNND 3LJAD 1M1AA 5AV8B 3KWQD 5GSUB 3X1SD 4J8XD 2CWEA 3AZEA 4H9QA 3X1TA 3V9RA 3KSYA 5B31D 3AFAA 4J8WA 3AZFA 5F99C 3AYWB 1AOID 2F8NG 5G49A 1EQZC 5BT1C 3MNNB 3C1CA 5AVCA 5CPKA 1P3ID 4Z5TC 1ZLAB 3W99B 4H9NA 1M18D 4XZQC 4JJND 4XUJB 1BH8B 4CSRB 4J8UC 4YS3C 1R4VA 2HIOD 1HTAA 4Z2MH 3MGSA 3AV1A 5CP6C 4LD9C 3B6GA 5GT0C 3AV2C 3AZHD 3MGPA 4JJNB 3AZJC 2CV5D 4Z66D 1M1AC 4YM6C 3MGQD 5F99B 1BH9A 4G92C 5B40D 5B2ID 1M19D 3VH5T 1KX3A 3AZEC 1WWSA 2HIOB 1B67A 3X1TC 4Z5TB 5C3IC 3REHA 3AFAC 3AZFC 2JSSA 1F66D 3REID 4XZQB 4ZUXA 4Z66B 1KU5A 3A6ND 3VH6W 4YS3B 5CPKC 1P3KD 5GXQA 3W97D 3REJA 5CPJD 3WAAC 5GT3A 5CP6B 4UUZB 4LD9B 5GT0B 3AV2B 3LZ0C 1S32A 5B1LA 4QLCA 3AZJB 3AZND 4KGCA 4YM6B 4WU9D 5B33A 2RVQD 3KUYC 3MGRA 5B2JA 3MGSC 3B6GC 3AZMD 3AZEB 3W98A 3MGPC 4H9QB 3X1VC 4KUDA 3V9RB 4WNNA 5C3IB 4X23D 3AZFB 3AZIC 2F8ND 3NQJA 1KX3C 4WU9B 1U35A 5CPKB 5AY8A 3REHC 3AZMB 5CPIA 4R8PA 3WA9A 4H9NB 5B0ZC 1Q9CA 3W96D 3WAAB 4ZUXC 3LZ0B 5BNXA 2FJ7A 3RELC 1P3FD 3REJC 3KUYB 5JRGA 3LELD 1ID3D 3X1UC 3X1VB 1S32C 1P3OA 5B1LC 5AV5A 4QLCC 3MVDD 5B33C 3AZIB 4E44A 5B2JC 3UTAA 3W98C 3AZGA 2YFWB 4KUDC 2BYKA 3REHB 2YFVB 3KXBD 5B0ZB 3REKC 4ZUXB 1TZYB 1F1EA 4KHAB 1U35C 3LZ1D 5AY8C 5FUGA 5DNMB 3RELB 1P3AA 2NZDA 4R8PC 3REJB 5B1MB 1H3OB 5B0YD 4DRAA 3X1UB
chains in the Genus database with same CATH superfamily
2FJ7C 5BO0A 5B1LB 3LJAA 5BNVA 3UT9C 5B33B 3KWQA 3X1SA 5B2JB 5E5AD 5JA4B 5AV6A 4J8XA 5JRGC 3W98B 5B31A 4KUDB 5AV9D 4WNNB 5AV5C 1P3OC 5KDMB 3AL0C 3NQJB 5AV8D 3WTPD 5GSUD 3UTAC 3REKB 1P3GA 1PZRA 4Z2MG 2VQRA 1P3BC 3AZGC 1U35B 1P3IA 3AN2A 5AY8B 1N1JA 3B0CW 2NQBA 4R8PB 2IO5C 3AYWD 5AV9B 1JFIA 3B6FC 2FJ7B 1WWIA 1P3PA 3WTPB 1P3AC 2UWXA 3UT9B 1ZLAD 3W99D 4XUJD 5JRGB 2AROB 2CV5A 1P3OB 4HGAC 2J8PA 3MGQA 1M19A 5B40A 5B2IA 1P3MA 1KX5C 3X1SC 2F8NK 5AV6C 4J8XC 3UTAB 2JE5A 1P3BB 3AZGB 5B31C 4H9PA 5B24A 1F66A 5AVBC 3REIA 2IO5B 5F99D 3VH6A 1P3GC 1P3KA 3B6FB 3AN2C 5FUGB 4Z5TD 1P3AB 3W97A 5CPJA 2NQBC 4XZQD 4CAYA 3AZLA 4J8UD 5BO0B 1P3PC 4YS3D 4HGAB 5BNVB 1EQZB 1KX5B 5AV6B 4LD9D 5CP6D 5GT0D 3AV2D 4J8WC 3WKJA 3AZJD 3MGQC 3C1CC 5AVBB 4YM6D 5B40C 5B2IC 1P3MC 2F8NA 5AVCC 4J8UB 1P3GB 3NQUB 1BFMA 3AZED 3B0DC 3EPHA 3AN2B 1P3LA 3C1BA 5B24C 3AZFD 2NQBB 3W96A 3AZKA 1M1AB 1P3PB 4G92B 3TU4A 5CPKD 3AV1C 1P3FA 3W97C 2Y2QA 2Y2LA 4WU8A 1HQ3A 3X1TB 3WAAD 3LELA 3AZLC 3AFAB 1TAFA 3LZ0D 4J8WB 2BYMA 3MVDA 5G49B 3C1CB 3KUYD 5AVCB 3MGSD 3B6GD 3B0DB 3X1VD 3WKJC 3KXBA 3AZID 2PYOA 5BS7A 1KX3D 4J8VA 4WJ3C 3VH6T 3UTBA 1Z2CB 5GXQC 3LZ1A 1P3LC 2DQNC 3AV1B 3C1BC 3MGSB 3REHD 5GT3C 3B6GB 4UPKA 5B0YA 3MGPB 3W96C 5B0ZD 3AZKC 3R45A 3EPKA 4ZUXD 1TZYD 4CAYB 4KGCC 1BH9B 5DNNA 3TU4C 3MGRC 3RELD 5DNMD 3O62A 1KX3B 5B32A 3REJD 5E5AA 5B1MD 4WU8C 1HQ3C 3X1UD 2LY8A 5B1LD 4QLCD 4NE5A 1KX4A 5B33D 5AV8A 5B2JD 4G91C 3W98D 2G5HC 5GXQB 5CPIC 3WA9C 1B6WA 1P3LB 4KUDD 3C1BB 5GT3B 1P34A 2Y2PA 4H9SA 2PYOC 4J8VC 1S32B 4ZBJC 3MNNA 3REKD 3UTBC 2W8SA 4QLCB 1W2EA 4KGCB 1U35D 3TU4B 3MGRB 5AY8D 1ZLAA 4R8PD 4WU8B 4XUJA 1HQ3B 4CSRA 1AOIA 2FJ7D 5DNNC 3O62C 3UT9D 5B32C 5JRGD 4G91B 2AROD 1M18A 5CPIB 4JJNA 3WA9B 1P3OD 1KX4C 5F99A 3VH5A 5BNXB 2PYOB 4J8VB 3UTAD 4ZBJB 4WZSB 3UTBB 2L5AA 2HIOA 1P3BD 3AZGD 2NZDC 2ZY3A 4Z5TA 1P34C 3AZHA 4XZQA 4H9SC 4E45A 3MNNC 4Z66A 5AV5B 3LJAC 4YS3A 3KWQC 3B6FD 3O62B 1P3AD 1ZLAC 2Y2HA 5B32B 4LD9A 5CP6A 4XUJC 4UUZA 2BYKB 5GT0A 5CHLB 3AV2A 2Y2NA 2ZY4A 1AOIC 3AZJA 1ULYA 1KX4B 4YM6A 1EQZD 5BT1D 4NE6A 3WTPE 3VH5W 3A6NA 1P3IC 1KX5D 5AV6D 3B0CT 1M18C 2NZDB 4JJNC 3H0LC 1P34B 5AVBD 3AZNA 1P3GD 3LJAB 4WU9A 2HIOC 3KWQB 3AN2D 3X1SB 4J8XB 3AZMA 3AZHC 2NQBD 3WAAA 5B31B 2CV5C 4X23A 4Z66C 3LZ0A 1M1AD 1M19C 1AOIB 1P3PD 3KUYA 2XD1A 1P3IB 3H0RC 3X1TD 2HUEC 1N1JB 3AFAD 3A1KA 4J8WD 3REIC 3X1VA 1M18B 1F66C 3C1CD 3AZIA 2Y2KA 1P3MD 1JFIB 3A6NC 1P3KC 5AVCD 3B0BA 2YFWA 5CPJC 2Y2OA 2YFVA 4WV4B 5B24D 3AZHB 1ID3A 3EPLA 5B0ZA 4DRBA 2CV5B 2F8NH 1TZYA 3AZNC 4WU9C 4KHAA 2RVQC 3MGQB 1M19B 5B40B 5B2IB 3RELA 5DNMA 1P3MB 3AV1D 4H9OA 3AZMC 5B1MA 1H3OA 3MGPD 2HUEB 4X23C 4H9PB 