5BNXB

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.3-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnxB00
5JA4A 3C1BA 5B2ID 3AZIB 1ZLAA 4WNNA 4H9QA 3MGRC 1U35D 3REIA 3X1SA 4YS3C 4H9OA 3AFAD 1P34C 1TAFB 2BYKA 3W98A 3REJB 3REKB 3UT9A 2CV5C 3X1VA 1WWSA 4J8XA 4KUDB 3LELA 1B6WA 4Z5TB 4Z66B 3X1TA 3AZMB 5B40A 3C1CD 5B1MB 4EO5B 4XZQC 3TU4B 1P3AD 4J8WD 5B2JC 5CPIA 1M1AA 2HIOA 5B2IB 5B0YD 1R4VA 3KUYC 4WU9D 1P3MD 2BYMA 5C3IC 4H9PB 5E5AD 3AFAB 4ZUXC 1F66C 1EQZB 3KWQC 4X23D 3W96D 3LZ1C 1HTAA 1P3AB 4J8WB 3UTAC 5DNMA 5B0YB 3WTPB 1P3GC 5B32A 2FJ7D 4QLCC 4WU9B 2CV5A 5GT0D 4H9SC 1ID3D 5BS7C 1U35C 1M19A 3X1UA 5GT3C 4KHAA 5GSUD 5G49B 5BT1D 1AOIA 4X23B 3O62B 3NQJB 5B2JA 2NZDC 2PYOD 3MNNA 3C1CC 4AWLB 2AROD 2IO5C 3AZJD 5CP6D 3AZGC 5CPKA 5DNNA 5GT0B 3B6FC 3C1BD 1P3KA 1ID3B 1P3MC 1ZLAD 3AZEA 5E5AC 3REID 3X1SD 4WU8C 3UT9D 3X1VD 4J8XD 2PYOB 3LELD 3AYWA 1S32D 3W96C 5GXQA 3UTBA 5BO0A 5AV8B 4J8VA 2AROB 5AV9A 5B24C 3AZJB 3AV1C 3AZNA 5AV6D 5CP6B 5B0ZD 5CPID 1M1AD 1BH8B 5JA4B 3C1BB 2FJ7C 1ZLAB 4WNNB 4H9QB 4E44A 4J8UA 3RELD 3WAAA 1KX3D 3REIB 3X1SB 3VH6A 4H9OB 4UUZB 1P3LA 5GSUC 2BYKB 3W98B 4KGCA 3UT9B 3LJAA 1F1EA 3AZKC 3X1VB 1HQ3C 4J8XB 3V9RA 3AN2A 5F99C 3LELB 3W97C 3X1TB 2HUEB 4NE6A 4CSRB 4YM6A 3KXBD 1H3OA 4XUJA 3AZGA 3B6FA 5B31D 1BFMA 5AV6B 5CPIB 3AZID 1M1AB 2HIOB 5DNMD 3A6NA 3REHA 5B1LA 5AY8C 4R8PA 3B6GD 2BYMB 3MGQD 1P3IA 3X1UD 5AV5C 4NE3A 4KUDD 1AOID 4NE5A 3MVDC 3AV1A 3AV2A 1P3FC 3MGSD 5AVCC 1S32C 5B31B 3MNND 1ULYA 5B32G 5DNMB 5B0ZC 5B32B 1M18C 3B6GB 3MGQB 4H9RA 5DNND 2NQBA 1KX4C 3RELC 1M19B 3X1UB 1KX3C 4KHAB 1B67A 1EQZD 2CWEA 5CPJA 3AZFC 4LD9A 3W99C 1AOIB 1P3GD 3AZHA 3MGSB 4ZBJB 3MNNB 3KXBC 5AY8A 3AYWD 5GXQD 3WKJD 5JRGA 3WTPD 4J8VD 1P3PC 4CAYA 5AV9D 1KX5C 1Q9CA 5B33A 3AZIC 4HGAB 3AZND 5CPKB 2L5AA 5DNNB 3MGPD 1P3KB 1TZYA 3MVDA 5FUGA 4J8UD 3AZEB 3REJC 3REKC 3LZ0A 1P3FA 5AVCA 3WA9D 3NQUA 3O62D 1P3LD 4DRAA 4KGCD 4KUDC 4Z5TC 3LJAD 2YFWB 4Z66C 3AZMC 1P3BD 5B1MC 4EO5C 3MGRA 3AYWB 4YM6D 3TU4C 5GXQB 3WKJB 3UTBB 5BO0B 4J8VB 4YS3A 5AV9B 1P34A 5B2IC 3AZNB 1KX5B 3MGPB 3REHD 4M6BA 3B0DB 3A6ND 5B1LD 3AZLD 4R8PD 5AVBD 3VH6T 4J8UB 3AFAC 4XZQA 1P3ID 4G91B 1P3OD 1EQZC 3WA9B 1P3LB 4KGCB 3LJAB 3VH5W 3V9RB 1P3BB 3AN2B 3KUYA 1P3PA 4WZSB 1BH9A 5AV8D 4YM6B 1P3AC 1H3OB 3R45A 4XUJB 4J8WC 4JJND 5BNXA 4ZUXA 3WKJC 5B0YC 3WTPC 1F66A 4WU9C 3REHB 2F8NA 3A6NB 5B1LB 3KWQA 3AZLB 4R8PB 5AVBB 3B0CW 4Z5TA 3LZ1A 1P3IB 1P3OB 2NQBD 3W98D 3UTAA 3TU4A 4X23C 