5BNXB

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.3-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.3
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnxB00
3UTBA 3KUYC 3MNNC 3AZNA 5B1MC 5BNXA 1P3GD 4J8XD 5AV5A 4KGCC 3AZND 3X1VB 3MGRA 3RELB 3X1TC 3B6FA 4H9NB 3B6FB 1ZLAC 5B24B 5CPIB 1WWSA 3LZ1B 1ZLAD 5JA4B 5B2JD 1P3FC 3AZLC 3UT9C 1P3MA 5GSUB 3AV2D 4H9QA 5B1MB 5GT0A 4WZSB 3B0CW 4WV4B 5GT0D 4G91B 3AZFA 3WA9C 2BYKA 5CP6A 3AZGC 1P3PD 5AV9C 5BS7A 1KX3D 1AOID 4Z5TD 3C1BC 1P3LC 3MGRB 3RELA 3TU4C 4LD9B 3MGQB 5B31B 3MVDA 1BH8A 4J8UD 3UTAA 5DNMD 3LJAC 3W98B 3REKA 3LZ0D 3AZED 4WU8A 4Z5TC 5DNND 5AV6A 3C1BD 3AZIC 1P3LD 3AZGB 3AYWA 3WTPB 2HIOD 3O62B 1P3OC 2FJ7C 5AVBC 5CPKD 4YM6B 4X23D 3X1SD 3KXBC 4XZQD 5B2ID 5JRGA 1KX4D 4CAYA 1P3IA 3AZMA 1F1EA 3LJAB 3UTAD 5B33D 5G49B 3WKJB 5JRGD 3MVDB 5B31A 4LD9A 5AV8A 5F99C 5CHLB 4XZQC 3AZJA 2AROD 3C1CC 5CPKA 1P3OB 4R8PD 3LZ1A 1AOIA 2BYMA 5B0YD 3LELD 3MNND 5AV6B 1P3BD 4EO5C 3REIB 1U35B 5AV8D 3AZJD 3AZKD 3MGSD 4X23C 4J8XA 1EQZB 5B33A 1P3AA 5BO0B 3MGQC 3WAAB 2YFVB 2NQBD 2NZDA 3UTBB 5AVCB 2CV5D 5AY8B 1KX3A 1HQ3C 4J8WB 3W99B 3UT9B 4JJNC 4WNNB 5GXQA 1KX5D 3VH6W 4WU9B 4UUZA 1M19B 1Q9CA 1U35C 5B40C 4YS3B 4WU8C 3AZIA 3X1UD 3AZHB 1WWIA 3B6GD 3X1UC 5CPJB 2NQBA 2NZDD 4J8VA 1H3OB 3X1VA 1F66C 1F66D 3MGSC 2IO5B 4ZBJC 1BH8B 1P3GB 3AV1D 3NQJB 3REIA 4J8WC 3AZMC 3REHA 3MNNA 5B0YC 4XUJC 5B0ZB 3W97B 5B24D 5CPID 4R8PA 5AV9D 3W96D 4LD9C 3W99A 1P3FB 4ZUXB 3MGRC 3AZKC 5G49A 3KXBD 3AZFB 4HGAB 4AWLC 3X1TA 2CV5A 5AY8A 5B1MD 4J8VD 1P3IB 3AZHA 3WAAC 3AZIB 3AZLA 2PYOB 4NE3A 1KX4A 3W98C 5AVBB 4G91C 3O62C 5B1LA 1M18D 1KX5C 5B2JA 5KDMA 3WTPC 4QLCB 1HQ3B 1M1AC 3REHB 1AOIB 3REKB 1M1AD 2AROA 3AZFC 1P3AB 3KSYA 4J8UC 1TZYB 5FUGB 3AZMD 2L5AA 4Z66A 1ID3B 4H9RA 1P3BC 3MGPD 4KGCD 1P3KD 3AZGD 1P3PC 4KUDD 4DRBA 4UUZB 1M19A 2FJ7D 4JJND 3UT9A 3VH6A 3X1SB 1P3KA 3WKJA 1S32D 5B2IB 4NE6A 3AZLB 2PYOA 4WU8D 5C3IC 3AYWC 1HTAA 4AWLB 3B0BA 3UTAB 5GT3C 3KXBA 3WKJD 5JRGC 2F8NK 3WA9A 2CV5C 5AY8C 2AROB 3W97A 3AFAD 1P3OD 5B24A 5CPIA 3AZGA 3AYWD 3LELC 1KU5A 3VH5A 1A7WA 3MGPC 5AV6D 3B0DC 3C1BA 1P3LA 1KX4C 3NQJA 3KWQA 3R45B 1TZYA 3REID 4E45A 5AV8C 3AZJC 3AN2A 5E5AD 3MVDC 4NE5A 3AZNB 3UTAC 3TU4B 3X1VD 3RELD 4XUJD 1M1AA 3UTBD 2AROC 3C1CD 2CV5B 1S32A 3AV2A 4WU9A 5B2IA 5B2JB 3REIC 1TAFA 3REJB 5AVBA 3A6NA 5GSUD 3AV2B 4KUDA 4WU9D 4Z66C 4H9NA 4G92B 1P34C 3UTBC 3B6GC 1P34D 3AZNC 5B1MA 5GT0B 1P3GA 1BFMA 1P3MB 1F66B 1U35A 2PYOC 5GT3B 3AV1B 5BT1D 2HUEC 3X1UA 1ZLAA 3LZ1C 4YS3A 4H9PA 3AFAA 3W97D 5GXQB 5B1LB 5E5AC 4LD9D 2BYKB 5CP6B 1TAFB 4J8WA 2IO5C 4ZBJB 4ZUXD 2F8ND 4XUJA 5B31G 2YFWA 3AZEC 2HIOB 3AZKA 3V9RA 4J8XB 1EQZA 5B32C 3KWQD 5AV9A 4QLCD 1HQ3D 3B6FD 3LZ1D 1ZLAB 5FUGA 3W98A 3AV2C 2YFVA 4CSRB 3AV1A 2NQBC 5AV5D 5B33B 5DNMA 1F66A 3AN2B 3MVDD 5BNXB 3MGSA 4CSRA 3B0CT 3LJAA 2HIOC 3VH5W 1P34A 3AZMB 3B6GA 1B6WA 4Z5TA 5AV6C 2HUEB 3LELB 1JFIB 4QLCA 5B40D 1P3OA 1P3KB 3A6ND 3X1SA 4KUDB 4R8PC 3WA9B 2FJ7A 5AV8B 4DRAA 3AZJB 3V9RB 2FJ7B 4ZUXC 1R4VA 3AZKB 3REJA 4JJNB 1P3PB 3B0DB 3KUYD 1S32B 3AZLD 4Z66D 3W96C 5B32G 4WU8B 1B67A 5C3IB 3WAAA 4H9OB 3MGQD 5E5AA 5AV5C 4H9SC 5B31C 5B32D 3WKJC 3VH5T 5DNMB 4YM6A 1ULYA 3W98D 3O62A 5CPKC 3AZEB 3B6FC 4YS3D 3C1BB 5DNNB 1P3LB 1BH9B 2RVQC 3X1UB 3WTPD 3B6GB 3O62D 1M18A 3AZEA 5CPJD 5GT3A 4YM6D 4X23B 1EQZC 5GT0C 3MGQA 1KX4B 4J8UA 5B33C 1P3AC 2NZDC 3TU4D 4XUJB 5B0ZC 1TZYC 5B0ZD 5F99D 1HQ3A 3KUYA 3X1TD 1KX3C 5AV9B 5GSUA 5GXQC 4Z2MH 5B40A 4R8PB 3AZFD 4KGCA 5JA4A 2YFWB 1P3KC 4KHAA 2F8NH 3MNNB 5AVCA 1S32C 5B2IC 1P34B 3TU4A 3X1VC 5BO0A 1U35D 4J8VC 3MGSB 4ZUXA 1P3FA 2F8NG 2LY8A 3WTPE 1P3MD 1M18B 5GT3D 5CPJA 5AVCD 4Z2MG 1BH9A 1N1JB 2CWEA 3REHC 5B0YA 3REHD 4WNNA 3W99C 1H3OA 3AZHD 2F8NB 3VH6T 2JSSA 2NZDB 4NFTA 1M18C 5BT1C 4KGCB 3LZ0C 4H9QB 4XZQA 3R45A 3KWQB 5B2JC 3WTPA 1KX3B 4Z5TB 4G92C 1ID3A 5B0ZA 3REKC 5DNNA 1N1JA 3MGRD 3W96B 3NQUA 5GSUC 5B31D 4J8UB 5B32A 1P3FD 5AV5B 1P3GC 3KXBB 3AN2D 3NQUB 3LZ0B 4J8VB 5AVCC 1P3ID 1P3BA 3AZID 1P3IC 2PYOD 2BYMB 3AV1C 4KHAB 5KDMB 1P3PA 5CPKB 4JJNA 5B40B 4YS3C 5AVBD 3AFAC 3A6NB 1M19C 4XZQB 3WA9D 2HIOA 5E5AB 5CPJC 5F99A 3KUYB 3C1CA 4Z66B 4M6BA 3REKD 1M1AB 1AOIC 3LJAD 3C1CB 1P3AD 5JRGB 3REJC 3REJD 5B32B 1P3MC 1TZYD 4X23A 4J8XC 3W97C 3W96A 5CPIC 5B24C 5B0YB 1ID3D 1JFIA 3LELA 3MGPB 2RVQD 3MGPA 1P3BB 3KWQC 4H9SA 3LZ0A 4YM6C 1EQZD 4HGAC 3AN2C 5DNMC 5CP6C 3WAAD 4H9OA 2NQBB 1ID3C 3AZHC 5BS7C 5DNNC 4E44A 2F8NA 5AY8D 4WU9C 4CAYB 4J8WD 5F99B 3W99D 4QLCC 3RELC 3UT9D 3X1TB 5B1LC 5BNVB 1KX5B 5GXQD 5BNVA 3X1SC 5B1LD 1KX5A 1M19D 5CP6D 4H9PB 3A6NC 3AFAB 4KUDC 3AYWB 4EO5B 4H9RB