3X1UA 4NE3A 5B24B 3AZLD 1F66B 3REIB 4AWLC 5B32G 5JA4A 3A6NB 1P3KB 1A7WA 2DF4C 3A1IA 3W97B 5CPJB 5KDMA 3WKJD 3AZLB 3REKA 3AZNB 1P3FC 5GXQD 1P3LD 3C1BD 2ZY5A 5GT3D 3LELC 1ID3C 5AV9A 1S32D 3AZKD 4H9RA 1TZYC 4X23B 3MVDC 3WKJB 4KGCD 2F8NB 3WTPA 5DNMC 5GSUA 4AWLB 3MGRD 3TU4D 3UT9A 2Y2IA 5B1MC 4WU8D 1HQ3D 5B31G 2AROA 3KXBC 3AYWA 3W96B 5BS7C 3AZKB 3P5JB 3LZ1C 1P3BA 1P3FB 3W99A 5B0YC 5CPID 3WA9D 3LELB 1ID3B 1BH8A 1TAFB 2PYOD 2BYMB 2ZY2A 4J8VD 3UTBD 4EO5C 3MVDB 3B6FA 5E5AC 4H9OB 5AV9C 4NFTA 5AV5D 2FFFB 3KXBB 5AV8C 3WTPC 5GSUC 5DNND 1EQZA 3O62D 1KX5A 2G5IC 5B32D 3LZ1B 2AROC 3EPJA 3AYWC 5B0YB 1KX4D 5AVBA 3R45B 4J8UA 5DNNB 3NQUA 4EO5B 3W99C 2NZDD 2JCHA 5E5AB 2XD5A 1P34D 4M6BA 4H9RB 3MNND 3LJAD 1M1AA 1T3UA 5AV8B 3KWQD 5GSUB 3X1SD 4J8XD 2BG1A 2CWEA 3AZEA 4H9QA 3X1TA 3V9RA 3KSYA 5B31D 3AFAA 4J8WA 3AZFA 5F99C 3AYWB 1AOID 2F8NG 5G49A 1EQZC 5BT1C 3MNNB 3C1CA 5AVCA 5CPKA 1P3ID 4Z5TC 1ZLAB 3W99B 4H9NA 1M18D 4XZQC 4JJND 4XUJB 1BH8B 4CSRB 4J8UC 4YS3C 1R4VA 2ZM5A 2HIOD 1HTAA 4Z2MH 3MGSA 3AV1A 5CP6C 4LD9C 3B6GA 5GT0C 3AV2C 3AZHD 3MGPA 4JJNB 3AZJC 2CV5D 4Z66D 1M1AC 4YM6C 3MGQD 5F99B 1BH9A 4G92C 5B40D 5B2ID 1M19D 3VH5T 1KX3A 3AZEC 1WWSA 2HIOB 1B67A 3X1TC 3FDDA 4Z5TB 5C3IC 3REHA 3AFAC 3AZFC 2JSSA 1F66D 3REID 4XZQB 4ZUXA 4Z66B 3KFUG 1KU5A 3A6ND 3VH6W 4YS3B 5CPKC 1P3KD 5GXQA 3W97D 3REJA 5CPJD 3WAAC 5GT3A 5CP6B 4UUZB 4LD9B 5GT0B 3AV2B 3LZ0C 1S32A 5B1LA 4QLCA 3AZJB 3AZND 4KGCA 4YM6B 4WU9D 5B33A 2RVQD 3KUYC 3MGRA 5B2JA 3MGSC 3B6GC 3AZMD 3AZEB 3W98A 3MGPC 4H9QB 3X1VC 4KUDA 3V9RB 4WNNA 5C3IB 4X23D 3AZFB 3AZIC 2F8ND 3NQJA 1KX3C 2RIQA 4WU9B 1U35A 5CPKB 5AY8A 3REHC 3F6TA 3AZMB 5CPIA 4R8PA 2Y2GA 4H9NB 3WA9A 4DQYB 5B0ZC 1Q9CA 3W96D 3WAAB 4ZUXC 3LZ0B 5BNXA 2FJ7A 3RELC 2Y2JA 1P3FD 3REJC 2Y2MA 3KUYB 5JRGA 3LELD 1ID3D 2F2AC 3X1UC 3X1VB 1S32C 1P3OA 5B1LC 5AV5A 4QLCC 3MVDD 5B33C 3AZIB 4E44A 5B2JC 3UTAA 3W98C 3AZGA 2YFWB 4KUDC 2BYKA 3REHB 2YFVB 3KXBD 5B0ZB 3IP4C 3REKC 3EG5B 4ZUXB 1TZYB 1F1EA 4KHAB 1U35C 3LZ1D 5AY8C 5FUGA 5DNMB 3RELB 1P3AA 2NZDA 4R8PC 3REJB 5B1MB 5B0YD 1H3OB 3H0MC 4DRAA 3X1UB
chains in the Genus database with same CATH topology
2FJ7C 5BO0A 5B1LB 3LJAA 5BNVA 3UT9C 5B33B 3KWQA 3X1SA 5B2JB 5E5AD 5JA4B 5AV6A 4J8XA 5JRGC 3W98B 5B31A 4KUDB 5AV9D 4WNNB 5AV5C 1P3OC 5KDMB 3AL0C 3NQJB 5AV8D 3WTPD 5GSUD 3UTAC 3REKB 1P3GA 1PZRA 4Z2MG 2VQRA 1P3BC 3AZGC 1U35B 1P3IA 3AN2A 5AY8B 1N1JA 3B0CW 2NQBA 4R8PB 2IO5C 3AYWD 5AV9B 1JFIA 3B6FC 2FJ7B 1WWIA 1P3PA 3WTPB 1P3AC 2UWXA 3UT9B 1ZLAD 3W99D 4XUJD 5JRGB 2AROB 2CV5A 1P3OB 4HGAC 2J8PA 3MGQA 1M19A 5B40A 5B2IA 1P3MA 1KX5C 3X1SC 2F8NK 5AV6C 4J8XC 3UTAB 2JE5A 1P3BB 3AZGB 5B31C 4H9PA 5B24A 1F66A 5AVBC 3REIA 2IO5B 5F99D 3VH6A 1P3GC 1P3KA 3B6FB 3AN2C 5FUGB 4Z5TD 1P3AB 3W97A 5CPJA 2NQBC 4XZQD 4CAYA 3AZLA 4J8UD 5BO0B 1P3PC 4YS3D 4HGAB 5BNVB 1EQZB 1KX5B 5AV6B 4LD9D 5CP6D 5GT0D 3AV2D 4J8WC 3WKJA 3AZJD 3MGQC 3C1CC 5AVBB 4YM6D 5B40C 5B2IC 1P3MC 2F8NA 5AVCC 4J8UB 1P3GB 3NQUB 1BFMA 3AZED 3B0DC 3EPHA 3AN2B 1P3LA 3C1BA 5B24C 3AZFD 2NQBB 3W96A 3AZKA 1M1AB 1P3PB 4G92B 3TU4A 5CPKD 3AV1C 1P3FA 3W97C 2Y2QA 2Y2LA 4WU8A 1HQ3A 3X1TB 3WAAD 3LELA 3AZLC 3AFAB 1TAFA 3LZ0D 4J8WB 2BYMA 3MVDA 5G49B 3C1CB 3KUYD 5AVCB 3MGSD 3B6GD 3B0DB 3X1VD 3WKJC 3KXBA 3AZID 2PYOA 5BS7A 1KX3D 4J8VA 4WJ3C 3VH6T 3UTBA 1Z2CB 5GXQC 3LZ1A 1P3LC 2DQNC 3AV1B 3C1BC 3MGSB 3REHD 5GT3C 3B6GB 4UPKA 5B0YA 3MGPB 3W96C 5B0ZD 3AZKC 3R45A 3EPKA 4ZUXD 1TZYD 4CAYB 4KGCC 1BH9B 5DNNA 3TU4C 3MGRC 3RELD 5DNMD 3O62A 1KX3B 5B32A 3REJD 5E5AA 5B1MD 4WU8C 1HQ3C 3X1UD 2LY8A 5B1LD 4QLCD 4NE5A 1KX4A 5B33D 5AV8A 5B2JD 4G91C 3W98D 2G5HC 5GXQB 5CPIC 3WA9C 1B6WA 1P3LB 4KUDD 3C1BB 5GT3B 1P34A 2Y2PA 4H9SA 2PYOC 4J8VC 1S32B 4ZBJC 3MNNA 3REKD 3UTBC 2W8SA 4QLCB 1W2EA 4KGCB 1U35D 3TU4B 3MGRB 5AY8D 1ZLAA 4R8PD 4WU8B 4XUJA 1HQ3B 4CSRA 1AOIA 2FJ7D 5DNNC 3O62C 3UT9D 5B32C 5JRGD 4G91B 2AROD 1M18A 5CPIB 4JJNA 3WA9B 1P3OD 1KX4C 5F99A 3VH5A 5BNXB 2PYOB 4J8VB 3UTAD 4ZBJB 4WZSB 3UTBB 2L5AA 2HIOA 1P3BD 3AZGD 2NZDC 2ZY3A 