3O62C 1P3GA 2LY8A 5CPJD 5BNVA 3X1TD 4LD9D 4QLCA 5B40D 4H9SA 4AWLC 4JJNB 5BS7A 3AZHD 1U35A 3WTPE 5GT3A 2HIOD 5JRGD 5GT0C 5B33D 1ID3C 2NZDA 4H9RB 2YFVA 3C1CA 2NQBB 1TZYD 5BT1C 1P3AA 2F8NK 5CPJB 2PYOC 4LD9B 5B40B 4E45A 2RVQD 3AZHB 1P3MA 5AV8C 2AROC 3MGRD 1WWIA 4JJNC 5E5AA 3AZJC 4NFTA 5JRGB 5CP6C 4YS3D 4CAYB 5B32D 4WU8A 1P34D 3C1BC 5B33B 2CV5D 1ZLAC 1M19D 3REIC 3X1SC 1TZYB 3W96A 5FUGB 3W98C 3UT9C 3LZ0B 5B24A 3X1VC 4J8XC 3NQUB 4G92B 5B2JD 3LELC 3X1TC 2HUEC 2FJ7A 3KUYD 5KDMA 3MGRB 5AV6C 4YS3B 5CPIC 1M1AC 1P34B 2HIOC 5GSUA 2CV5B 5CPKD 3AZKA 1F66D 1HQ3A 1P3KD 2F8ND 5F99A 3W97A 3AZED 1JFIA 5CHLB 3LZ1D 3B0BA 4WV4B 1N1JA 5B2JB 3UTAD 1KU5A 3KUYB 3VH5T 2RVQC 4QLCD 3UTBD 5B31C 1BH9B 5C3IB 3R45B 3KSYA 5BNXB 2F8NH 5AV5A 4ZUXB 5GT3D 5DNMC 2F8NG 1F66B 5B32C 4UUZA 3B6GC 2F8NB 3MGQC 4H9NA 3WAAD 3KWQB 1M19C 3X1UC 2NZDD 3LZ1B 1S32A 3B0CT 4CSRA 3UTAB 1AOIC 3AN2D 5AV6A 5B0ZA 1P3GB 5BNVB 3MGSC 4QLCB 4ZBJC 4XUJD 3MNNC 3AZGD 1M18A 3B6FD 1KX4A 3RELA 1U35B 1KX3A 5GT3B 4HGAC 3AZFA 5CPKC 3W99A 5DNNC 4WU8D 3WAAB 1P3KC 2NZDB 2YFVB 3KXBA 3AZEC 3C1CB 5B31A 2IO5B 5B24D 1KX5A 3AZIA 3AV1D 3VH5A 3AZGB 3AV2D 3AYWC 3B6FB 5GXQC 3UTBC 1P3MB 3B6GA 4J8VC 3MGQA 5AV9C 1TAFA 5E5AB 3REJA 3REKA 3AZNC 4WU8B 3MGPC 4KUDA 3B0DC 4Z66A 3AZKD 1HQ3D 3AZMA 3WAAC 4J8UC 5B1MA 5F99D 3W97D 4G91C 3W96B 3MGSA 3WA9C 1P3LC 4KGCC 3LJAC 5B24B 4Z2MH 5B2IA 1P3BC 3AN2C 3AV1B 4Z2MG 3AV2B 4YM6C 2FJ7B 4H9PA 4XUJC 5AY8D 5KDMB 3AFAA 1EQZA 5AV5D 5GSUB 3REHC 3A6NC 5B1LC 3AZKB 1HQ3B 3AZLC 4R8PC 5AVBC 5F99B 2YFWA 1P3IC 3W97B 3MVDD 1P3OC 3LZ0D 4J8WA 1JFIB 1P3FD 5AVCD 3WKJA 5B0YA 3WTPA 1N1JB 4WU9A 5AY8B 3AV2C 3MGPA 1M18D 3VH6W 1KX4D 5G49A 5AV5B 3WA9A 4X23A 3O62A 3NQJA 3AZFD 3W99D 4H9NB 3MVDB 1P3BA 2NQBC 4XZQD 1P3FB 5AVCB 1S32B 5CPJC 4LD9C 5B40C 1P3PD 1KX5D 5GT0A 5B0ZB 3AZHC 1ID3A 1M18B 3AZLA 4DRBA 4ZUXD 5AVBA 3RELB 1KX4B 5JRGC 1KX3B 1A7WA 1P3OA 3REJD 3REKD 5B33C 2JSSA 2PYOA 3KWQD 3AZFB 3W99B 4Z5TD 4XZQB 4Z66D 1TZYC 3AZMD 5B31G 5AV8A 3KXBB 5B1MD 2AROA 3LZ0C 4JJNA 3TU4D 3AZJA 4G92C 1P3PB 5CP6A 1BH8A
chains in the Genus database with same CATH superfamily