chains in the Genus database with same CATH superfamily
3UTBA 3KUYC 3MNNC 3AZNA 5B1MC 5BNXA 1P3GD 4J8XD 5AV5A 4KGCC 3AZND 3X1VB 3MGRA 3RELB 3X1TC 3B6FA 4H9NB 3B6FB 1ZLAC 5B24B 5CPIB 1WWSA 3LZ1B 1ZLAD 5JA4B 5B2JD 1P3FC 3AZLC 3H0MC 3UT9C 1P3MA 2ZY4A 5GSUB 3AV2D 4H9QA 5B1MB 5GT0A 4WZSB 3B0CW 4WV4B 1Z2CB 2DF4C 5GT0D 2VQRA 4G91B 2Y2LA 3AZFA 3WA9C 2BYKA 5CP6A 2ZM5A 2JE5A 3AZGC 1P3PD 5AV9C 5BS7A 1KX3D 1AOID 4Z5TD 3C1BC 1P3LC 3MGRB 3RELA 3TU4C 4LD9B 3MGQB 5B31B 3MVDA 1BH8A 4J8UD 2JCHA 3UTAA 5DNMD 3LJAC 2J8PA 3W98B 3REKA 3LZ0D 3AZED 4WU8A 4Z5TC 5DNND 5AV6A 3C1BD 3AZIC 1P3LD 3H0RC 3AZGB 3AYWA 3WTPB 3EPLA 2HIOD 3O62B 1P3OC 2FJ7C 5AVBC 5CPKD 4YM6B 4X23D 3X1SD 3KXBC 4XZQD 5B2ID 5JRGA 1KX4D 4CAYA 1P3IA 3AZMA 1F1EA 3LJAB 3UTAD 5B33D 5G49B 3WKJB 5JRGD 5B31A 3MVDB 4LD9A 5AV8A 5F99C 5CHLB 4XZQC 2XD5A 2AROD 3C1CC 3AZJA 5CPKA 2XD1A 1P3OB 4R8PD 3LZ1A 1AOIA 2BYMA 5B0YD 3LELD 3MNND 5AV6B 1P3BD 4EO5C 3REIB 1U35B 5AV8D 3AZJD 3AZKD 3MGSD 4X23C 4J8XA 1EQZB 5B33A 2ZY5A 5BO0B 3MGQC 1P3AA 3WAAB 2YFVB 2NQBD 2NZDA 3UTBB 3EPHA 5AVCB 2Y2OA 1W2EA 2CV5D 5AY8B 1KX3A 2RIQA 1HQ3C 4J8WB 3W99B 3H0LC 3UT9B 4JJNC 4WNNB 5GXQA 1KX5D 3VH6W 4WU9B 4UUZA 1M19B 1Q9CA 1U35C 5B40C 4YS3B 4WU8C 3AZIA 3X1UD 3AZHB 1WWIA 3B6GD 3X1UC 5CPJB 2NQBA 2NZDD 4J8VA 1H3OB 3X1VA 1F66C 1F66D 3MGSC 2IO5B 4ZBJC 1BH8B 1P3GB 3AV1D 2W8SA 3NQJB 3REIA 4J8WC 3AZMC 3REHA 3MNNA 5B0YC 4XUJC 5B0ZB 2G5HC 3W97B 5B24D 5CPID 4R8PA 5AV9D 3W96D 4LD9C 3W99A 2ZY2A 1P3FB 4ZUXB 3MGRC 3AZKC 5G49A 3KXBD 3AZFB 4HGAB 4AWLC 3X1TA 2CV5A 5AY8A 5B1MD 4J8VD 1P3IB 3AZHA 3WAAC 3AZIB 3AZLA 2PYOB 4NE3A 1KX4A 3W98C 5AVBB 4G91C 3O62C 5B1LA 1M18D 1KX5C 5B2JA 5KDMA 3WTPC 4QLCB 4UPKA 1HQ3B 1M1AC 3REHB 1AOIB 3REKB 1M1AD 2AROA 3AZFC 1P3AB 3KSYA 4J8UC 1TZYB 5FUGB 3AZMD 2L5AA 4Z66A 1ID3B 4H9RA 1P3BC 2Y2HA 3MGPD 4KGCD 1P3KD 3AZGD 1P3PC 4KUDD 4DRBA 4UUZB 1M19A 2FJ7D 4JJND 3UT9A 3VH6A 3X1SB 1P3KA 3WKJA 1S32D 5B2IB 4NE6A 3AZLB 2PYOA 4WU8D 5C3IC 3AYWC 1HTAA 4AWLB 3B0BA 2F2AC 3UTAB 5GT3C 3KXBA 3WKJD 5JRGC 2F8NK 3WA9A 2CV5C 5AY8C 2AROB 3W97A 3AFAD 1P3OD 5B24A 5CPIA 3AZGA 3AYWD 3IP4C 3LELC 1KU5A 2G5IC 1A7WA 3VH5A 3MGPC 5AV6D 3B0DC 3C1BA 1P3LA 1KX4C 3NQJA 3KWQA 3R45B 1TZYA 3REID 4E45A 5AV8C 3AZJC 3AN2A 2Y2GA 5E5AD 3MVDC 4NE5A 3AZNB 3UTAC 3TU4B 3X1VD 3RELD 4XUJD 1M1AA 3UTBD 2AROC 3C1CD 2CV5B 1S32A 3AV2A 4WU9A 5B2IA 5B2JB 3REIC 1TAFA 3REJB 5AVBA 3A6NA 5GSUD 3AV2B 4KUDA 4WU9D 4Z66C 4H9NA 4G92B 1P34C 3UTBC 3B6GC 1P34D 3AZNC 5B1MA 5GT0B 1P3GA 1BFMA 1P3MB 1F66B 1U35A 2PYOC 5GT3B 3AV1B 5BT1D 2HUEC 3X1UA 1ZLAA 3LZ1C 4YS3A 4H9PA 3AFAA 3W97D 5GXQB 2Y2PA 5B1LB 5E5AC 4LD9D 2BYKB 5CP6B 1TAFB 4J8WA 2IO5C 4ZBJB 4ZUXD 2F8ND 4XUJA 1T3UA 5B31G 2YFWA 3AZEC 2HIOB 3AZKA 3V9RA 2Y2IA 4J8XB 1EQZA 5B32C 3KWQD 5AV9A 4QLCD 1HQ3D 3B6FD 3LZ1D 1ZLAB 5FUGA 3W98A 3AV2C 2YFVA 4CSRB 3AV1A 2NQBC 5AV5D 5B33B 5DNMA 1F66A 3AN2B 3MVDD 2Y2KA 5BNXB 3MGSA 4CSRA 3B0CT 3LJAA 2HIOC 3VH5W 1P34A 3AZMB 3B6GA 1B6WA 4Z5TA 5AV6C 2HUEB 3LELB 1JFIB 4QLCA 5B40D 1P3OA 1P3KB 3A6ND 3X1SA 4KUDB 4R8PC 3WA9B 2FJ7A 5AV8B 4DRAA 3AZJB 3V9RB 2FJ7B 4ZUXC 1R4VA 3AZKB 3REJA 4JJNB 1P3PB 3B0DB 3KUYD 1S32B 3AZLD 4Z66D 3W96C 5B32G 2Y2NA 4WU8B 1B67A 5C3IB 2FFFB 3WAAA 4H9OB 3MGQD 5E5AA 5AV5C 4H9SC 5B31C 5B32D 3WKJC 3VH5T 5DNMB 4YM6A 1ULYA 3W98D 3EG5B 3O62A 5CPKC 3AZEB 3B6FC 4YS3D 3C1BB 5DNNB 1P3LB 1BH9B 2RVQC 3X1UB 3WTPD 3B6GB 2UWXA 3O62D 1M18A 3AZEA 5CPJD 5GT3A 4YM6D 4X23B 1EQZC 5GT0C 3MGQA 1KX4B 4J8UA 5B33C 1P3AC 2NZDC 3TU4D 4XUJB 5B0ZC 1TZYC 5B0ZD 5F99D 1HQ3A 3KUYA 3X1TD 1KX3C 5AV9B 5GSUA 5GXQC 4Z2MH 5B40A 4R8PB 3AZFD 3EPJA 4KGCA 5JA4A 2YFWB 1P3KC 4KHAA 2F8NH 3MNNB 5AVCA 1S32C 5B2IC 1P34B 3TU4A 3X1VC 5BO0A 1U35D 4J8VC 3MGSB 4ZUXA 1P3FA 2F8NG 2LY8A 3WTPE 1P3MD 1M18B 5GT3D 5CPJA 5AVCD 2DQNC 4Z2MG 1BH9A 1N1JB 2CWEA 3REHC 5B0YA 3REHD 4WNNA 3W99C 1H3OA 3AZHD 2F8NB 1PZRA 3VH6T 2JSSA 2NZDB 4NFTA 1M18C 3EPKA 3AL0C 5BT1C 4KGCB 3LZ0C 4H9QB 4XZQA 3KFUG 3R45A 3KWQB 5B2JC 3WTPA 1KX3B 4Z5TB 4G92C 1ID3A 5B0ZA 3REKC 5DNNA 1N1JA 3MGRD 2ZY3A 3W96B 3NQUA 5GSUC 5B31D 4J8UB 5B32A 1P3FD 5AV5B 1P3GC 3KXBB 3AN2D 3NQUB 3LZ0B 4J8VB 5AVCC 1P3ID 1P3BA 3AZID 1P3IC 2PYOD 2BYMB 3AV1C 4KHAB 5KDMB 1P3PA 5CPKB 4JJNA 5B40B 3F6TA 5AVBD 4YS3C 3AFAC 3A6NB 1M19C 4XZQB 3WA9D 2HIOA 5E5AB 5CPJC 5F99A 3A1KA 3KUYB 3C1CA 4Z66B 4M6BA 3REKD 1M1AB 1AOIC 3LJAD 3A1IA 3C1CB 1P3AD 5JRGB 3REJC 2Y2MA 3REJD 5B32B 1P3MC 1TZYD 4X23A 4J8XC 3W97C 3W96A 5CPIC 5B24C 3P5JB 5B0YB 1ID3D 1JFIA 3LELA 3MGPB 2RVQD 3MGPA 1P3BB 3KWQC 4H9SA 3LZ0A 3FDDA 4YM6C 1EQZD 4HGAC 3AN2C 5DNMC 5CP6C 2Y2JA 3WAAD 4H9OA 2NQBB 1ID3C 3AZHC 5BS7C 5DNNC 4E44A 2F8NA 5AY8D 4WU9C 4CAYB 4J8WD 5F99B 4DQYB 2BG1A 3W99D 4QLCC 3RELC 3UT9D 3X1TB 2Y2QA 5B1LC 5BNVB 1KX5B 5GXQD 5BNVA 3X1SC 5B1LD 1KX5A 1M19D 5CP6D 4H9PB 3A6NC 3AFAB 4KUDC 3AYWB 4WJ3C 4EO5B 4H9RB