4Z5TA 1P34C 3AZHA 4XZQA 4H9SC 4E45A 3MNNC 4Z66A 5AV5B 3LJAC 4YS3A 3KWQC 3B6FD 3O62B 1P3AD 1ZLAC 2Y2HA 5B32B 4LD9A 5CP6A 4XUJC 4UUZA 2BYKB 5GT0A 5CHLB 3AV2A 2Y2NA 2ZY4A 1AOIC 3AZJA 1ULYA 1KX4B 4YM6A 1EQZD 5BT1D 4NE6A 3WTPE 3VH5W 3A6NA 1P3IC 1KX5D 5AV6D 3B0CT 1M18C 2NZDB 4JJNC 3H0LC 1P34B 5AVBD 3AZNA 1P3GD 3LJAB 4WU9A 2HIOC 3KWQB 3AN2D 3X1SB 4J8XB 3AZMA 3AZHC 2NQBD 3WAAA 5B31B 2CV5C 4X23A 4Z66C 3LZ0A 1M1AD 1M19C 1AOIB 1P3PD 3KUYA 2XD1A 1P3IB 3H0RC 3X1TD 2HUEC 1N1JB 3AFAD 3A1KA 4J8WD 3REIC 3X1VA 1M18B 1F66C 3C1CD 3AZIA 2Y2KA 1P3MD 1JFIB 3A6NC 1P3KC 5AVCD 3B0BA 2YFWA 5CPJC 2Y2OA 2YFVA 4WV4B 5B24D 3AZHB 1ID3A 3EPLA 5B0ZA 4DRBA 2CV5B 2F8NH 1TZYA 3AZNC 4WU9C 4KHAA 2RVQC 3MGQB 1M19B 5B40B 5B2IB 3RELA 5DNMA 1P3MB 3AV1D 4H9OA 3AZMC 5B1MA 1H3OA 3MGPD 2HUEB 4X23C 4H9PB 3X1UA 4NE3A 5B24B 3AZLD 1F66B 3REIB 4AWLC 5B32G 5JA4A 3A6NB 1P3KB 1A7WA 2DF4C 3A1IA 3W97B 5CPJB 5KDMA 3WKJD 3AZLB 3REKA 3AZNB 1P3FC 5GXQD 1P3LD 3C1BD 2ZY5A 5GT3D 3LELC 1ID3C 5AV9A 1S32D 3AZKD 4H9RA 1TZYC 4X23B 3MVDC 3WKJB 4KGCD 2F8NB 3WTPA 5DNMC 5GSUA 4AWLB 3MGRD 3TU4D 3UT9A 2Y2IA 5B1MC 4WU8D 1HQ3D 5B31G 2AROA 3KXBC 3AYWA 3W96B 5BS7C 3AZKB 3P5JB 3LZ1C 1P3BA 1P3FB 3W99A 5B0YC 5CPID 3WA9D 3LELB 1ID3B 1BH8A 1TAFB 2PYOD 2BYMB 2ZY2A 4J8VD 3UTBD 4EO5C 3MVDB 3B6FA 5E5AC 4H9OB 5AV9C 4NFTA 5AV5D 2FFFB 3KXBB 5AV8C 3WTPC 5GSUC 5DNND 1EQZA 3O62D 1KX5A 2G5IC 5B32D 3LZ1B 2AROC 3EPJA 3AYWC 5B0YB 1KX4D 5AVBA 3R45B 4J8UA 5DNNB 3NQUA 4EO5B 3W99C 2NZDD 2JCHA 5E5AB 2XD5A 1P34D 4M6BA 4H9RB 3MNND 3LJAD 1M1AA 1T3UA 5AV8B 3KWQD 5GSUB 3X1SD 4J8XD 2BG1A 2CWEA 3AZEA 4H9QA 3X1TA 3V9RA 3KSYA 5B31D 3AFAA 4J8WA 3AZFA 5F99C 3AYWB 1AOID 2F8NG 5G49A 1EQZC 5BT1C 3MNNB 3C1CA 5AVCA 5CPKA 1P3ID 4Z5TC 1ZLAB 3W99B 4H9NA 1M18D 4XZQC 4JJND 4XUJB 1BH8B 4CSRB 4J8UC 4YS3C 1R4VA 2ZM5A 2HIOD 1HTAA 4Z2MH 3MGSA 3AV1A 5CP6C 4LD9C 3B6GA 5GT0C 3AV2C 3AZHD 3MGPA 4JJNB 3AZJC 2CV5D 4Z66D 1M1AC 4YM6C 3MGQD 5F99B 1BH9A 4G92C 5B40D 5B2ID 1M19D 3VH5T 1KX3A 3AZEC 1WWSA 2HIOB 1B67A 3X1TC 3FDDA 4Z5TB 5C3IC 3REHA 3AFAC 3AZFC 2JSSA 1F66D 3REID 4XZQB 4ZUXA 4Z66B 3KFUG 1KU5A 3A6ND 3VH6W 4YS3B 5CPKC 1P3KD 5GXQA 3W97D 3REJA 5CPJD 3WAAC 5GT3A 5CP6B 4UUZB 4LD9B 5GT0B 3AV2B 3LZ0C 1S32A 5B1LA 4QLCA 3AZJB 3AZND 4KGCA 4YM6B 4WU9D 5B33A 2RVQD 3KUYC 3MGRA 5B2JA 3MGSC 3B6GC 3AZMD 3AZEB 3W98A 3MGPC 4H9QB 3X1VC 4KUDA 3V9RB 4WNNA 5C3IB 4X23D 3AZFB 3AZIC 2F8ND 3NQJA 1KX3C 2RIQA 4WU9B 1U35A 5CPKB 5AY8A 3REHC 3F6TA 3AZMB 5CPIA 4R8PA 2Y2GA 4H9NB 3WA9A 4DQYB 5B0ZC 1Q9CA 3W96D 3WAAB 4ZUXC 3LZ0B 5BNXA 2FJ7A 3RELC 2Y2JA 1P3FD 3REJC 2Y2MA 3KUYB 5JRGA 3LELD 1ID3D 2F2AC 3X1UC 3X1VB 1S32C 1P3OA 5B1LC 5AV5A 4QLCC 3MVDD 5B33C 3AZIB 4E44A 5B2JC 3UTAA 3W98C 3AZGA 2YFWB 4KUDC 2BYKA 3REHB 2YFVB 3KXBD 5B0ZB 3IP4C 3REKC 3EG5B 4ZUXB 1TZYB 1F1EA 4KHAB 1U35C 3LZ1D 5AY8C 5FUGA 5DNMB 3RELB 1P3AA 2NZDA 4R8PC 3REJB 5B1MB 5B0YD 1H3OB 3H0MC 4DRAA 3X1UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ7 C;  5BO0 A;  5B1L B;  3LJA A;  5BNV A;  3UT9 C;  5B33 B;  3KWQ A;  3X1S A;  5B2J B;  5E5A D;  5JA4 B;  5AV6 A;  4J8X A;  5JRG C;  3W98 B;  5B31 A;  4KUD B;  5AV9 D;  4WNN B;  5AV5 C;  1P3O C;  5KDM B;  3NQJ B;  5AV8 D;  3WTP D;  5GSU D;  3UTA C;  3REK B;  1P3G A;  4Z2M G;  1P3B C;  3AZG C;  1U35 B;  1P3I A;  3AN2 A;  5AY8 B;  1N1J A;  3B0C W;  2NQB A;  4R8P B;  2IO5 C;  3AYW D;  5AV9 B;  1JFI A;  3B6F C;  2FJ7 B;  1WWI A;  1P3P A;  3WTP B;  1P3A C;  3UT9 B;  1ZLA D;  3W99 D;  4XUJ D;  5JRG B;  2ARO B;  2CV5 A;  1P3O B;  4HGA C;  3MGQ A;  1M19 A;  5B40 A;  5B2I A;  1P3M A;  1KX5 C;  3X1S C;  2F8N K;  5AV6 C;  4J8X C;  3UTA B;  1P3B B;  3AZG B;  5B31 C;  4H9P A;  5B24 A;  1F66 A;  5AVB C;  3REI A;  2IO5 B;  5F99 D;  3VH6 A;  1P3G C;  1P3K A;  3B6F B;  3AN2 C;  5FUG B;  4Z5T D;  1P3A B;  3W97 A;  5CPJ A;  2NQB C;  4XZQ D;  4CAY A;  3AZL A;  4J8U D;  5BO0 B;  1P3P C;  4YS3 D;  4HGA B;  5BNV B;  1EQZ B;  1KX5 B;  5AV6 B;  4LD9 D;  5CP6 D;  5GT0 D;  3AV2 D;  4J8W C;  3WKJ A;  