5JA4A 3C1BA 5B2ID 3AZIB 1ZLAA 4WNNA 4H9QA 3MGRC 1U35D 3REIA 3X1SA 4YS3C 4H9OA 3AFAD 1P34C 1TAFB 2BYKA 3W98A 3REJB 3REKB 3UT9A 2CV5C 3X1VA 1WWSA 4J8XA 4KUDB 3LELA 1B6WA 4Z5TB 4Z66B 3X1TA 3AZMB 5B40A 3C1CD 1PZRA 5B1MB 4EO5B 4XZQC 3TU4B 1P3AD 4J8WD 5B2JC 5CPIA 1M1AA 1Z2CB 2HIOA 5B2IB 5B0YD 1R4VA 3KUYC 4WU9D 1P3MD 2BYMA 5C3IC 4H9PB 5E5AD 3AFAB 4ZUXC 1F66C 1EQZB 3KWQC 4X23D 3W96D 3LZ1C 3EG5B 1HTAA 1P3AB 4J8WB 3UTAC 5DNMA 5B0YB 3WTPB 1P3GC 5B32A 2FJ7D 4QLCC 4WU9B 2CV5A 5GT0D 4H9SC 1ID3D 5BS7C 1U35C 1M19A 3X1UA 5GT3C 4KHAA 2ZY4A 5GSUD 5G49B 5BT1D 1AOIA 4X23B 3O62B 3NQJB 5B2JA 3A1IA 2PYOD 2NZDC 2BG1A 2ZY5A 3MNNA 3C1CC 4AWLB 2AROD 2IO5C 3AZJD 5CP6D 3AZGC 3H0RC 5CPKA 5DNNA 5GT0B 3B6FC 3C1BD 1P3KA 1ID3B 1P3MC 1ZLAD 3EPLA 3AZEA 5E5AC 3REID 3X1SD 4WU8C 3F6TA 3UT9D 3X1VD 4J8XD 2PYOB 3LELD 3AYWA 1S32D 3W96C 2DQNC 5GXQA 3UTBA 5BO0A 5AV8B 4J8VA 2AROB 5AV9A 5B24C 3AZJB 3AV1C 3AZNA 5AV6D 5CP6B 5B0ZD 5CPID 2Y2KA 1M1AD 1BH8B 5JA4B 3C1BB 2FJ7C 1ZLAB 4WNNB 4H9QB 4E44A 4J8UA 3RELD 3WAAA 1KX3D 3REIB 3X1SB 3VH6A 4H9OB 4UUZB 1P3LA 5GSUC 2BYKB 3W98B 4KGCA 3UT9B 3LJAA 1F1EA 3AZKC 3X1VB 1HQ3C 4J8XB 3V9RA 3AN2A 5F99C 3LELB 3W97C 2DF4C 3X1TB 2HUEB 4NE6A 2FFFB 4CSRB 4YM6A 1H3OA 4XUJA 3KXBD 3AZGA 2RIQA 3B6FA 5B31D 1BFMA 5AV6B 5CPIB 3AZID 1M1AB 2HIOB 5DNMD 3A6NA 3REHA 5B1LA 2XD5A 5AY8C 4R8PA 2G5IC 3B6GD 2BYMB 3MGQD 1P3IA 3X1UD 5AV5C 4NE3A 4KUDD 1AOID 4NE5A 3MVDC 3AV1A 3AV2A 1P3FC 3MGSD 5AVCC 1S32C 5B31B 3MNND 1ULYA 5B32G 2Y2GA 5DNMB 5B0ZC 5B32B 1M18C 3B6GB 3FDDA 4H9RA 3MGQB 5DNND 2NQBA 1KX4C 3RELC 1M19B 3X1UB 1KX3C 4KHAB 1B67A 1EQZD 2CWEA 1T3UA 2ZY3A 5CPJA 3AZFC 4LD9A 3W99C 1AOIB 1P3GD 3AZHA 3MGSB 4ZBJB 3MNNB 3KXBC 5AY8A 3AYWD 5GXQD 3WKJD 5JRGA 3WTPD 4J8VD 1P3PC 4CAYA 5AV9D 1KX5C 1Q9CA 3EPKA 5B33A 3AZIC 4HGAB 3AZND 5CPKB 2L5AA 5DNNB 3MGPD 1P3KB 1TZYA 3MVDA 5FUGA 4J8UD 3AZEB 3REJC 3REKC 3LZ0A 1P3FA 5AVCA 3WA9D 3NQUA 3O62D 1P3LD 4DRAA 4KGCD 4KUDC 4Z5TC 3LJAD 2YFWB 3H0LC 4Z66C 1W2EA 3AZMC 1P3BD 5B1MC 4EO5C 3MGRA 2UWXA 3AYWB 4YM6D 3TU4C 5GXQB 3WKJB 3UTBB 5BO0B 4J8VB 4YS3A 2Y2HA 5AV9B 1P34A 5B2IC 3AZNB 1KX5B 3MGPB 3REHD 4M6BA 3B0DB 3IP4C 5B1LD 3A6ND 3AZLD 4R8PD 5AVBD 3VH6T 4J8UB 3AFAC 3AL0C 4XZQA 1P3ID 4G91B 1P3OD 1EQZC 3WA9B 1P3LB 4KGCB 3LJAB 3VH5W 2Y2OA 3V9RB 1P3BB 3AN2B 3KUYA 1P3PA 4WZSB 1BH9A 5AV8D 4YM6B 1P3AC 1H3OB 3R45A 4XUJB 4J8WC 4JJND 5BNXA 4ZUXA 3WKJC 5B0YC 3WTPC 1F66A 2W8SA 4WU9C 3REHB 2F8NA 3A6NB 5B1LB 3KWQA 3AZLB 4R8PB 5AVBB 3B0CW 2Y2LA 4Z5TA 3LZ1A 1P3IB 2Y2JA 3A1KA 1P3OB 2NQBD 3W98D 2XD1A 3UTAA 2Y2PA 3TU4A 4X23C 3O62C 1P3GA 2LY8A 5CPJD 2Y2MA 5BNVA 3X1TD 4QLCA 5B40D 4LD9D 4H9SA 4AWLC 4JJNB 5BS7A 3AZHD 1U35A 3WTPE 5GT3A 3KFUG 2HIOD 5JRGD 5GT0C 4UPKA 5B33D 1ID3C 2NZDA 4H9RB 2YFVA 3C1CA 2NQBB 1TZYD 5BT1C 1P3AA 2F8NK 5CPJB 2PYOC 4LD9B 5B40B 4E45A 2RVQD 3AZHB 1P3MA 5AV8C 2AROC 3MGRD 1WWIA 4JJNC 5E5AA 3AZJC 4NFTA 5JRGB 5CP6C 4YS3D 4CAYB 5B32D 4WU8A 1P34D 3C1BC 5B33B 2CV5D 1ZLAC 1M19D 3REIC 3X1SC 1TZYB 3W96A 5FUGB 3W98C 3UT9C 2Y2NA 3LZ0B 5B24A 3X1VC 4J8XC 3NQUB 4G92B 5B2JD 3LELC 3X1TC 2HUEC 2FJ7A 3KUYD 5KDMA 3MGRB 5AV6C 4YS3B 5CPIC 1M1AC 2ZY2A 1P34B 2HIOC 5GSUA 2CV5B 5CPKD 3AZKA 1F66D 1HQ3A 1P3KD 2F8ND 5F99A 3W97A 2ZM5A 3AZED 1JFIA 5CHLB 3LZ1D 3B0BA 4WV4B 1N1JA 5B2JB 3UTAD 2JCHA 1KU5A 3KUYB 3VH5T 2RVQC 4QLCD 3UTBD 5B31C 1BH9B 5C3IB 3R45B 3KSYA 5BNXB 2F8NH 5AV5A 4ZUXB 5GT3D 5DNMC 2F8NG 1F66B 5B32C 4UUZA 3B6GC 2F8NB 3MGQC 4H9NA 3WAAD 3KWQB 1M19C 3X1UC 2NZDD 2F2AC 3LZ1B 1S32A 3B0CT 4CSRA 3UTAB 1AOIC 3AN2D 3EPJA 5AV6A 5B0ZA 1P3GB 5BNVB 2J8PA 3MGSC 4QLCB 4ZBJC 4XUJD 3MNNC 3AZGD 1M18A 3B6FD 1KX4A 3RELA 1U35B 2Y2IA 2VQRA 1KX3A 5GT3B 4HGAC 3AZFA 5CPKC 3W99A 5DNNC 4WU8D 3WAAB 1P3KC 4DQYB 2NZDB 2YFVB 3KXBA 3AZEC 3C1CB 5B31A 2IO5B 5B24D 1KX5A 3AZIA 3AV1D 3VH5A 3AZGB 3AV2D 3AYWC 3B6FB 5GXQC 3UTBC 1P3MB 3B6GA 4J8VC 3MGQA 5AV9C 1TAFA 5E5AB 3REJA 3REKA 3AZNC 4WU8B 3MGPC 4KUDA 3B0DC 4Z66A 3AZKD 1HQ3D 3AZMA 3WAAC 4J8UC 5B1MA 5F99D 3W97D 4G91C 3W96B 3MGSA 3WA9C 1P3LC 4KGCC 3LJAC 5B24B 4Z2MH 5B2IA 1P3BC 3AN2C 3AV1B 4Z2MG 3AV2B 4YM6C 2FJ7B 4H9PA 4XUJC 5AY8D 5KDMB 3AFAA 1EQZA 5AV5D 5GSUB 3REHC 3A6NC 5B1LC 3AZKB 1HQ3B 3AZLC 4R8PC 5AVBC 5F99B 2YFWA 1P3IC 3W97B 3MVDD 1P3OC 3LZ0D 4J8WA 1JFIB 1P3FD 3EPHA 5AVCD 3WKJA 5B0YA 3WTPA 1N1JB 4WU9A 5AY8B 3AV2C 3MGPA 1M18D 3VH6W 1KX4D 5G49A 5AV5B 3P5JB 3WA9A 4X23A 3O62A 3NQJA 3AZFD 3W99D 4H9NB 3MVDB 1P3BA 2NQBC 4XZQD 2G5HC 2JE5A 1P3FB 5AVCB 1S32B 2Y2QA 5CPJC 4LD9C 5B40C 1P3PD 1KX5D 5GT0A 5B0ZB 3AZHC 1ID3A 1M18B 3AZLA 4DRBA 4ZUXD 5AVBA 3RELB 1KX4B 4WJ3C 5JRGC 1KX3B 1A7WA 3H0MC 1P3OA 3REJD 3REKD 5B33C 2JSSA 2PYOA 3KWQD 3AZFB 3W99B 4Z5TD 4XZQB 4Z66D 1TZYC 3AZMD 5B31G 5AV8A 3KXBB 5B1MD 2AROA 3LZ0C 4JJNA 3TU4D 3AZJA 4G92C 1P3PB 5CP6A 1BH8A
chains in the Genus database with same CATH topology
5JA4A 3C1BA 5B2ID 3AZIB 1ZLAA 4WNNA 4H9QA 3MGRC 1U35D 3REIA 3X1SA 4YS3C 4H9OA 3AFAD 1P34C 1TAFB 2BYKA 3W98A 3REJB 3REKB 3UT9A 2CV5C 3X1VA 1WWSA 4J8XA 4KUDB 3LELA 1B6WA 4Z5TB 4Z66B 3X1TA 3AZMB 5B40A 3C1CD 1PZRA 5B1MB 4EO5B 4XZQC 3TU4B 1P3AD 4J8WD 5B2JC 5CPIA 1M1AA 1Z2CB 2HIOA 5B2IB 5B0YD 1R4VA 3KUYC 4WU9D 1P3MD 2BYMA 5C3IC 4H9PB 5E5AD 3AFAB 4ZUXC 1F66C 1EQZB 3KWQC 4X23D 3W96D 3LZ1C 3EG5B 1HTAA 1P3AB 4J8WB 3UTAC 5DNMA 5B0YB 3WTPB 1P3GC 5B32A 2FJ7D 4QLCC 4WU9B 2CV5A 5GT0D 4H9SC 