chains in the Genus database with same CATH topology
3UTBA 3KUYC 3MNNC 3AZNA 5B1MC 5BNXA 1P3GD 4J8XD 5AV5A 4KGCC 3AZND 3X1VB 3MGRA 3RELB 3X1TC 3B6FA 4H9NB 3B6FB 1ZLAC 5B24B 5CPIB 1WWSA 3LZ1B 1ZLAD 5JA4B 5B2JD 1P3FC 3AZLC 3H0MC 3UT9C 1P3MA 2ZY4A 5GSUB 3AV2D 4H9QA 5B1MB 5GT0A 4WZSB 3B0CW 4WV4B 1Z2CB 2DF4C 5GT0D 2VQRA 4G91B 2Y2LA 3AZFA 3WA9C 2BYKA 5CP6A 2ZM5A 2JE5A 3AZGC 1P3PD 5AV9C 5BS7A 1KX3D 1AOID 4Z5TD 3C1BC 1P3LC 3MGRB 3RELA 3TU4C 4LD9B 3MGQB 5B31B 3MVDA 1BH8A 4J8UD 2JCHA 3UTAA 5DNMD 3LJAC 2J8PA 3W98B 3REKA 3LZ0D 3AZED 4WU8A 4Z5TC 5DNND 5AV6A 3C1BD 3AZIC 1P3LD 3H0RC 3AZGB 3AYWA 3WTPB 3EPLA 2HIOD 3O62B 1P3OC 2FJ7C 5AVBC 5CPKD 4YM6B 4X23D 3X1SD 3KXBC 4XZQD 5B2ID 5JRGA 1KX4D 4CAYA 1P3IA 3AZMA 1F1EA 3LJAB 3UTAD 5B33D 5G49B 3WKJB 5JRGD 5B31A 3MVDB 4LD9A 5AV8A 5F99C 5CHLB 4XZQC 2XD5A 2AROD 3C1CC 3AZJA 5CPKA 2XD1A 1P3OB 4R8PD 3LZ1A 1AOIA 2BYMA 5B0YD 3LELD 3MNND 5AV6B 1P3BD 4EO5C 3REIB 1U35B 5AV8D 3AZJD 3AZKD 3MGSD 4X23C 4J8XA 1EQZB 5B33A 2ZY5A 5BO0B 3MGQC 1P3AA 3WAAB 2YFVB 2NQBD 2NZDA 3UTBB 3EPHA 5AVCB 2Y2OA 1W2EA 2CV5D 5AY8B 1KX3A 2RIQA 1HQ3C 4J8WB 3W99B 3H0LC 3UT9B 4JJNC 4WNNB 5GXQA 1KX5D 3VH6W 4WU9B 4UUZA 1M19B 1Q9CA 1U35C 5B40C 4YS3B 4WU8C 3AZIA 3X1UD 3AZHB 1WWIA 3B6GD 3X1UC 5CPJB 2NQBA 2NZDD 4J8VA 1H3OB 3X1VA 1F66C 1F66D 3MGSC 2IO5B 4ZBJC 1BH8B 1P3GB 3AV1D 2W8SA 3NQJB 3REIA 4J8WC 3AZMC 3REHA 3MNNA 5B0YC 4XUJC 5B0ZB 2G5HC 3W97B 5B24D 5CPID 4R8PA 5AV9D 3W96D 4LD9C 3W99A 2ZY2A 1P3FB 4ZUXB 3MGRC 3AZKC 5G49A 3KXBD 3AZFB 4HGAB 4AWLC 3X1TA 2CV5A 5AY8A 5B1MD 4J8VD 1P3IB 3AZHA 3WAAC 3AZIB 3AZLA 2PYOB 4NE3A 1KX4A 3W98C 5AVBB 4G91C 3O62C 5B1LA 1M18D 1KX5C 5B2JA 5KDMA 3WTPC 4QLCB 4UPKA 1HQ3B 1M1AC 3REHB 1AOIB 3REKB 1M1AD 2AROA 3AZFC 1P3AB 3KSYA 4J8UC 1TZYB 5FUGB 3AZMD 2L5AA 4Z66A 1ID3B 4H9RA 1P3BC 2Y2HA 3MGPD 4KGCD 1P3KD 3AZGD 1P3PC 4KUDD 4DRBA 4UUZB 1M19A 2FJ7D 4JJND 3UT9A 3VH6A 3X1SB 1P3KA 3WKJA 1S32D 5B2IB 4NE6A 3AZLB 2PYOA 4WU8D 5C3IC 3AYWC 1HTAA 4AWLB 3B0BA 2F2AC 3UTAB 5GT3C 3KXBA 3WKJD 5JRGC 2F8NK 3WA9A 2CV5C 5AY8C 2AROB 3W97A 3AFAD 1P3OD 5B24A 5CPIA 3AZGA 3AYWD 3IP4C 3LELC 1KU5A 2G5IC 1A7WA 3VH5A 3MGPC 5AV6D 3B0DC 3C1BA 1P3LA 1KX4C 3NQJA 3KWQA 3R45B 1TZYA 3REID 4E45A 5AV8C 3AZJC 3AN2A 2Y2GA 5E5AD 3MVDC 4NE5A 3AZNB 3UTAC 3TU4B 3X1VD 3RELD 4XUJD 1M1AA 3UTBD 2AROC 3C1CD 2CV5B 1S32A 3AV2A 4WU9A 5B2IA 5B2JB 3REIC 1TAFA 3REJB 5AVBA 3A6NA 5GSUD 3AV2B 4KUDA 4WU9D 4Z66C 4H9NA 4G92B 1P34C 3UTBC 3B6GC 1P34D 3AZNC 5B1MA 5GT0B 1P3GA 1BFMA 1P3MB 1F66B 1U35A 2PYOC 5GT3B 3AV1B 5BT1D 2HUEC 3X1UA 1ZLAA 3LZ1C 4YS3A 4H9PA 3AFAA 3W97D 5GXQB 2Y2PA 5B1LB 5E5AC 4LD9D 2BYKB 5CP6B 1TAFB 4J8WA 2IO5C 4ZBJB 4ZUXD 2F8ND 4XUJA 1T3UA 5B31G 2YFWA 3AZEC 2HIOB 3AZKA 3V9RA 2Y2IA 4J8XB 1EQZA 5B32C 3KWQD 5AV9A 4QLCD 1HQ3D 3B6FD 3LZ1D 1ZLAB 5FUGA 3W98A 3AV2C 2YFVA 4CSRB 3AV1A 2NQBC 5AV5D 5B33B 5DNMA 1F66A 3AN2B 3MVDD 2Y2KA 5BNXB 3MGSA 4CSRA 3B0CT 3LJAA 2HIOC 3VH5W 1P34A 3AZMB 3B6GA 1B6WA 4Z5TA 5AV6C 2HUEB 3LELB 1JFIB 4QLCA 5B40D 1P3OA 1P3KB 3A6ND 3X1SA 4KUDB 4R8PC 3WA9B 2FJ7A 5AV8B 4DRAA 3AZJB 3V9RB 2FJ7B 4ZUXC 1R4VA 3AZKB 3REJA 4JJNB 1P3PB 3B0DB 3KUYD 1S32B 3AZLD 4Z66D 3W96C 5B32G 2Y2NA 4WU8B 1B67A 5C3IB 2FFFB 3WAAA 4H9OB 3MGQD 5E5AA 5AV5C 4H9SC 5B31C 5B32D 3WKJC 3VH5T 5DNMB 4YM6A 1ULYA 3W98D 3EG5B 3O62A 5CPKC 3AZEB 3B6FC 4YS3D 3C1BB 5DNNB 1P3LB 1BH9B 2RVQC 3X1UB 3WTPD 3B6GB 2UWXA 3O62D 1M18A 3AZEA 5CPJD 5GT3A 4YM6D 4X23B 1EQZC 5GT0C 3MGQA 1KX4B 4J8UA 5B33C 1P3AC 2NZDC 3TU4D 4XUJB 5B0ZC 1TZYC 5B0ZD 5F99D 1HQ3A 3KUYA 3X1TD 1KX3C 5AV9B 5GSUA 5GXQC 4Z2MH 5B40A 4R8PB 3AZFD 3EPJA 4KGCA 5JA4A 2YFWB 1P3KC 4KHAA 2F8NH 3MNNB 5AVCA 1S32C 5B2IC 1P34B 3TU4A 3X1VC 5BO0A 1U35D 4J8VC 3MGSB 4ZUXA 1P3FA 2F8NG 2LY8A 3WTPE 1P3MD 1M18B 5GT3D 5CPJA 5AVCD 2DQNC 4Z2MG 1BH9A 1N1JB 2CWEA 3REHC 5B0YA 3REHD 4WNNA 3W99C 1H3OA 3AZHD 