3AZJ D;  3MGQ C;  3C1C C;  5AVB B;  4YM6 D;  5B40 C;  5B2I C;  1P3M C;  2F8N A;  5AVC C;  4J8U B;  1P3G B;  3NQU B;  1BFM A;  3AZE D;  3B0D C;  3AN2 B;  1P3L A;  3C1B A;  5B24 C;  3AZF D;  2NQB B;  3W96 A;  3AZK A;  1M1A B;  1P3P B;  4G92 B;  3TU4 A;  5CPK D;  3AV1 C;  1P3F A;  3W97 C;  4WU8 A;  1HQ3 A;  3X1T B;  3WAA D;  3LEL A;  3AZL C;  3AFA B;  1TAF A;  3LZ0 D;  4J8W B;  2BYM A;  3MVD A;  5G49 B;  3C1C B;  3KUY D;  5AVC B;  3MGS D;  3B6G D;  3B0D B;  3X1V D;  3WKJ C;  3KXB A;  3AZI D;  2PYO A;  5BS7 A;  1KX3 D;  4J8V A;  3VH6 T;  3UTB A;  5GXQ C;  3LZ1 A;  1P3L C;  3AV1 B;  3C1B C;  3MGS B;  3REH D;  5GT3 C;  3B6G B;  5B0Y A;  3MGP B;  3W96 C;  5B0Z D;  3AZK C;  3R45 A;  4ZUX D;  1TZY D;  4CAY B;  4KGC C;  1BH9 B;  5DNN A;  3TU4 C;  3MGR C;  3REL D;  5DNM D;  3O62 A;  1KX3 B;  5B32 A;  3REJ D;  5E5A A;  5B1M D;  4WU8 C;  1HQ3 C;  3X1U D;  2LY8 A;  5B1L D;  4QLC D;  4NE5 A;  1KX4 A;  5B33 D;  5AV8 A;  5B2J D;  4G91 C;  3W98 D;  5GXQ B;  5CPI C;  3WA9 C;  1B6W A;  1P3L B;  4KUD D;  3C1B B;  5GT3 B;  1P34 A;  4H9S A;  2PYO C;  4J8V C;  1S32 B;  4ZBJ C;  3MNN A;  3REK D;  3UTB C;  4QLC B;  4KGC B;  1U35 D;  3TU4 B;  3MGR B;  5AY8 D;  1ZLA A;  4R8P D;  4WU8 B;  4XUJ A;  1HQ3 B;  4CSR A;  1AOI A;  2FJ7 D;  5DNN C;  3O62 C;  3UT9 D;  5B32 C;  5JRG D;  4G91 B;  2ARO D;  1M18 A;  5CPI B;  4JJN A;  3WA9 B;  1P3O D;  1KX4 C;  5F99 A;  3VH5 A;  5BNX B;  2PYO B;  4J8V B;  3UTA D;  4ZBJ B;  4WZS B;  3UTB B;  2L5A A;  2HIO A;  1P3B D;  3AZG D;  2NZD C;  4Z5T A;  1P34 C;  3AZH A;  4XZQ A;  4H9S C;  4E45 A;  3MNN C;  4Z66 A;  5AV5 B;  3LJA C;  4YS3 A;  3KWQ C;  3B6F D;  3O62 B;  1P3A D;  1ZLA C;  5B32 B;  4LD9 A;  5CP6 A;  4XUJ C;  4UUZ A;  2BYK B;  5GT0 A;  5CHL B;  3AV2 A;  1AOI C;  3AZJ A;  1ULY A;  1KX4 B;  4YM6 A;  1EQZ D;  5BT1 D;  4NE6 A;  3WTP E;  3VH5 W;  3A6N A;  1P3I C;  1KX5 D;  5AV6 D;  3B0C T;  1M18 C;  2NZD B;  4JJN C;  1P34 B;  5AVB D;  3AZN A;  1P3G D;  3LJA B;  4WU9 A;  2HIO C;  3KWQ B;  3AN2 D;  3X1S B;  4J8X B;  3AZM A;  3AZH C;  2NQB D;  3WAA A;  5B31 B;  2CV5 C;  4X23 A;  4Z66 C;  3LZ0 A;  1M1A D;  1M19 C;  1AOI B;  1P3P D;  3KUY A;  1P3I B;  3X1T D;  2HUE C;  1N1J B;  3AFA D;  3X1V A;  4J8W D;  3REI C;  1M18 B;  1F66 C;  3C1C D;  3AZI A;  1P3M D;  1JFI B;  3A6N C;  1P3K C;  5AVC D;  3B0B A;  2YFW A;  5CPJ C;  2YFV A;  4WV4 B;  5B24 D;  3AZH B;  1ID3 A;  5B0Z A;  4DRB A;  2CV5 B;  2F8N H;  1TZY A;  3AZN C;  4WU9 C;  4KHA A;  2RVQ C;  3MGQ B;  1M19 B;  5B40 B;  5B2I B;  3REL A;  5DNM A;  1P3M B;  3AV1 D;  4H9O A;  3AZM C;  5B1M A;  1H3O A;  3MGP D;  2HUE B;  4X23 C;  4H9P B;  3X1U A;  4NE3 A;  5B24 B;  3AZL D;  1F66 B;  3REI B;  4AWL C;  5B32 G;  5JA4 A;  3A6N B;  1P3K B;  1A7W A;  3W97 B;  5CPJ B;  5KDM A;  3WKJ D;  3AZL B;  3REK A;  3AZN B;  1P3F C;  5GXQ D;  1P3L D;  3C1B D;  5GT3 D;  3LEL C;  1ID3 C;  5AV9 A;  1S32 D;  3AZK D;  4H9R A;  1TZY C;  4X23 B;  3MVD C;  3WKJ B;  4KGC D;  2F8N B;  3WTP A;  5DNM C;  5GSU A;  4AWL B;  3MGR D;  3TU4 D;  3UT9 A;  5B1M C;  4WU8 D;  1HQ3 D;  5B31 G;  2ARO A;  3KXB C;  3AYW A;  3W96 B;  5BS7 C;  3AZK B;  3LZ1 C;  1P3B A;  1P3F B;  3W99 A;  5B0Y C;  5CPI D;  3WA9 D;  3LEL B;  1ID3 B;  1BH8 A;  1TAF B;  2PYO D;  2BYM B;  4J8V D;  3UTB D;  4EO5 C;  3MVD B;  3B6F A;  5E5A C;  4H9O B;  5AV9 C;  4NFT A;  5AV5 D;  3KXB B;  5AV8 C;  3WTP C;  5GSU C;  5DNN D;  1EQZ A;  3O62 D;  1KX5 A;  5B32 D;  3LZ1 B;  2ARO C;  3AYW C;  5B0Y B;  1KX4 D;  5AVB A;  3R45 B;  4J8U A;  5DNN B;  3NQU A;  4EO5 B;  3W99 C;  2NZD D;  5E5A B;  1P34 D;  4M6B A;  4H9R B;  3MNN D;  3LJA D;  1M1A A;  5AV8 B;  3KWQ D;  5GSU B;  3X1S D;  4J8X D;  2CWE A;  3AZE A;  4H9Q A;  3X1T A;  3V9R A;  3KSY A;  5B31 D;  3AFA A;  4J8W A;  3AZF A;  5F99 C;  3AYW B;  1AOI D;  2F8N G;  5G49 A;  1EQZ C;  5BT1 C;  3MNN B;  3C1C A;  5AVC A;  5CPK A;  1P3I D;  4Z5T C;  1ZLA B;  3W99 B;  4H9N A;  1M18 D;  4XZQ C;  4JJN D;  4XUJ B;  1BH8 B;  4CSR B;  4J8U C;  4YS3 C;  1R4V A;  2HIO D;  1HTA A;  4Z2M H;  3MGS A;  3AV1 A;  5CP6 C;  4LD9 C;  3B6G A;  5GT0 C;  3AV2 C;  3AZH D;  3MGP A;  4JJN B;  3AZJ C;  2CV5 D;  4Z66 D;  1M1A C;  4YM6 C;  3MGQ D;  5F99 B;  1BH9 A;  4G92 C;  5B40 D;  5B2I D;  1M19 D;  3VH5 T;  1KX3 A;  3AZE C;  1WWS A;  2HIO B;  1B67 A;  3X1T C;  4Z5T B;  5C3I C;  3REH A;  3AFA C;  3AZF C;  2JSS A;  1F66 D;  3REI D;  4XZQ B;  4ZUX A;  4Z66 B;  1KU5 A;  3A6N D;  3VH6 W;  4YS3 B;  5CPK C;  1P3K D;  5GXQ A;  3W97 D;  3REJ A;  5CPJ D;  3WAA C;  5GT3 A;  5CP6 B;  4UUZ B;  4LD9 B;  5GT0 B;  3AV2 B;  3LZ0 C;  1S32 A;  5B1L A;  4QLC A;  3AZJ B;  3AZN D;  4KGC A;  4YM6 B;  4WU9 D;  5B33 A;  2RVQ D;  3KUY C;  3MGR A;  5B2J A;  3MGS C;  3B6G C;  3AZM D;  3AZE B;  3W98 A;  3MGP C;  4H9Q B;  3X1V C;  4KUD A;  3V9R B;  4WNN A;  5C3I B;  4X23 D;  3AZF B;  3AZI C;  2F8N D;  3NQJ A;  1KX3 C;  4WU9 B;  1U35 A;  5CPK B;  5AY8 A;  3REH C;  3AZM B;  5CPI A;  4R8P A;  3WA9 A;  4H9N B;  5B0Z C;  1Q9C A;  3W96 D;  3WAA B;  4ZUX C;  3LZ0 B;  5BNX A;  2FJ7 A;  3REL C;  1P3F D;  3REJ C;  3KUY B;  5JRG A;  3LEL D;  1ID3 D;  3X1U C;  3X1V B;  1S32 C;  1P3O A;  5B1L C;  5AV5 A;  4QLC C;  3MVD D;  5B33 C;  3AZI B;  4E44 A;  5B2J C;  3UTA A;  3W98 C;  3AZG A;  2YFW B;  4KUD C;  2BYK A;  3REH B;  2YFV B;  3KXB D;  5B0Z B;  3REK C;  4ZUX B;  1TZY B;  1F1E A;  4KHA B;  1U35 C;  3LZ1 D;  5AY8 C;  5FUG A;  5DNM B;  3REL B;  1P3A A;  2NZD A;  4R8P C;  3REJ B;  5B1M B;  1H3O B;  5B0Y D;  4DRA A;  3X1U B; 
#chains in the Genus database with same CATH topology
 2FJ7 C;  5BO0 A;  5B1L B;  3LJA A;  5BNV A;  3UT9 C;  5B33 B;  3KWQ A;  3X1S A;  5B2J B;  5E5A D;  5JA4 B;  5AV6 A;  4J8X A;  5JRG C;  3W98 B;  5B31 A;  4KUD B;  5AV9 D;  4WNN B;  5AV5 C;  1P3O C;  5KDM B;  3AL0 C;  3NQJ B;  5AV8 D;  3WTP D;  5GSU D;  3UTA C;  3REK B;  1P3G A;  1PZR A;  4Z2M G;  2VQR A;  1P3B C;  3AZG C;  1U35 B;  1P3I A;  3AN2 A;  5AY8 B;  1N1J A;  3B0C W;  2NQB A;  4R8P B;  2IO5 C;  3AYW D;  5AV9 B;  1JFI A;  3B6F C;  2FJ7 B;  1WWI A;  1P3P A;  3WTP B;  1P3A C;  2UWX A;  3UT9 B;  1ZLA D;  3W99 D;  4XUJ D;  5JRG B;  2ARO B;  2CV5 A;  1P3O B;  4HGA C;  2J8P A;  3MGQ A;  1M19 A;  5B40 A;  5B2I A;  1P3M A;  1KX5 C;  3X1S C;  2F8N K;  5AV6 C;  4J8X C;  3UTA B;  2JE5 A;  1P3B B;  3AZG B;  5B31 C;  4H9P A;  5B24 A;  1F66 A;  5AVB C;  3REI A;  2IO5 B;  5F99 D;  3VH6 A;  1P3G C;  1P3K A;  3B6F B;  3AN2 C;  5FUG B;  4Z5T D;  1P3A B;  3W97 A;  5CPJ A;  2NQB C;  4XZQ D;  4CAY A;  3AZL A;  4J8U D;  5BO0 B;  1P3P C;  4YS3 D;  4HGA B;  5BNV B;  1EQZ B;  1KX5 B;  5AV6 B;  4LD9 D;  5CP6 D;  5GT0 D;  3AV2 D;  4J8W C;  3WKJ A;  3AZJ D;  3MGQ C;  3C1C C;  5AVB B;  4YM6 D;  5B40 C;  5B2I C;  1P3M C;  2F8N A;  5AVC C;  4J8U B;  1P3G B;  3NQU B;  1BFM A;  3AZE D;  3B0D C;  3EPH A;  3AN2 B;  1P3L A;  3C1B A;  5B24 C;  3AZF D;  2NQB B;  3W96 A;  3AZK A;  1M1A B;  1P3P B;  4G92 B;  3TU4 A;  5CPK D;  3AV1 C;  1P3F A;  3W97 C;  2Y2Q A;  2Y2L A;  4WU8 A;  1HQ3 A;  3X1T B;  3WAA D;  3LEL A;  3AZL C;  3AFA B;  1TAF A;  3LZ0 D;  4J8W B;  2BYM A;  3MVD A;  5G49 B;  3C1C B;  3KUY D;  5AVC B;  3MGS D;  3B6G D;  3B0D B;  3X1V D;  3WKJ C;  3KXB A;  3AZI D;  2PYO A;  5BS7 A;  1KX3 D;  4J8V A;  4WJ3 C;  3VH6 T;  3UTB A;  1Z2C B;  5GXQ C;  3LZ1 A;  1P3L C;  2DQN C;  3AV1 B;  3C1B C;  3MGS B;  3REH D;  5GT3 C;  3B6G B;  4UPK A;  5B0Y A;  3MGP B;  3W96 C;  5B0Z D;  3AZK C;  3R45 A;  3EPK A;  4ZUX D;  1TZY D;  4CAY B;  4KGC C;  1BH9 B;  5DNN A;  3TU4 C;  3MGR C;  3REL D;  5DNM D;  3O62 A;  1KX3 B;  5B32 A;  3REJ D;  5E5A A;  5B1M D;  4WU8 C;  1HQ3 C;  3X1U D;  2LY8 A;  5B1L D;  4QLC D;  4NE5 A;  1KX4 A;  5B33 D;  5AV8 A;  5B2J D;  4G91 C;  3W98 D;  2G5H C;  5GXQ B;  5CPI C;  3WA9 C;  1B6W A;  1P3L B;  4KUD D;  3C1B B;  5GT3 B;  1P34 A;  2Y2P A;  4H9S A;  2PYO C;  4J8V C;  1S32 B;  4ZBJ C;  3MNN A;  3REK D;  3UTB C;  2W8S A;  4QLC B;  