1ID3D 5BS7C 1U35C 1M19A 3X1UA 5GT3C 4KHAA 2ZY4A 5GSUD 5G49B 5BT1D 1AOIA 4X23B 3O62B 3NQJB 5B2JA 3A1IA 2PYOD 2NZDC 2BG1A 2ZY5A 3MNNA 3C1CC 4AWLB 2AROD 2IO5C 3AZJD 5CP6D 3AZGC 3H0RC 5CPKA 5DNNA 5GT0B 3B6FC 3C1BD 1P3KA 1ID3B 1P3MC 1ZLAD 3EPLA 3AZEA 5E5AC 3REID 3X1SD 4WU8C 3F6TA 3UT9D 3X1VD 4J8XD 2PYOB 3LELD 3AYWA 1S32D 3W96C 2DQNC 5GXQA 3UTBA 5BO0A 5AV8B 4J8VA 2AROB 5AV9A 5B24C 3AZJB 3AV1C 3AZNA 5AV6D 5CP6B 5B0ZD 5CPID 2Y2KA 1M1AD 1BH8B 5JA4B 3C1BB 2FJ7C 1ZLAB 4WNNB 4H9QB 4E44A 4J8UA 3RELD 3WAAA 1KX3D 3REIB 3X1SB 3VH6A 4H9OB 4UUZB 1P3LA 5GSUC 2BYKB 3W98B 4KGCA 3UT9B 3LJAA 1F1EA 3AZKC 3X1VB 1HQ3C 4J8XB 3V9RA 3AN2A 5F99C 3LELB 3W97C 2DF4C 3X1TB 2HUEB 4NE6A 2FFFB 4CSRB 4YM6A 1H3OA 4XUJA 3KXBD 3AZGA 2RIQA 3B6FA 5B31D 1BFMA 5AV6B 5CPIB 3AZID 1M1AB 2HIOB 5DNMD 3A6NA 3REHA 5B1LA 2XD5A 5AY8C 4R8PA 2G5IC 3B6GD 2BYMB 3MGQD 1P3IA 3X1UD 5AV5C 4NE3A 4KUDD 1AOID 4NE5A 3MVDC 3AV1A 3AV2A 1P3FC 3MGSD 5AVCC 1S32C 5B31B 3MNND 1ULYA 5B32G 2Y2GA 5DNMB 5B0ZC 5B32B 1M18C 3B6GB 3FDDA 4H9RA 3MGQB 5DNND 2NQBA 1KX4C 3RELC 1M19B 3X1UB 1KX3C 4KHAB 1B67A 1EQZD 2CWEA 1T3UA 2ZY3A 5CPJA 3AZFC 4LD9A 3W99C 1AOIB 1P3GD 3AZHA 3MGSB 4ZBJB 3MNNB 3KXBC 5AY8A 3AYWD 5GXQD 3WKJD 5JRGA 3WTPD 4J8VD 1P3PC 4CAYA 5AV9D 1KX5C 1Q9CA 3EPKA 5B33A 3AZIC 4HGAB 3AZND 5CPKB 2L5AA 5DNNB 3MGPD 1P3KB 1TZYA 3MVDA 5FUGA 4J8UD 3AZEB 3REJC 3REKC 3LZ0A 1P3FA 5AVCA 3WA9D 3NQUA 3O62D 1P3LD 4DRAA 4KGCD 4KUDC 4Z5TC 3LJAD 2YFWB 3H0LC 4Z66C 1W2EA 3AZMC 1P3BD 5B1MC 4EO5C 3MGRA 2UWXA 3AYWB 4YM6D 3TU4C 5GXQB 3WKJB 3UTBB 5BO0B 4J8VB 4YS3A 2Y2HA 5AV9B 1P34A 5B2IC 3AZNB 1KX5B 3MGPB 3REHD 4M6BA 3B0DB 3IP4C 5B1LD 3A6ND 3AZLD 4R8PD 5AVBD 3VH6T 4J8UB 3AFAC 3AL0C 4XZQA 1P3ID 4G91B 1P3OD 1EQZC 3WA9B 1P3LB 4KGCB 3LJAB 3VH5W 2Y2OA 3V9RB 1P3BB 3AN2B 3KUYA 1P3PA 4WZSB 1BH9A 5AV8D 4YM6B 1P3AC 1H3OB 3R45A 4XUJB 4J8WC 4JJND 5BNXA 4ZUXA 3WKJC 5B0YC 3WTPC 1F66A 2W8SA 4WU9C 3REHB 2F8NA 3A6NB 5B1LB 3KWQA 3AZLB 4R8PB 5AVBB 3B0CW 2Y2LA 4Z5TA 3LZ1A 1P3IB 2Y2JA 3A1KA 1P3OB 2NQBD 3W98D 2XD1A 3UTAA 2Y2PA 3TU4A 4X23C 3O62C 1P3GA 2LY8A 5CPJD 2Y2MA 5BNVA 3X1TD 4QLCA 5B40D 4LD9D 4H9SA 4AWLC 4JJNB 5BS7A 3AZHD 1U35A 3WTPE 5GT3A 3KFUG 2HIOD 5JRGD 5GT0C 4UPKA 5B33D 1ID3C 2NZDA 4H9RB 2YFVA 3C1CA 2NQBB 1TZYD 5BT1C 1P3AA 2F8NK 5CPJB 2PYOC 4LD9B 5B40B 4E45A 2RVQD 3AZHB 1P3MA 5AV8C 2AROC 3MGRD 1WWIA 4JJNC 5E5AA 3AZJC 4NFTA 5JRGB 5CP6C 4YS3D 4CAYB 5B32D 4WU8A 1P34D 3C1BC 5B33B 2CV5D 1ZLAC 1M19D 3REIC 3X1SC 1TZYB 