2F8NB 1PZRA 3VH6T 2JSSA 2NZDB 4NFTA 1M18C 3EPKA 3AL0C 5BT1C 4KGCB 3LZ0C 4H9QB 4XZQA 3KFUG 3R45A 3KWQB 5B2JC 3WTPA 1KX3B 4Z5TB 4G92C 1ID3A 5B0ZA 3REKC 5DNNA 1N1JA 3MGRD 2ZY3A 3W96B 3NQUA 5GSUC 5B31D 4J8UB 5B32A 1P3FD 5AV5B 1P3GC 3KXBB 3AN2D 3NQUB 3LZ0B 4J8VB 5AVCC 1P3ID 1P3BA 3AZID 1P3IC 2PYOD 2BYMB 3AV1C 4KHAB 5KDMB 1P3PA 5CPKB 4JJNA 5B40B 3F6TA 5AVBD 4YS3C 3AFAC 3A6NB 1M19C 4XZQB 3WA9D 2HIOA 5E5AB 5CPJC 5F99A 3A1KA 3KUYB 3C1CA 4Z66B 4M6BA 3REKD 1M1AB 1AOIC 3LJAD 3A1IA 3C1CB 1P3AD 5JRGB 3REJC 2Y2MA 3REJD 5B32B 1P3MC 1TZYD 4X23A 4J8XC 3W97C 3W96A 5CPIC 5B24C 3P5JB 5B0YB 1ID3D 1JFIA 3LELA 3MGPB 2RVQD 3MGPA 1P3BB 3KWQC 4H9SA 3LZ0A 3FDDA 4YM6C 1EQZD 4HGAC 3AN2C 5DNMC 5CP6C 2Y2JA 3WAAD 4H9OA 2NQBB 1ID3C 3AZHC 5BS7C 5DNNC 4E44A 2F8NA 5AY8D 4WU9C 4CAYB 4J8WD 5F99B 4DQYB 2BG1A 3W99D 4QLCC 3RELC 3UT9D 3X1TB 2Y2QA 5B1LC 5BNVB 1KX5B 5GXQD 5BNVA 3X1SC 5B1LD 1KX5A 1M19D 5CP6D 4H9PB 3A6NC 3AFAB 4KUDC 3AYWB 4WJ3C 4EO5B 4H9RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB A;  3KUY C;  3MNN C;  3AZN A;  5B1M C;  5BNX A;  1P3G D;  4J8X D;  5AV5 A;  4KGC C;  3AZN D;  3X1V B;  3MGR A;  3REL B;  3X1T C;  3B6F A;  4H9N B;  3B6F B;  1ZLA C;  5B24 B;  5CPI B;  1WWS A;  3LZ1 B;  1ZLA D;  5JA4 B;  5B2J D;  1P3F C;  3AZL C;  3UT9 C;  1P3M A;  5GSU B;  3AV2 D;  4H9Q A;  5B1M B;  5GT0 A;  4WZS B;  3B0C W;  4WV4 B;  5GT0 D;  4G91 B;  3AZF A;  3WA9 C;  2BYK A;  5CP6 A;  3AZG C;  1P3P D;  5AV9 C;  5BS7 A;  1KX3 D;  1AOI D;  4Z5T D;  3C1B C;  1P3L C;  3MGR B;  3REL A;  3TU4 C;  4LD9 B;  3MGQ B;  5B31 B;  3MVD A;  1BH8 A;  4J8U D;  3UTA A;  5DNM D;  3LJA C;  3W98 B;  3REK A;  3LZ0 D;  3AZE D;  4WU8 A;  4Z5T C;  5DNN D;  5AV6 A;  3C1B D;  3AZI C;  1P3L D;  3AZG B;  3AYW A;  3WTP B;  2HIO D;  3O62 B;  1P3O C;  2FJ7 C;  5AVB C;  5CPK D;  4YM6 B;  4X23 D;  3X1S D;  3KXB C;  4XZQ D;  5B2I D;  5JRG A;  1KX4 D;  4CAY A;  1P3I A;  3AZM A;  1F1E A;  3LJA B;  3UTA D;  5B33 D;  5G49 B;  3WKJ B;  5JRG D;  3MVD B;  5B31 A;  4LD9 A;  5AV8 A;  5F99 C;  5CHL B;  4XZQ C;  3AZJ A;  2ARO D;  3C1C C;  5CPK A;  1P3O B;  4R8P D;  3LZ1 A;  1AOI A;  2BYM A;  5B0Y D;  3LEL D;  3MNN D;  5AV6 B;  1P3B D;  4EO5 C;  3REI B;  1U35 B;  5AV8 D;  3AZJ D;  3AZK D;  3MGS D;  4X23 C;  4J8X A;  1EQZ B;  5B33 A;  1P3A A;  5BO0 B;  3MGQ C;  3WAA B;  2YFV B;  2NQB D;  2NZD A;  3UTB B;  5AVC B;  2CV5 D;  5AY8 B;  1KX3 A;  1HQ3 C;  4J8W B;  3W99 B;  3UT9 B;  4JJN C;  4WNN B;  5GXQ A;  1KX5 D;  3VH6 W;  4WU9 B;  4UUZ A;  1M19 B;  1Q9C A;  1U35 C;  5B40 C;  4YS3 B;  4WU8 C;  3AZI A;  3X1U D;  3AZH B;  1WWI A;  3B6G D;  3X1U C;  5CPJ B;  2NQB A;  2NZD D;  4J8V A;  1H3O B;  3X1V A;  1F66 C;  1F66 D;  3MGS C;  2IO5 B;  4ZBJ C;  1BH8 B;  1P3G B;  3AV1 D;  3NQJ B;  3REI A;  4J8W C;  3AZM C;  3REH A;  3MNN A;  5B0Y C;  4XUJ C;  5B0Z B;  3W97 B;  5B24 D;  5CPI D;  4R8P A;  5AV9 D;  3W96 D;  4LD9 C;  3W99 A;  1P3F B;  4ZUX B;  3MGR C;  3AZK C;  5G49 A;  3KXB D;  3AZF B;  4HGA B;  4AWL C;  3X1T A;  2CV5 A;  5AY8 A;  5B1M D;  4J8V D;  1P3I B;  3AZH A;  3WAA C;  3AZI B;  3AZL A;  2PYO B;  4NE3 A;  1KX4 A;  3W98 C;  5AVB B;  4G91 C;  3O62 C;  5B1L A;  1M18 D;  1KX5 C;  5B2J A;  5KDM A;  3WTP C;  4QLC B;  1HQ3 B;  1M1A C;  3REH B;  1AOI B;  3REK B;  1M1A D;  2ARO A;  3AZF C;  1P3A B;  3KSY A;  4J8U C;  1TZY B;  5FUG B;  3AZM D;  2L5A A;  4Z66 A;  1ID3 B;  4H9R A;  1P3B C;  3MGP D;  4KGC D;  1P3K D;  3AZG D;  1P3P C;  4KUD D;  4DRB A;  4UUZ B;  1M19 A;  2FJ7 D;  4JJN D;  3UT9 A;  3VH6 A;  3X1S B;  1P3K A;  3WKJ A;  1S32 D;  5B2I B;  4NE6 A;  3AZL B;  2PYO A;  4WU8 D;  5C3I C;  3AYW C;  1HTA A;  4AWL B;  3B0B A;  3UTA B;  5GT3 C;  3KXB A;  3WKJ D;  5JRG C;  2F8N K;  3WA9 A;  2CV5 C;  5AY8 C;  2ARO B;  3W97 A;  3AFA D;  1P3O D;  5B24 A;  5CPI A;  3AZG A;  3AYW D;  3LEL C;  1KU5 A;  3VH5 A;  1A7W A;  3MGP C;  5AV6 D;  3B0D C;  3C1B A;  1P3L A;  1KX4 C;  3NQJ A;  3KWQ A;  3R45 B;  1TZY A;  3REI D;  4E45 A;  5AV8 C;  3AZJ C;  3AN2 A;  5E5A D;  3MVD C;  4NE5 A;  3AZN B;  3UTA C;  3TU4 B;  3X1V D;  3REL D;  4XUJ D;  1M1A A;  3UTB D;  2ARO C;  3C1C D;  2CV5 B;  1S32 A;  3AV2 A;  4WU9 A;  5B2I A;  5B2J B;  3REI C;  1TAF A;  3REJ B;  5AVB A;  3A6N A;  5GSU D;  3AV2 B;  4KUD A;  4WU9 D;  4Z66 C;  4H9N A;  4G92 B;  1P34 C;  3UTB C;  3B6G C;  1P34 D;  3AZN C;  5B1M A;  5GT0 B;  1P3G A;  1BFM A;  