1W2E A;  4KGC B;  1U35 D;  3TU4 B;  3MGR B;  5AY8 D;  1ZLA A;  4R8P D;  4WU8 B;  4XUJ A;  1HQ3 B;  4CSR A;  1AOI A;  2FJ7 D;  5DNN C;  3O62 C;  3UT9 D;  5B32 C;  5JRG D;  4G91 B;  2ARO D;  1M18 A;  5CPI B;  4JJN A;  3WA9 B;  1P3O D;  1KX4 C;  5F99 A;  3VH5 A;  5BNX B;  2PYO B;  4J8V B;  3UTA D;  4ZBJ B;  4WZS B;  3UTB B;  2L5A A;  2HIO A;  1P3B D;  3AZG D;  2NZD C;  2ZY3 A;  4Z5T A;  1P34 C;  3AZH A;  4XZQ A;  4H9S C;  4E45 A;  3MNN C;  4Z66 A;  5AV5 B;  3LJA C;  4YS3 A;  3KWQ C;  3B6F D;  3O62 B;  1P3A D;  1ZLA C;  2Y2H A;  5B32 B;  4LD9 A;  5CP6 A;  4XUJ C;  4UUZ A;  2BYK B;  5GT0 A;  5CHL B;  3AV2 A;  2Y2N A;  2ZY4 A;  1AOI C;  3AZJ A;  1ULY A;  1KX4 B;  4YM6 A;  1EQZ D;  5BT1 D;  4NE6 A;  3WTP E;  3VH5 W;  3A6N A;  1P3I C;  1KX5 D;  5AV6 D;  3B0C T;  1M18 C;  2NZD B;  4JJN C;  3H0L C;  1P34 B;  5AVB D;  3AZN A;  1P3G D;  3LJA B;  4WU9 A;  2HIO C;  3KWQ B;  3AN2 D;  3X1S B;  4J8X B;  3AZM A;  3AZH C;  2NQB D;  3WAA A;  5B31 B;  2CV5 C;  4X23 A;  4Z66 C;  3LZ0 A;  1M1A D;  1M19 C;  1AOI B;  1P3P D;  3KUY A;  2XD1 A;  1P3I B;  3H0R C;  3X1T D;  2HUE C;  1N1J B;  3AFA D;  3A1K A;  4J8W D;  3REI C;  3X1V A;  1M18 B;  1F66 C;  3C1C D;  3AZI A;  2Y2K A;  1P3M D;  1JFI B;  3A6N C;  1P3K C;  5AVC D;  3B0B A;  2YFW A;  5CPJ C;  2Y2O A;  2YFV A;  4WV4 B;  5B24 D;  3AZH B;  1ID3 A;  3EPL A;  5B0Z A;  4DRB A;  2CV5 B;  2F8N H;  1TZY A;  3AZN C;  4WU9 C;  4KHA A;  2RVQ C;  3MGQ B;  1M19 B;  5B40 B;  5B2I B;  3REL A;  5DNM A;  1P3M B;  3AV1 D;  4H9O A;  3AZM C;  5B1M A;  1H3O A;  3MGP D;  2HUE B;  4X23 C;  4H9P B;  3X1U A;  4NE3 A;  5B24 B;  3AZL D;  1F66 B;  3REI B;  4AWL C;  5B32 G;  5JA4 A;  3A6N B;  1P3K B;  1A7W A;  2DF4 C;  3A1I A;  3W97 B;  5CPJ B;  5KDM A;  3WKJ D;  3AZL B;  3REK A;  3AZN B;  1P3F C;  5GXQ D;  1P3L D;  3C1B D;  2ZY5 A;  5GT3 D;  3LEL C;  1ID3 C;  5AV9 A;  1S32 D;  3AZK D;  4H9R A;  1TZY C;  4X23 B;  3MVD C;  3WKJ B;  4KGC D;  2F8N B;  3WTP A;  5DNM C;  5GSU A;  4AWL B;  3MGR D;  3TU4 D;  3UT9 A;  2Y2I A;  5B1M C;  4WU8 D;  1HQ3 D;  5B31 G;  2ARO A;  3KXB C;  3AYW A;  3W96 B;  5BS7 C;  3AZK B;  3P5J B;  3LZ1 C;  1P3B A;  1P3F B;  3W99 A;  5B0Y C;  5CPI D;  3WA9 D;  3LEL B;  1ID3 B;  1BH8 A;  1TAF B;  2PYO D;  2BYM B;  2ZY2 A;  4J8V D;  3UTB D;  4EO5 C;  3MVD B;  3B6F A;  5E5A C;  4H9O B;  5AV9 C;  4NFT A;  5AV5 D;  2FFF B;  3KXB B;  5AV8 C;  3WTP C;  5GSU C;  5DNN D;  1EQZ A;  3O62 D;  1KX5 A;  2G5I C;  5B32 D;  3LZ1 B;  2ARO C;  3EPJ A;  3AYW C;  5B0Y B;  1KX4 D;  5AVB A;  3R45 B;  4J8U A;  5DNN B;  3NQU A;  4EO5 B;  3W99 C;  2NZD D;  2JCH A;  5E5A B;  2XD5 A;  1P34 D;  4M6B A;  4H9R B;  3MNN D;  3LJA D;  1M1A A;  1T3U A;  5AV8 B;  3KWQ D;  5GSU B;  3X1S D;  4J8X D;  2BG1 A;  2CWE A;  3AZE A;  4H9Q A;  3X1T A;  3V9R A;  3KSY A;  5B31 D;  3AFA A;  4J8W A;  3AZF A;  5F99 C;  3AYW B;  1AOI D;  2F8N G;  5G49 A;  1EQZ C;  5BT1 C;  3MNN B;  3C1C A;  5AVC A;  5CPK A;  1P3I D;  4Z5T C;  1ZLA B;  3W99 B;  4H9N A;  1M18 D;  4XZQ C;  4JJN D;  4XUJ B;  1BH8 B;  4CSR B;  4J8U C;  4YS3 C;  1R4V A;  2ZM5 A;  2HIO D;  1HTA A;  4Z2M H;  3MGS A;  3AV1 A;  5CP6 C;  4LD9 C;  3B6G A;  5GT0 C;  3AV2 C;  3AZH D;  3MGP A;  4JJN B;  3AZJ C;  2CV5 D;  4Z66 D;  1M1A C;  4YM6 C;  3MGQ D;  5F99 B;  1BH9 A;  4G92 C;  5B40 D;  5B2I D;  1M19 D;  3VH5 T;  1KX3 A;  3AZE C;  1WWS A;  2HIO B;  1B67 A;  3X1T C;  3FDD A;  4Z5T B;  5C3I C;  3REH A;  3AFA C;  3AZF C;  2JSS A;  1F66 D;  3REI D;  4XZQ B;  4ZUX A;  4Z66 B;  3KFU G;  1KU5 A;  3A6N D;  3VH6 W;  4YS3 B;  5CPK C;  1P3K D;  5GXQ A;  3W97 D;  3REJ A;  5CPJ D;  3WAA C;  5GT3 A;  5CP6 B;  4UUZ B;  4LD9 B;  5GT0 B;  3AV2 B;  3LZ0 C;  1S32 A;  5B1L A;  4QLC A;  3AZJ B;  3AZN D;  4KGC A;  4YM6 B;  4WU9 D;  5B33 A;  2RVQ D;  3KUY C;  3MGR A;  5B2J A;  3MGS C;  3B6G C;  3AZM D;  3AZE B;  3W98 A;  3MGP C;  4H9Q B;  3X1V C;  4KUD A;  3V9R B;  4WNN A;  5C3I B;  4X23 D;  3AZF B;  3AZI C;  2F8N