3W96A 5FUGB 3W98C 3UT9C 2Y2NA 3LZ0B 5B24A 3X1VC 4J8XC 3NQUB 4G92B 5B2JD 3LELC 3X1TC 2HUEC 2FJ7A 3KUYD 5KDMA 3MGRB 5AV6C 4YS3B 5CPIC 1M1AC 2ZY2A 1P34B 2HIOC 5GSUA 2CV5B 5CPKD 3AZKA 1F66D 1HQ3A 1P3KD 2F8ND 5F99A 3W97A 2ZM5A 3AZED 1JFIA 5CHLB 3LZ1D 3B0BA 4WV4B 1N1JA 5B2JB 3UTAD 2JCHA 1KU5A 3KUYB 3VH5T 2RVQC 4QLCD 3UTBD 5B31C 1BH9B 5C3IB 3R45B 3KSYA 5BNXB 2F8NH 5AV5A 4ZUXB 5GT3D 5DNMC 2F8NG 1F66B 5B32C 4UUZA 3B6GC 2F8NB 3MGQC 4H9NA 3WAAD 3KWQB 1M19C 3X1UC 2NZDD 2F2AC 3LZ1B 1S32A 3B0CT 4CSRA 3UTAB 1AOIC 3AN2D 3EPJA 5AV6A 5B0ZA 1P3GB 5BNVB 2J8PA 3MGSC 4QLCB 4ZBJC 4XUJD 3MNNC 3AZGD 1M18A 3B6FD 1KX4A 3RELA 1U35B 2Y2IA 2VQRA 1KX3A 5GT3B 4HGAC 3AZFA 5CPKC 3W99A 5DNNC 4WU8D 3WAAB 1P3KC 4DQYB 2NZDB 2YFVB 3KXBA 3AZEC 3C1CB 5B31A 2IO5B 5B24D 1KX5A 3AZIA 3AV1D 3VH5A 3AZGB 3AV2D 3AYWC 3B6FB 5GXQC 3UTBC 1P3MB 3B6GA 4J8VC 3MGQA 5AV9C 1TAFA 5E5AB 3REJA 3REKA 3AZNC 4WU8B 3MGPC 4KUDA 3B0DC 4Z66A 3AZKD 1HQ3D 3AZMA 3WAAC 4J8UC 5B1MA 5F99D 3W97D 4G91C 3W96B 3MGSA 3WA9C 1P3LC 4KGCC 3LJAC 5B24B 4Z2MH 5B2IA 1P3BC 3AN2C 3AV1B 4Z2MG 3AV2B 4YM6C 2FJ7B 4H9PA 4XUJC 5AY8D 5KDMB 3AFAA 1EQZA 5AV5D 5GSUB 3REHC 3A6NC 5B1LC 3AZKB 1HQ3B 3AZLC 4R8PC 5AVBC 5F99B 2YFWA 1P3IC 3W97B 3MVDD 1P3OC 3LZ0D 4J8WA 1JFIB 1P3FD 3EPHA 5AVCD 3WKJA 5B0YA 3WTPA 1N1JB 4WU9A 5AY8B 3AV2C 3MGPA 1M18D 3VH6W 1KX4D 5G49A 5AV5B 3P5JB 3WA9A 4X23A 3O62A 3NQJA 3AZFD 3W99D 4H9NB 3MVDB 1P3BA 2NQBC 4XZQD 2G5HC 2JE5A 1P3FB 5AVCB 1S32B 2Y2QA 5CPJC 4LD9C 5B40C 1P3PD 1KX5D 5GT0A 5B0ZB 3AZHC 1ID3A 1M18B 3AZLA 4DRBA 4ZUXD 5AVBA 3RELB 1KX4B 4WJ3C 5JRGC 1KX3B 1A7WA 3H0MC 1P3OA 3REJD 3REKD 5B33C 2JSSA 2PYOA 3KWQD 3AZFB 3W99B 4Z5TD 4XZQB 4Z66D 1TZYC 3AZMD 5B31G 5AV8A 3KXBB 5B1MD 2AROA 3LZ0C 4JJNA 3TU4D 3AZJA 4G92C 1P3PB 5CP6A 1BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 A;  3C1B A;  5B2I D;  3AZI B;  1ZLA A;  4WNN A;  4H9Q A;  3MGR C;  1U35 D;  3REI A;  3X1S A;  4YS3 C;  4H9O A;  3AFA D;  1P34 C;  1TAF B;  2BYK A;  3W98 A;  3REJ B;  3REK B;  3UT9 A;  2CV5 C;  3X1V A;  1WWS A;  4J8X A;  4KUD B;  3LEL A;  1B6W A;  4Z5T B;  4Z66 B;  3X1T A;  3AZM B;  5B40 A;  3C1C D;  5B1M B;  4EO5 B;  4XZQ C;  3TU4 B;  1P3A D;  4J8W D;  5B2J C;  5CPI A;  1M1A A;  2HIO A;  5B2I B;  5B0Y D;  1R4V A;  3KUY C;  4WU9 D;  1P3M D;  2BYM A;  5C3I C;  4H9P B;  5E5A D;  3AFA B;  4ZUX C;  1F66 C;  1EQZ B;  3KWQ C;  4X23 D;  3W96 D;  3LZ1 C;  1HTA A;  1P3A B;  4J8W B;  3UTA C;  5DNM A;  5B0Y B;  3WTP B;  