1P3M B;  1F66 B;  1U35 A;  2PYO C;  5GT3 B;  3AV1 B;  5BT1 D;  2HUE C;  3X1U A;  1ZLA A;  3LZ1 C;  4YS3 A;  4H9P A;  3AFA A;  3W97 D;  5GXQ B;  5B1L B;  5E5A C;  4LD9 D;  2BYK B;  5CP6 B;  1TAF B;  4J8W A;  2IO5 C;  4ZBJ B;  4ZUX D;  2F8N D;  4XUJ A;  5B31 G;  2YFW A;  3AZE C;  2HIO B;  3AZK A;  3V9R A;  4J8X B;  1EQZ A;  5B32 C;  3KWQ D;  5AV9 A;  4QLC D;  1HQ3 D;  3B6F D;  3LZ1 D;  1ZLA B;  5FUG A;  3W98 A;  3AV2 C;  2YFV A;  4CSR B;  3AV1 A;  2NQB C;  5AV5 D;  5B33 B;  5DNM A;  1F66 A;  3AN2 B;  3MVD D;  5BNX B;  3MGS A;  4CSR A;  3B0C T;  3LJA A;  2HIO C;  3VH5 W;  1P34 A;  3AZM B;  3B6G A;  1B6W A;  4Z5T A;  5AV6 C;  2HUE B;  3LEL B;  1JFI B;  4QLC A;  5B40 D;  1P3O A;  1P3K B;  3A6N D;  3X1S A;  4KUD B;  4R8P C;  3WA9 B;  2FJ7 A;  5AV8 B;  4DRA A;  3AZJ B;  3V9R B;  2FJ7 B;  4ZUX C;  1R4V A;  3AZK B;  3REJ A;  4JJN B;  1P3P B;  3B0D B;  3KUY D;  1S32 B;  3AZL D;  4Z66 D;  3W96 C;  5B32 G;  4WU8 B;  1B67 A;  5C3I B;  3WAA A;  4H9O B;  3MGQ D;  5E5A A;  5AV5 C;  4H9S C;  5B31 C;  5B32 D;  3WKJ C;  3VH5 T;  5DNM B;  4YM6 A;  1ULY A;  3W98 D;  3O62 A;  5CPK C;  3AZE B;  3B6F C;  4YS3 D;  3C1B B;  5DNN B;  1P3L B;  1BH9 B;  2RVQ C;  3X1U B;  3WTP D;  3B6G B;  3O62 D;  1M18 A;  3AZE A;  5CPJ D;  5GT3 A;  4YM6 D;  4X23 B;  1EQZ C;  5GT0 C;  3MGQ A;  1KX4 B;  4J8U A;  5B33 C;  1P3A C;  2NZD C;  3TU4 D;  4XUJ B;  5B0Z C;  1TZY C;  5B0Z D;  5F99 D;  1HQ3 A;  3KUY A;  3X1T D;  1KX3 C;  5AV9 B;  5GSU A;  5GXQ C;  4Z2M H;  5B40 A;  4R8P B;  3AZF D;  4KGC A;  5JA4 A;  2YFW B;  1P3K C;  4KHA A;  2F8N H;  3MNN B;  5AVC A;  1S32 C;  5B2I C;  1P34 B;  3TU4 A;  3X1V C;  5BO0 A;  1U35 D;  4J8V C;  3MGS B;  4ZUX A;  1P3F A;  2F8N G;  2LY8 A;  3WTP E;  1P3M D;  1M18 B;  5GT3 D;  5CPJ A;  5AVC D;  4Z2M G;  1BH9 A;  1N1J B;  2CWE A;  3REH C;  5B0Y A;  3REH D;  4WNN A;  3W99 C;  1H3O A;  3AZH D;  2F8N B;  3VH6 T;  2JSS A;  2NZD B;  4NFT A;  1M18 C;  5BT1 C;  4KGC B;  3LZ0 C;  4H9Q B;  4XZQ A;  3R45 A;  3KWQ B;  5B2J C;  3WTP A;  1KX3 B;  4Z5T B;  4G92 C;  1ID3 A;  5B0Z A;  3REK C;  5DNN A;  1N1J A;  3MGR D;  3W96 B;  3NQU A;  5GSU C;  5B31 D;  4J8U B;  5B32 A;  1P3F D;  5AV5 B;  1P3G C;  3KXB B;  3AN2 D;  3NQU B;  3LZ0 B;  4J8V B;  5AVC C;  1P3I D;  1P3B A;  3AZI D;  1P3I C;  2PYO D;  2BYM B;  3AV1 C;  4KHA B;  5KDM B;  1P3P A;  5CPK B;  4JJN A;  5B40 B;  4YS3 C;  5AVB D;  3AFA C;  3A6N B;  1M19 C;  4XZQ B;  3WA9 D;  2HIO A;  5E5A B;  5CPJ C;  5F99 A;  3KUY B;  3C1C A;  4Z66 B;  4M6B A;  3REK D;  1M1A B;  1AOI C;  3LJA D;  3C1C B;  1P3A D;  5JRG B;  3REJ C;  3REJ D;  5B32 B;  1P3M C;  1TZY D;  4X23 A;  4J8X C;  3W97 C;  3W96 A;  5CPI C;  5B24 C;  5B0Y B;  1ID3 D;  1JFI A;  3LEL A;  3MGP B;  2RVQ D;  3MGP A;  1P3B B;  3KWQ C;  4H9S A;  3LZ0 A;  4YM6 C;  1EQZ D;  4HGA C;  3AN2 C;  5DNM C;  5CP6 C;  3WAA D;  4H9O A;  2NQB B;  1ID3 C;  3AZH C;  5BS7 C;  5DNN C;  4E44 A;  2F8N A;  5AY8 D;  4WU9 C;  4CAY B;  4J8W D;  5F99 B;  3W99 D;  4QLC C;  3REL C;  3UT9 D;  3X1T B;  5B1L C;  5BNV B;  1KX5 B;  5GXQ D;  5BNV A;  3X1S C;  5B1L D;  1KX5 A;  1M19 D;  5CP6 D;  4H9P B;  3A6N C;  3AFA B;  4KUD C;  3AYW B;  4EO5 B;  4H9R B; 
#chains in the Genus database with same CATH topology
 3UTB A;  3KUY C;  3MNN C;  3AZN A;  5B1M C;  5BNX A;  1P3G D;  4J8X D;  5AV5 A;  4KGC C;  3AZN D;  3X1V B;  3MGR A;  3REL B;  3X1T C;  3B6F A;  4H9N B;  3B6F B;  1ZLA C;  5B24 B;  5CPI B;  1WWS A;  3LZ1 B;  1ZLA D;  5JA4 B;  5B2J D;  1P3F C;  3AZL C;  3H0M C;  3UT9 C;  1P3M A;  2ZY4 A;  5GSU B;  3AV2 D;  4H9Q A;  5B1M B;  5GT0 A;  4WZS B;  3B0C W;  4WV4 B;  1Z2C B;  2DF4 C;  5GT0 D;  2VQR A;  4G91 B;  2Y2L A;  3AZF A;  3WA9 C;  2BYK A;  5CP6 A;  2ZM5 A;  2JE5 A;  3AZG C;  1P3P D;  5AV9 C;  5BS7 A;  1KX3 D;  1AOI D;  4Z5T D;  3C1B C;  1P3L C;  3MGR B;  3REL A;  3TU4 C;  4LD9 B;  3MGQ B;  5B31 B;  3MVD A;  1BH8 A;  4J8U D;  2JCH A;  3UTA A;  5DNM D;  3LJA C;  2J8P A;  3W98 B;  3REK A;  3LZ0 D;  3AZE D;  4WU8 A;  4Z5T C;  5DNN D;  5AV6 A;  3C1B D;  3AZI C;  1P3L D;  3H0R C;  3AZG B;  3AYW A;  3WTP B;  3EPL A;  2HIO D;  3O62 B;  1P3O C;  2FJ7 C;  5AVB C;  5CPK D;  4YM6 B;  4X23 D;  3X1S D;  3KXB C;  4XZQ D;  5B2I D;  5JRG A;  1KX4 D;  4CAY A;  1P3I A;  3AZM A;  1F1E A;  3LJA B;  3UTA D;  5B33 D;  5G49 B;  3WKJ B;  5JRG D;  5B31 A;  3MVD B;  4LD9 A;  5AV8 A;  