D;  3NQJ A;  1KX3 C;  2RIQ A;  4WU9 B;  1U35 A;  5CPK B;  5AY8 A;  3REH C;  3F6T A;  3AZM B;  5CPI A;  4R8P A;  2Y2G A;  4H9N B;  3WA9 A;  4DQY B;  5B0Z C;  1Q9C A;  3W96 D;  3WAA B;  4ZUX C;  3LZ0 B;  5BNX A;  2FJ7 A;  3REL C;  2Y2J A;  1P3F D;  3REJ C;  2Y2M A;  3KUY B;  5JRG A;  3LEL D;  1ID3 D;  2F2A C;  3X1U C;  3X1V B;  1S32 C;  1P3O A;  5B1L C;  5AV5 A;  4QLC C;  3MVD D;  5B33 C;  3AZI B;  4E44 A;  5B2J C;  3UTA A;  3W98 C;  3AZG A;  2YFW B;  4KUD C;  2BYK A;  3REH B;  2YFV B;  3KXB D;  5B0Z B;  3IP4 C;  3REK C;  3EG5 B;  4ZUX B;  1TZY B;  1F1E A;  4KHA B;  1U35 C;  3LZ1 D;  5AY8 C;  5FUG A;  5DNM B;  3REL B;  1P3A A;  2NZD A;  4R8P C;  3REJ B;  5B1M B;  5B0Y D;  1H3O B;  3H0M C;  4DRA A;  3X1U B; 
#chains in the Genus database with same CATH homology
 2FJ7 C;  5BO0 A;  5B1L B;  3LJA A;  5BNV A;  3UT9 C;  5B33 B;  3KWQ A;  3X1S A;  5B2J B;  5E5A D;  5JA4 B;  5AV6 A;  4J8X A;  5JRG C;  3W98 B;  5B31 A;  4KUD B;  5AV9 D;  4WNN B;  5AV5 C;  1P3O C;  5KDM B;  3AL0 C;  3NQJ B;  5AV8 D;  3WTP D;  5GSU D;  3UTA C;  3REK B;  1P3G A;  1PZR A;  4Z2M G;  2VQR A;  1P3B C;  3AZG C;  1U35 B;  1P3I A;  3AN2 A;  5AY8 B;  1N1J A;  3B0C W;  2NQB A;  4R8P B;  2IO5 C;  3AYW D;  5AV9 B;  1JFI A;  3B6F C;  2FJ7 B;  1WWI A;  1P3P A;  3WTP B;  1P3A C;  2UWX A;  3UT9 B;  1ZLA D;  3W99 D;  4XUJ D;  5JRG B;  2ARO B;  2CV5 A;  1P3O B;  4HGA C;  2J8P A;  3MGQ A;  1M19 A;  5B40 A;  5B2I A;  1P3M A;  1KX5 C;  3X1S C;  2F8N K;  5AV6 C;  4J8X C;  3UTA B;  2JE5 A;  1P3B B;  3AZG B;  5B31 C;  4H9P A;  5B24 A;  1F66 A;  5AVB C;  3REI A;  2IO5 B;  5F99 D;  3VH6 A;  1P3G C;  1P3K A;  3B6F B;  3AN2 C;  5FUG B;  4Z5T D;  1P3A B;  3W97 A;  5CPJ A;  2NQB C;  4XZQ D;  4CAY A;  3AZL A;  4J8U D;  5BO0 B;  1P3P C;  4YS3 D;  4HGA B;  5BNV B;  1EQZ B;  1KX5 B;  5AV6 B;  4LD9 D;  5CP6 D;  5GT0 D;  3AV2 D;  4J8W C;  3WKJ A;  3AZJ D;  3MGQ C;  3C1C C;  5AVB B;  4YM6 D;  5B40 C;  5B2I C;  1P3M C;  2F8N A;  5AVC C;  4J8U B;  1P3G B;  3NQU B;  1BFM A;  3AZE D;  3B0D C;  3EPH A;  3AN2 B;  1P3L A;  3C1B A;  5B24 C;  3AZF D;  2NQB B;  3W96 A;  3AZK A;  1M1A B;  1P3P B;  4G92 B;  3TU4 A;  5CPK D;  3AV1 C;  1P3F A;  3W97 C;  2Y2Q A;  2Y2L A;  4WU8 A;  1HQ3 A;  3X1T B;  3WAA D;  3LEL A;  3AZL C;  3AFA B;  1TAF A;  3LZ0 D;  4J8W B;  2BYM A;  3MVD A;  5G49 B;  3C1C B;  3KUY D;  5AVC B;  3MGS D;  3B6G D;  3B0D B;  3X1V D;  3WKJ C;  3KXB A;  3AZI D;  2PYO A;  5BS7 A;  1KX3 D;  4J8V A;  4WJ3 C;  3VH6 T;  3UTB A;  1Z2C B;  5GXQ C;  3LZ1 A;  1P3L C;  2DQN C;  3AV1 B;  3C1B C;  3MGS B;  3REH D;  5GT3 C;  3B6G B;  4UPK A;  5B0Y A;  3MGP B;  3W96 C;  5B0Z D;  3AZK C;  3R45 A;  3EPK A;  4ZUX D;  1TZY D;  4CAY B;  4KGC C;  1BH9 B;  5DNN A;  3TU4 C;  3MGR C;  3REL D;  5DNM D;  3O62 A;  1KX3 B;  5B32 A;  3REJ D;  5E5A A;  5B1M D;  4WU8 C;  1HQ3 C;  3X1U D;  2LY8 A;  5B1L D;  4QLC D;  4NE5 A;  1KX4 A;  5B33 D;  5AV8 A;  5B2J D;  4G91 C;  3W98 D;  2G5H C;  5GXQ B;  5CPI C;  3WA9 C;  1B6W A;  1P3L B;  4KUD D;  3C1B B;  5GT3 B;  1P34 A;  2Y2P A;  4H9S A;  2PYO C;  4J8V C;  1S32 B;  4ZBJ C;  3MNN A;  3REK D;  3UTB C;  2W8S A;  4QLC B;  1W2E A;  4KGC B;  1U35 D;  3TU4 B;  3MGR B;  5AY8 D;  1ZLA A;  4R8P D;  4WU8 B;  4XUJ A;  1HQ3 B;  4CSR A;  1AOI A;  2FJ7 D;  5DNN C;  3O62 C;  3UT9 D;  5B32 C;  5JRG D;  4G91 B;  2ARO D;  1M18 A;  5CPI B;  4JJN A;  3WA9 B;  1P3O D;  1KX4 C;  5F99 A;  3VH5 A;  5BNX B;  2PYO B;  4J8V B;  3UTA D;  4ZBJ B;  4WZS B;  3UTB B;  2L5A A;  2HIO A;  1P3B D;  3AZG D;  2NZD C;  2ZY3 A;  4Z5T A;  1P34 C;  3AZH A;  4XZQ A;  4H9S C;  4E45 A;  3MNN C;  4Z66 A;  5AV5 B;  3LJA C;  4YS3 A;  3KWQ C;  3B6F D;  3O62 B;  1P3A D;  1ZLA C;  2Y2H A;  5B32 B;  4LD9 A;  5CP6 A;  4XUJ C;  4UUZ A;  2BYK B;  5GT0 A;  5CHL B;  3AV2 A;  2Y2N A;  2ZY4 A;  1AOI C;  3AZJ A;  1ULY A;  1KX4 B;  4YM6 A;  1EQZ D;  5BT1 D;  4NE6 A;  3WTP E;  3VH5 W;  3A6N A;  1P3I C;  1KX5 D;  5AV6 D;  3B0C T;  