1P3G C;  5B32 A;  2FJ7 D;  4QLC C;  4WU9 B;  2CV5 A;  5GT0 D;  4H9S C;  1ID3 D;  5BS7 C;  1U35 C;  1M19 A;  3X1U A;  5GT3 C;  4KHA A;  5GSU D;  5G49 B;  5BT1 D;  1AOI A;  4X23 B;  3O62 B;  3NQJ B;  5B2J A;  2NZD C;  2PYO D;  3MNN A;  3C1C C;  4AWL B;  2ARO D;  2IO5 C;  3AZJ D;  5CP6 D;  3AZG C;  5CPK A;  5DNN A;  5GT0 B;  3B6F C;  3C1B D;  1P3K A;  1ID3 B;  1P3M C;  1ZLA D;  3AZE A;  5E5A C;  3REI D;  3X1S D;  4WU8 C;  3UT9 D;  3X1V D;  4J8X D;  2PYO B;  3LEL D;  3AYW A;  1S32 D;  3W96 C;  5GXQ A;  3UTB A;  5BO0 A;  5AV8 B;  4J8V A;  2ARO B;  5AV9 A;  5B24 C;  3AZJ B;  3AV1 C;  3AZN A;  5AV6 D;  5CP6 B;  5B0Z D;  5CPI D;  1M1A D;  1BH8 B;  5JA4 B;  3C1B B;  2FJ7 C;  1ZLA B;  4WNN B;  4H9Q B;  4E44 A;  4J8U A;  3REL D;  3WAA A;  1KX3 D;  3REI B;  3X1S B;  3VH6 A;  4H9O B;  4UUZ B;  1P3L A;  5GSU C;  2BYK B;  3W98 B;  4KGC A;  3UT9 B;  3LJA A;  1F1E A;  3AZK C;  3X1V B;  1HQ3 C;  4J8X B;  3V9R A;  3AN2 A;  5F99 C;  3LEL B;  3W97 C;  3X1T B;  2HUE B;  4NE6 A;  4CSR B;  4YM6 A;  3KXB D;  1H3O A;  4XUJ A;  3AZG A;  3B6F A;  5B31 D;  1BFM A;  5AV6 B;  5CPI B;  3AZI D;  1M1A B;  2HIO B;  5DNM D;  3A6N A;  3REH A;  5B1L A;  5AY8 C;  4R8P A;  3B6G D;  2BYM B;  3MGQ D;  1P3I A;  3X1U D;  5AV5 C;  4NE3 A;  4KUD D;  1AOI D;  4NE5 A;  3MVD C;  3AV1 A;  3AV2 A;  1P3F C;  3MGS D;  5AVC C;  1S32 C;  5B31 B;  3MNN D;  1ULY A;  5B32 G;  5DNM B;  5B0Z C;  5B32 B;  1M18 C;  3B6G B;  3MGQ B;  4H9R A;  5DNN D;  2NQB A;  1KX4 C;  3REL C;  1M19 B;  3X1U B;  1KX3 C;  4KHA B;  1B67 A;  1EQZ D;  2CWE A;  5CPJ A;  3AZF C;  4LD9 A;  3W99 C;  1AOI B;  1P3G D;  3AZH A;  3MGS B;  4ZBJ B;  3MNN B;  3KXB C;  5AY8 A;  3AYW D;  5GXQ D;  3WKJ D;  5JRG A;  3WTP D;  4J8V D;  1P3P C;  4CAY A;  5AV9 D;  1KX5 C;  1Q9C A;  5B33 A;  3AZI C;  4HGA B;  3AZN D;  5CPK B;  2L5A A;  5DNN B;  3MGP D;  1P3K B;  1TZY A;  3MVD A;  5FUG A;  4J8U D;  3AZE B;  3REJ C;  3REK C;  3LZ0 A;  1P3F A;  5AVC A;  3WA9 D;  3NQU A;  3O62 D;  1P3L D;  4DRA A;  4KGC D;  4KUD C;  4Z5T C;  3LJA D;  2YFW B;  4Z66 C;  3AZM C;  1P3B D;  5B1M C;  4EO5 C;  3MGR A;  3AYW B;  4YM6 D;  3TU4 C;  5GXQ B;  3WKJ B;  3UTB B;  5BO0 B;  4J8V B;  4YS3 A;  5AV9 B;  1P34 A;  5B2I C;  3AZN B;  1KX5 B;  3MGP B;  3REH D;  4M6B A;  3B0D B;  3A6N D;  5B1L D;  3AZL D;  4R8P D;  5AVB D;  3VH6 T;  4J8U B;  3AFA C;  4XZQ A;  1P3I D;  4G91 B;  1P3O D;  1EQZ C;  3WA9 B;  1P3L B;  4KGC B;  3LJA B;  3VH5 