5F99 C;  5CHL B;  4XZQ C;  2XD5 A;  2ARO D;  3C1C C;  3AZJ A;  5CPK A;  2XD1 A;  1P3O B;  4R8P D;  3LZ1 A;  1AOI A;  2BYM A;  5B0Y D;  3LEL D;  3MNN D;  5AV6 B;  1P3B D;  4EO5 C;  3REI B;  1U35 B;  5AV8 D;  3AZJ D;  3AZK D;  3MGS D;  4X23 C;  4J8X A;  1EQZ B;  5B33 A;  2ZY5 A;  5BO0 B;  3MGQ C;  1P3A A;  3WAA B;  2YFV B;  2NQB D;  2NZD A;  3UTB B;  3EPH A;  5AVC B;  2Y2O A;  1W2E A;  2CV5 D;  5AY8 B;  1KX3 A;  2RIQ A;  1HQ3 C;  4J8W B;  3W99 B;  3H0L C;  3UT9 B;  4JJN C;  4WNN B;  5GXQ A;  1KX5 D;  3VH6 W;  4WU9 B;  4UUZ A;  1M19 B;  1Q9C A;  1U35 C;  5B40 C;  4YS3 B;  4WU8 C;  3AZI A;  3X1U D;  3AZH B;  1WWI A;  3B6G D;  3X1U C;  5CPJ B;  2NQB A;  2NZD D;  4J8V A;  1H3O B;  3X1V A;  1F66 C;  1F66 D;  3MGS C;  2IO5 B;  4ZBJ C;  1BH8 B;  1P3G B;  3AV1 D;  2W8S A;  3NQJ B;  3REI A;  4J8W C;  3AZM C;  3REH A;  3MNN A;  5B0Y C;  4XUJ C;  5B0Z B;  2G5H C;  3W97 B;  5B24 D;  5CPI D;  4R8P A;  5AV9 D;  3W96 D;  4LD9 C;  3W99 A;  2ZY2 A;  1P3F B;  4ZUX B;  3MGR C;  3AZK C;  5G49 A;  3KXB D;  3AZF B;  4HGA B;  4AWL C;  3X1T A;  2CV5 A;  5AY8 A;  5B1M D;  4J8V D;  1P3I B;  3AZH A;  3WAA C;  3AZI B;  3AZL A;  2PYO B;  4NE3 A;  1KX4 A;  3W98 C;  5AVB B;  4G91 C;  3O62 C;  5B1L A;  1M18 D;  1KX5 C;  5B2J A;  5KDM A;  3WTP C;  4QLC B;  4UPK A;  1HQ3 B;  1M1A C;  3REH B;  1AOI B;  3REK B;  1M1A D;  2ARO A;  3AZF C;  1P3A B;  3KSY A;  4J8U C;  1TZY B;  5FUG B;  3AZM D;  2L5A A;  4Z66 A;  1ID3 B;  4H9R A;  1P3B C;  2Y2H A;  3MGP D;  4KGC D;  1P3K D;  3AZG D;  1P3P C;  4KUD D;  4DRB A;  4UUZ B;  1M19 A;  2FJ7 D;  4JJN D;  3UT9 A;  3VH6 A;  3X1S B;  1P3K A;  3WKJ A;  1S32 D;  5B2I B;  4NE6 A;  3AZL B;  2PYO A;  4WU8 D;  5C3I C;  3AYW C;  1HTA A;  4AWL B;  3B0B A;  2F2A C;  3UTA B;  5GT3 C;  3KXB A;  3WKJ D;  5JRG C;  2F8N K;  3WA9 A;  2CV5 C;  5AY8 C;  2ARO B;  3W97 A;  3AFA D;  1P3O D;  5B24 A;  5CPI A;  3AZG A;  3AYW D;  3IP4 C;  3LEL C;  1KU5 A;  2G5I C;  1A7W A;  3VH5 A;  3MGP C;  5AV6 D;  3B0D C;  3C1B A;  1P3L A;  1KX4 C;  3NQJ A;  3KWQ A;  3R45 B;  1TZY A;  3REI D;  4E45 A;  5AV8 C;  3AZJ C;  3AN2 A;  2Y2G A;  5E5A D;  3MVD C;  4NE5 A;  3AZN B;  3UTA C;  3TU4 B;  3X1V D;  3REL D;  4XUJ D;  1M1A A;  3UTB D;  2ARO C;  3C1C D;  2CV5 B;  1S32 A;  3AV2 A;  4WU9 A;  5B2I A;  5B2J B;  3REI C;  1TAF A;  3REJ B;  5AVB A;  3A6N A;  5GSU D;  3AV2 B;  4KUD A;  4WU9 D;  4Z66 C;  4H9N A;  4G92 B;  1P34 C;  3UTB C;  3B6G C;  1P34 D;  3AZN C;  5B1M A;  5GT0 B;  1P3G A;  1BFM A;  1P3M B;  1F66 B;  1U35 A;  2PYO C;  5GT3 B;  3AV1 B;  5BT1 D;  2HUE C;  3X1U A;  1ZLA A;  3LZ1 C;  4YS3 A;  4H9P A;  3AFA A;  3W97 D;  5GXQ B;  2Y2P A;  5B1L B;  5E5A C;  4LD9 D;  2BYK B;  5CP6 B;  1TAF B;  4J8W A;  2IO5 C;  4ZBJ B;  4ZUX D;  2F8N D;  4XUJ A;  1T3U A;  5B31 G;  2YFW A;  3AZE C;  2HIO B;  3AZK A;  3V9R A;  2Y2I A;  4J8X B;  1EQZ A;  5B32 C;  3KWQ D;  5AV9 A;  4QLC D;  1HQ3 D;  3B6F D;  3LZ1 D;  1ZLA B;  5FUG A;  3W98 A;  3AV2 C;  2YFV A;  4CSR B;  3AV1 A;  2NQB C;  5AV5 D;  5B33 B;  5DNM A;  1F66 A;  3AN2 B;  3MVD D;  2Y2K A;  5BNX B;  3MGS A;  4CSR A;  3B0C T;  3LJA A;  2HIO C;  3VH5 W;  1P34 A;  3AZM B;  3B6G A;  1B6W A;  4Z5T A;  5AV6 C;  2HUE B;  3LEL B;  1JFI B;  4QLC A;  5B40 D;  1P3O A;  1P3K B;  3A6N D;  3X1S A;  4KUD B;  4R8P C;  3WA9 B;  2FJ7 A;  5AV8 B;  4DRA A;  3AZJ B;  3V9R B;  2FJ7 B;  4ZUX C;  1R4V A;  3AZK B;  3REJ A;  4JJN B;  1P3P B;  3B0D B;  3KUY D;  1S32 B;  3AZL D;  4Z66 D;  3W96 C;  5B32 G;  2Y2N A;  4WU8 B;  1B67 A;  5C3I B;  2FFF B;  3WAA A;  4H9O B;  3MGQ D;  5E5A A;  5AV5 C;  4H9S C;  5B31 C;  5B32 D;  3WKJ C;  3VH5 T;  5DNM B;  4YM6 A;  1ULY A;  3W98 D;  3EG5 B;  3O62 A;  5CPK C;  3AZE B;  3B6F C;  4YS3 D;  3C1B B;  5DNN B;  1P3L B;  1BH9 B;  2RVQ C;  3X1U B;  3WTP D;  3B6G B;  2UWX A;  3O62 D;  1M18 A;  3AZE A;  5CPJ D;  5GT3 A;  4YM6 D;  4X23 B;  1EQZ C;  5GT0 C;  3MGQ A;  1KX4 B;  4J8U A;  5B33 C;  1P3A C;  2NZD C;  3TU4 D;  4XUJ B;  5B0Z C;  1TZY C;  5B0Z D;  5F99 D;  1HQ3 A;  3KUY A;  3X1T D;  1KX3 C;  5AV9 B;  5GSU A;  5GXQ C;  4Z2M H;  5B40 A;  4R8P B;  3AZF D;  3EPJ A;  4KGC A;  5JA4 A;  2YFW B;  1P3K C;  4KHA A;  2F8N H;  3MNN B;  5AVC A;  1S32 C;  5B2I C;  1P34 B;  3TU4 A;  3X1V C;  5BO0 A;  1U35 D;  4J8V C;  3MGS B;  4ZUX A;  1P3F A;  2F8N G;  2LY8 A;  3WTP E;  1P3M D;  1M18 B;  5GT3 D;  5CPJ A;  5AVC