1M18 C;  2NZD B;  4JJN C;  3H0L C;  1P34 B;  5AVB D;  3AZN A;  1P3G D;  3LJA B;  4WU9 A;  2HIO C;  3KWQ B;  3AN2 D;  3X1S B;  4J8X B;  3AZM A;  3AZH C;  2NQB D;  3WAA A;  5B31 B;  2CV5 C;  4X23 A;  4Z66 C;  3LZ0 A;  1M1A D;  1M19 C;  1AOI B;  1P3P D;  3KUY A;  2XD1 A;  1P3I B;  3H0R C;  3X1T D;  2HUE C;  1N1J B;  3AFA D;  3A1K A;  4J8W D;  3REI C;  3X1V A;  1M18 B;  1F66 C;  3C1C D;  3AZI A;  2Y2K A;  1P3M D;  1JFI B;  3A6N C;  1P3K C;  5AVC D;  3B0B A;  2YFW A;  5CPJ C;  2Y2O A;  2YFV A;  4WV4 B;  5B24 D;  3AZH B;  1ID3 A;  3EPL A;  5B0Z A;  4DRB A;  2CV5 B;  2F8N H;  1TZY A;  3AZN C;  4WU9 C;  4KHA A;  2RVQ C;  3MGQ B;  1M19 B;  5B40 B;  5B2I B;  3REL A;  5DNM A;  1P3M B;  3AV1 D;  4H9O A;  3AZM C;  5B1M A;  1H3O A;  3MGP D;  2HUE B;  4X23 C;  4H9P B;  3X1U A;  4NE3 A;  5B24 B;  3AZL D;  1F66 B;  3REI B;  4AWL C;  5B32 G;  5JA4 A;  3A6N B;  1P3K B;  1A7W A;  2DF4 C;  3A1I A;  3W97 B;  5CPJ B;  5KDM A;  3WKJ D;  3AZL B;  3REK A;  3AZN B;  1P3F C;  5GXQ D;  1P3L D;  3C1B D;  2ZY5 A;  5GT3 D;  3LEL C;  1ID3 C;  5AV9 A;  1S32 D;  3AZK D;  4H9R A;  1TZY C;  4X23 B;  3MVD C;  3WKJ B;  4KGC D;  2F8N B;  3WTP A;  5DNM C;  5GSU A;  4AWL B;  3MGR D;  3TU4 D;  3UT9 A;  2Y2I A;  5B1M C;  4WU8 D;  1HQ3 D;  5B31 G;  2ARO A;  3KXB C;  3AYW A;  3W96 B;  5BS7 C;  3AZK B;  3P5J B;  3LZ1 C;  1P3B A;  1P3F B;  3W99 A;  5B0Y C;  5CPI D;  3WA9 D;  3LEL B;  1ID3 B;  1BH8 A;  1TAF B;  2PYO D;  2BYM B;  2ZY2 A;  4J8V D;  3UTB D;  4EO5 C;  3MVD B;  3B6F A;  5E5A C;  4H9O B;  5AV9 C;  4NFT A;  5AV5 D;  2FFF B;  3KXB B;  5AV8 C;  3WTP C;  5GSU C;  5DNN D;  1EQZ A;  3O62 D;  1KX5 A;  2G5I C;  5B32 D;  3LZ1 B;  2ARO C;  3EPJ A;  3AYW C;  5B0Y B;  1KX4 D;  5AVB A;  3R45 B;  4J8U A;  5DNN B;  3NQU A;  4EO5 B;  3W99 C;  2NZD D;  2JCH A;  5E5A B;  2XD5 A;  1P34 D;  4M6B A;  4H9R B;  3MNN D;  3LJA D;  1M1A A;  1T3U A;  5AV8 B;  3KWQ D;  5GSU B;  3X1S D;  4J8X D;  2BG1 A;  2CWE A;  3AZE A;  4H9Q A;  3X1T A;  3V9R A;  3KSY A;  5B31 D;  3AFA A;  4J8W A;  3AZF A;  5F99 C;  3AYW B;  1AOI D;  2F8N G;  5G49 A;  1EQZ C;  5BT1 C;  3MNN B;  3C1C A;  5AVC A;  5CPK A;  1P3I D;  4Z5T C;  1ZLA B;  3W99 B;  4H9N A;  1M18 D;  4XZQ C;  4JJN D;  4XUJ B;  1BH8 B;  4CSR B;  4J8U C;  4YS3 C;  1R4V A;  2ZM5 A;  2HIO D;  1HTA A;  4Z2M H;  3MGS A;  3AV1 A;  5CP6 C;  4LD9 C;  3B6G A;  5GT0 C;  3AV2 C;  3AZH D;  3MGP A;  4JJN B;  3AZJ C;  2CV5 D;  4Z66 D;  1M1A C;  4YM6 C;  3MGQ D;  5F99 B;  1BH9 A;  4G92 C;  5B40 D;  5B2I D;  1M19 D;  3VH5 T;  1KX3 A;  3AZE C;  1WWS A;  2HIO B;  1B67 A;  3X1T C;  3FDD A;  4Z5T B;  5C3I C;  3REH A;  3AFA C;  3AZF C;  2JSS A;  1F66 D;  3REI D;  4XZQ B;  4ZUX A;  4Z66 B;  3KFU G;  1KU5 A;  3A6N D;  3VH6 W;  4YS3 B;  5CPK C;  1P3K D;  5GXQ A;  3W97 D;  3REJ A;  5CPJ D;  3WAA C;  5GT3 A;  5CP6 B;  4UUZ B;  4LD9 B;  5GT0 B;  3AV2 B;  3LZ0 C;  1S32 A;  5B1L A;  4QLC A;  3AZJ B;  3AZN D;  4KGC A;  4YM6 B;  4WU9 D;  5B33 A;  2RVQ D;  3KUY C;  3MGR A;  5B2J A;  3MGS C;  3B6G C;  3AZM D;  3AZE B;  3W98 A;  3MGP C;  4H9Q B;  3X1V C;  4KUD A;  3V9R B;  4WNN A;  5C3I B;  4X23 D;  3AZF B;  3AZI C;  2F8N D;  3NQJ A;  1KX3 C;  2RIQ A;  4WU9 B;  1U35 A;  5CPK B;  5AY8 A;  3REH C;  3F6T A;  3AZM B;  5CPI A;  4R8P A;  2Y2G A;  4H9N B;  3WA9 A;  4DQY B;  5B0Z C;  1Q9C A;  3W96 D;  3WAA B;  4ZUX C;  3LZ0 B;  5BNX A;  2FJ7 A;  3REL C;  2Y2J A;  1P3F D;  3REJ C;  2Y2M A;  3KUY B;  5JRG A;  3LEL D;  1ID3 D;  2F2A C;  3X1U C;  3X1V B;  1S32 C;  1P3O A;  5B1L C;  5AV5 A;  4QLC C;  3MVD D;  5B33 C;  3AZI B;  4E44 A;  5B2J C;  3UTA A;  3W98 C;  3AZG A;  2YFW B;  4KUD C;  2BYK A;  3REH B;  2YFV B;  3KXB D;  5B0Z B;  3IP4 C;  3REK C;  3EG5 B;  4ZUX B;  1TZY B;  1F1E A;  4KHA B;  1U35 C;  3LZ1 D;  5AY8 C;  5FUG A;  5DNM B;  3REL B;  1P3A A;  2NZD A;  4R8P C;  3REJ B;  5B1M B;  5B0Y D;  1H3O B;  3H0M C;  4DRA A;  3X1U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...