D;  2DQN C;  4Z2M G;  1BH9 A;  1N1J B;  2CWE A;  3REH C;  5B0Y A;  3REH D;  4WNN A;  3W99 C;  1H3O A;  3AZH D;  2F8N B;  1PZR A;  3VH6 T;  2JSS A;  2NZD B;  4NFT A;  1M18 C;  3EPK A;  3AL0 C;  5BT1 C;  4KGC B;  3LZ0 C;  4H9Q B;  4XZQ A;  3KFU G;  3R45 A;  3KWQ B;  5B2J C;  3WTP A;  1KX3 B;  4Z5T B;  4G92 C;  1ID3 A;  5B0Z A;  3REK C;  5DNN A;  1N1J A;  3MGR D;  2ZY3 A;  3W96 B;  3NQU A;  5GSU C;  5B31 D;  4J8U B;  5B32 A;  1P3F D;  5AV5 B;  1P3G C;  3KXB B;  3AN2 D;  3NQU B;  3LZ0 B;  4J8V B;  5AVC C;  1P3I D;  1P3B A;  3AZI D;  1P3I C;  2PYO D;  2BYM B;  3AV1 C;  4KHA B;  5KDM B;  1P3P A;  5CPK B;  4JJN A;  5B40 B;  3F6T A;  5AVB D;  4YS3 C;  3AFA C;  3A6N B;  1M19 C;  4XZQ B;  3WA9 D;  2HIO A;  5E5A B;  5CPJ C;  5F99 A;  3A1K A;  3KUY B;  3C1C A;  4Z66 B;  4M6B A;  3REK D;  1M1A B;  1AOI C;  3LJA D;  3A1I A;  3C1C B;  1P3A D;  5JRG B;  3REJ C;  2Y2M A;  3REJ D;  5B32 B;  1P3M C;  1TZY D;  4X23 A;  4J8X C;  3W97 C;  3W96 A;  5CPI C;  5B24 C;  3P5J B;  5B0Y B;  1ID3 D;  1JFI A;  3LEL A;  3MGP B;  2RVQ D;  3MGP A;  1P3B B;  3KWQ C;  4H9S A;  3LZ0 A;  3FDD A;  4YM6 C;  1EQZ D;  4HGA C;  3AN2 C;  5DNM C;  5CP6 C;  2Y2J A;  3WAA D;  4H9O A;  2NQB B;  1ID3 C;  3AZH C;  5BS7 C;  5DNN C;  4E44 A;  2F8N A;  5AY8 D;  4WU9 C;  4CAY B;  4J8W D;  5F99 B;  4DQY B;  2BG1 A;  3W99 D;  4QLC C;  3REL C;  3UT9 D;  3X1T B;  2Y2Q A;  5B1L C;  5BNV B;  1KX5 B;  5GXQ D;  5BNV A;  3X1S C;  5B1L D;  1KX5 A;  1M19 D;  5CP6 D;  4H9P B;  3A6N C;  3AFA B;  4KUD C;  3AYW B;  4WJ3 C;  4EO5 B;  4H9R B; 
#chains in the Genus database with same CATH homology
 3UTB A;  3KUY C;  3MNN C;  3AZN A;  5B1M C;  5BNX A;  1P3G D;  4J8X D;  5AV5 A;  4KGC C;  3AZN D;  3X1V B;  3MGR A;  3REL B;  3X1T C;  3B6F A;  4H9N B;  3B6F B;  1ZLA C;  5B24 B;  5CPI B;  1WWS A;  3LZ1 B;  1ZLA D;  5JA4 B;  5B2J D;  1P3F C;  3AZL C;  3H0M C;  3UT9 C;  1P3M A;  2ZY4 A;  5GSU B;  3AV2 D;  4H9Q A;  5B1M B;  5GT0 A;  4WZS B;  3B0C W;  4WV4 B;  1Z2C B;  2DF4 C;  5GT0 D;  2VQR A;  4G91 B;  2Y2L A;  3AZF A;  3WA9 C;  2BYK A;  5CP6 A;  2ZM5 A;  2JE5 A;  3AZG C;  1P3P D;  5AV9 C;  5BS7 A;  1KX3 D;  1AOI D;  4Z5T D;  3C1B C;  1P3L C;  3MGR B;  3REL A;  3TU4 C;  4LD9 B;  3MGQ B;  5B31 B;  3MVD A;  1BH8 A;  4J8U D;  2JCH A;  3UTA A;  5DNM D;  3LJA C;  2J8P A;  3W98 B;  3REK A;  3LZ0 D;  3AZE D;  4WU8 A;  4Z5T C;  5DNN D;  5AV6 A;  3C1B D;  3AZI C;  1P3L D;  3H0R C;  3AZG B;  3AYW A;  3WTP B;  3EPL A;  2HIO D;  3O62 B;  1P3O C;  2FJ7 C;  5AVB C;  5CPK D;  4YM6 B;  4X23 D;  3X1S D;  3KXB C;  4XZQ D;  5B2I D;  5JRG A;  1KX4 D;  4CAY A;  1P3I A;  3AZM A;  1F1E A;  3LJA B;  3UTA D;  5B33 D;  5G49 B;  3WKJ B;  5JRG D;  5B31 A;  3MVD B;  4LD9 A;  5AV8 A;  5F99 C;  5CHL B;  4XZQ C;  2XD5 A;  2ARO D;  3C1C C;  3AZJ A;  5CPK A;  2XD1 A;  1P3O B;  4R8P D;  3LZ1 A;  1AOI A;  2BYM A;  5B0Y D;  3LEL D;  3MNN D;  5AV6 B;  1P3B D;  4EO5 C;  3REI B;  1U35 B;  5AV8 D;  3AZJ D;  3AZK D;  3MGS D;  4X23 C;  4J8X A;  1EQZ B;  5B33 A;  2ZY5 A;  5BO0 B;  3MGQ C;  1P3A A;  3WAA B;  2YFV B;  2NQB D;  2NZD A;  3UTB B;  3EPH A;  5AVC B;  2Y2O A;  1W2E A;  2CV5 D;  5AY8 B;  1KX3 A;  2RIQ A;  1HQ3 C;  4J8W B;  3W99 B;  3H0L C;  3UT9 B;  4JJN C;  4WNN B;  5GXQ A;  1KX5 D;  3VH6 W;  4WU9 B;  4UUZ A;  1M19 B;  1Q9C A;  1U35 C;  5B40 C;  4YS3 B;  4WU8 C;  3AZI A;  3X1U D;  3AZH B;  1WWI A;  3B6G D;  3X1U C;  5CPJ B;  2NQB A;  2NZD D;  4J8V A;  1H3O B;  3X1V A;  1F66 C;  1F66 D;  3MGS C;  2IO5 B;  4ZBJ C;  1BH8 B;  1P3G B;  3AV1 D;  2W8S A;  3NQJ B;  3REI A;  4J8W C;  3AZM C;  3REH A;  3MNN A;  5B0Y C;  4XUJ C;  5B0Z B;  2G5H C;  3W97 B;  5B24 D;  5CPI D;  4R8P A;  5AV9 D;  3W96 D;  4LD9 C;  3W99 A;  2ZY2 A;  1P3F B;  4ZUX B;  3MGR C;  3AZK C;  5G49 A;  3KXB D;  3AZF B;  4HGA B;  4AWL C;  3X1T A;  2CV5 A;  5AY8 A;  5B1M D;  4J8V D;  1P3I B;  3AZH A;  3WAA C;  3AZI B;  3AZL A;  2PYO B;  4NE3 A;  1KX4 A;  3W98 C;  5AVB B;  4G91 C;  3O62 C;  5B1L A;  1M18 D;  1KX5 C;  5B2J A;  5KDM A;  3WTP C;  4QLC B;  4UPK A;  1HQ3 B;  1M1A C;  3REH B;  1AOI B;  3REK B;  1M1A D;  2ARO A;  3AZF C;  1P3A B;  3KSY A;  4J8U C;  1TZY B;  5FUG B;  3AZM D;  2L5A A;  4Z66 A;  1ID3 B;  4H9R A;  1P3B C;  2Y2H A;  3MGP D;  4KGC D;  1P3K D;  3AZG D;  1P3P C;  4KUD D;  4DRB A;  4UUZ B;  1M19 A;  2FJ7 D;  4JJN D;  3UT9 A;  3VH6 A;  3X1S B;  1P3K A;  3WKJ A;  1S32 D;  5B2I B;  4NE6 A;  3AZL B;  2PYO A;  4WU8 D;  5C3I C;  3AYW C;  1HTA A;  4AWL B;  3B0B A;  2F2A C;  3UTA B;  5GT3 C;  3KXB A;  3WKJ D;  5JRG C;  2F8N K;  3WA9 A;  2CV5 C;  5AY8 C;  2ARO B;  3W97 A;  3AFA D;  1P3O D;  5B24 A;  5CPI A;  3AZG A;  3AYW D;  3IP4 C;  3LEL C;  1KU5 A;  2G5I C;  1A7W A;  3VH5 A;  3MGP C;  5AV6 D;  3B0D C;  3C1B A;  1P3L A;  1KX4 C;  3NQJ A;  3KWQ A;  3R45 B;  1TZY A;  3REI D;  4E45 A;  5AV8 C;  3AZJ C;  3AN2 A;  2Y2G A;  5E5A D;  3MVD C;  4NE5 A;  3AZN B;  3UTA C;  3TU4 B;  3X1V D;  3REL D;  4XUJ D;  1M1A A;  3UTB D;  2ARO C;  3C1C D;  2CV5 B;  1S32 A;  3AV2 A;  4WU9 A;  5B2I A;  5B2J B;  3REI C;  1TAF A;  3REJ B;  5AVB A;  3A6N A;  5GSU D;  3AV2 B;  4KUD A;  4WU9 D;  4Z66 C;  4H9N A;  4G92 B;  1P34 C;  3UTB C;  3B6G C;  1P34 D;  3AZN C;  5B1M A;  5GT0 B;  1P3G A;  1BFM A;  1P3M B;  1F66 B;  1U35 A;  2PYO C;  5GT3 B;  3AV1 B;  5BT1 D;  2HUE C;  3X1U A;  1ZLA A;  3LZ1 C;  4YS3 A;  4H9P A;  3AFA A;  3W97 D;  5GXQ B;  2Y2P A;  5B1L B;  5E5A C;  4LD9 D;  2BYK B;  5CP6 B;  1TAF B;  4J8W A;  2IO5 C;  4ZBJ B;  4ZUX D;  2F8N D;  4XUJ A;  1T3U A;  5B31 G;  2YFW A;  3AZE C;  2HIO B;  3AZK A;  3V9R A;  2Y2I A;  4J8X B;  1EQZ A;  5B32 C;  3KWQ D;  5AV9 A;  4QLC D;  1HQ3 D;  3B6F D;  3LZ1 D;  1ZLA B;  5FUG A;  3W98 A;  3AV2 C;  2YFV A;  4CSR B;  3AV1 A;  2NQB C;  5AV5 D;  5B33 B;  5DNM A;  1F66 A;  3AN2 B;  3MVD D;  2Y2K A;  5BNX B;  3MGS A;  4CSR A;  3B0C T;  3LJA A;  2HIO C;  3VH5 W;  1P34 A;  3AZM B;  3B6G A;  1B6W A;  4Z5T A;  5AV6 C;  2HUE B;  3LEL B;  1JFI B;  4QLC A;  5B40 D;  1P3O A;  1P3K B;  3A6N D;  3X1S A;  4KUD B;  4R8P C;  3WA9 B;  2FJ7 A;  5AV8 B;  4DRA A;  3AZJ B;  3V9R B;  2FJ7 B;  4ZUX C;  1R4V A;  3AZK B;  3REJ A;  4JJN B;  1P3P B;  3B0D B;  3KUY D;  1S32 B;  3AZL D;  4Z66 D;  3W96 C;  5B32 G;  2Y2N A;  4WU8 B;  1B67 A;  5C3I B;  2FFF B;  3WAA A;  4H9O B;  3MGQ D;  5E5A A;  5AV5 C;  4H9S C;  5B31 C;  5B32 D;  3WKJ C;  3VH5 T;  5DNM B;  4YM6 A;  1ULY A;  3W98 D;  3EG5 B;  3O62 A;  5CPK C;  3AZE B;  3B6F C;  4YS3 D;  3C1B B;  5DNN B;  1P3L B;  1BH9 B;  2RVQ C;  3X1U B;  3WTP D;  3B6G B;  2UWX A;  3O62 D;  1M18 A;  3AZE A;  5CPJ D;  5GT3 A;  4YM6 D;  4X23 B;  1EQZ C;  5GT0 C;  3MGQ A;  1KX4 B;  4J8U A;  5B33 C;  1P3A C;  2NZD C;  3TU4 D;  4XUJ B;  5B0Z C;  1TZY C;  5B0Z D;  5F99 D;  1HQ3 A;  3KUY A;  3X1T D;  1KX3 C;  5AV9 B;  5GSU A;  5GXQ C;  4Z2M H;  5B40 A;  4R8P B;  3AZF D;  3EPJ A;  4KGC A;  5JA4 A;  2YFW B;  1P3K C;  4KHA A;  2F8N H;  3MNN B;  5AVC A;  1S32 C;  5B2I C;  1P34 B;  3TU4 A;  3X1V C;  5BO0 A;  1U35 D;  4J8V C;  3MGS B;  4ZUX A;  1P3F A;  2F8N G;  2LY8 A;  3WTP E;  1P3M D;  1M18 B;  5GT3 D;  5CPJ A;  5AVC D;  2DQN C;  4Z2M G;  1BH9 A;  1N1J B;  2CWE A;  3REH C;  5B0Y A;  3REH D;  4WNN A;  3W99 C;  1H3O A;  3AZH D;  2F8N B;  1PZR A;  3VH6 T;  2JSS A;  2NZD B;  4NFT A;  1M18 C;  3EPK A;  3AL0 C;  5BT1 C;  4KGC B;  3LZ0 C;  4H9Q B;  4XZQ A;  3KFU G;  3R45 A;  3KWQ B;  5B2J C;  3WTP A;  1KX3 B;  4Z5T B;  4G92 C;  1ID3 A;  5B0Z A;  3REK C;  5DNN A;  1N1J A;  3MGR D;  2ZY3 A;  3W96 B;  3NQU A;  5GSU C;  5B31 D;  4J8U B;  5B32 A;  1P3F D;  5AV5 B;  1P3G C;  3KXB B;  3AN2 D;  3NQU B;  3LZ0 B;  4J8V B;  5AVC C;  1P3I D;  1P3B A;  3AZI D;  1P3I C;  2PYO D;  2BYM B;  3AV1 C;  4KHA B;  5KDM B;  1P3P A;  5CPK B;  4JJN A;  5B40 B;  3F6T A;  5AVB D;  4YS3 C;  3AFA C;  3A6N B;  1M19 C;  4XZQ B;  3WA9 D;  2HIO A;  5E5A B;  5CPJ C;  5F99 A;  3A1K A;  3KUY B;  3C1C A;  4Z66 B;  4M6B A;  3REK D;  1M1A B;  1AOI C;  3LJA D;  3A1I A;  3C1C B;  1P3A D;  5JRG B;  3REJ C;  2Y2M A;  3REJ D;  5B32 B;  1P3M C;  1TZY D;  4X23 A;  4J8X C;  3W97 C;  3W96 A;  5CPI C;  5B24 C;  3P5J B;  5B0Y B;  1ID3 D;  1JFI A;  3LEL A;  3MGP B;  2RVQ D;  3MGP A;  1P3B B;  3KWQ C;  4H9S A;  3LZ0 A;  3FDD A;  4YM6 C;  1EQZ D;  4HGA C;  3AN2 C;  5DNM C;  5CP6 C;  2Y2J A;  3WAA D;  4H9O A;  2NQB B;  1ID3 C;  3AZH C;  5BS7 C;  5DNN C;  4E44 A;  2F8N A;  5AY8 D;  4WU9 C;  4CAY B;  4J8W D;  5F99 B;  4DQY B;  2BG1 A;  3W99 D;  4QLC C;  3REL C;  3UT9 D;  3X1T B;  2Y2Q A;  5B1L C;  5BNV B;  1KX5 B;  5GXQ D;  5BNV A;  3X1S C;  5B1L D;  1KX5 A;  1M19 D;  5CP6 D;  4H9P B;  3A6N C;  3AFA B;  4KUD C;  3AYW B;  4WJ3 C;  4EO5 B;  4H9R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...