W;  3V9R B;  1P3B B;  3AN2 B;  3KUY A;  1P3P A;  4WZS B;  1BH9 A;  5AV8 D;  4YM6 B;  1P3A C;  1H3O B;  3R45 A;  4XUJ B;  4J8W C;  4JJN D;  5BNX A;  4ZUX A;  3WKJ C;  5B0Y C;  3WTP C;  1F66 A;  4WU9 C;  3REH B;  2F8N A;  3A6N B;  5B1L B;  3KWQ A;  3AZL B;  4R8P B;  5AVB B;  3B0C W;  4Z5T A;  3LZ1 A;  1P3I B;  1P3O B;  2NQB D;  3W98 D;  3UTA A;  3TU4 A;  4X23 C;  3O62 C;  1P3G A;  2LY8 A;  5CPJ D;  5BNV A;  3X1T D;  4LD9 D;  4QLC A;  5B40 D;  4H9S A;  4AWL C;  4JJN B;  5BS7 A;  3AZH D;  1U35 A;  3WTP E;  5GT3 A;  2HIO D;  5JRG D;  5GT0 C;  5B33 D;  1ID3 C;  2NZD A;  4H9R B;  2YFV A;  3C1C A;  2NQB B;  1TZY D;  5BT1 C;  1P3A A;  2F8N K;  5CPJ B;  2PYO C;  4LD9 B;  5B40 B;  4E45 A;  2RVQ D;  3AZH B;  1P3M A;  5AV8 C;  2ARO C;  3MGR D;  1WWI A;  4JJN C;  5E5A A;  3AZJ C;  4NFT A;  5JRG B;  5CP6 C;  4YS3 D;  4CAY B;  5B32 D;  4WU8 A;  1P34 D;  3C1B C;  5B33 B;  2CV5 D;  1ZLA C;  1M19 D;  3REI C;  3X1S C;  1TZY B;  3W96 A;  5FUG B;  3W98 C;  3UT9 C;  3LZ0 B;  5B24 A;  3X1V C;  4J8X C;  3NQU B;  4G92 B;  5B2J D;  3LEL C;  3X1T C;  2HUE C;  2FJ7 A;  3KUY D;  5KDM A;  3MGR B;  5AV6 C;  4YS3 B;  5CPI C;  1M1A C;  1P34 B;  2HIO C;  5GSU A;  2CV5 B;  5CPK D;  3AZK A;  1F66 D;  1HQ3 A;  1P3K D;  2F8N D;  5F99 A;  3W97 A;  3AZE D;  1JFI A;  5CHL B;  3LZ1 D;  3B0B A;  4WV4 B;  1N1J A;  5B2J B;  3UTA D;  1KU5 A;  3KUY B;  3VH5 T;  2RVQ C;  4QLC D;  3UTB D;  5B31 C;  1BH9 B;  5C3I B;  3R45 B;  3KSY A;  5BNX B;  2F8N H;  5AV5 A;  4ZUX B;  5GT3 D;  5DNM C;  2F8N G;  1F66 B;  5B32 C;  4UUZ A;  3B6G C;  2F8N B;  3MGQ C;  4H9N A;  3WAA D;  3KWQ B;  1M19 C;  3X1U C;  2NZD D;  3LZ1 B;  1S32 A;  3B0C T;  4CSR A;  3UTA B;  1AOI C;  3AN2 D;  5AV6 A;  5B0Z A;  1P3G B;  5BNV B;  3MGS C;  4QLC B;  4ZBJ C;  4XUJ D;  3MNN C;  3AZG D;  1M18 A;  3B6F D;  1KX4 A;  3REL A;  1U35 B;  1KX3 A;  5GT3 B;  4HGA C;  3AZF A;  5CPK C;  3W99 A;  5DNN C;  4WU8 D;  3WAA B;  1P3K C;  2NZD B;  2YFV B;  3KXB A;  3AZE C;  3C1C B;  5B31 A;  2IO5 B;  5B24 D;  1KX5 A;  3AZI A;  3AV1 D;  3VH5 A;  3AZG B;  3AV2 D;  3AYW C;  3B6F B;  5GXQ C;  3UTB C;  1P3M B;  3B6G A;  4J8V C;  3MGQ A;  5AV9 C;  1TAF A;  5E5A B;  3REJ A;  3REK A;  3AZN C;  4WU8 B;  3MGP C;  4KUD A;  3B0D C;  4Z66 A;  3AZK D;  1HQ3 D;  3AZM A;  3WAA C;  4J8U C;  5B1M A;  5F99 D;  3W97 D;  4G91 C;  3W96 B;  3MGS A;  3WA9 C;  1P3L C;  4KGC C;  3LJA C;  5B24 B;  4Z2M H;  5B2I A;  1P3B C;  3AN2 C;  3AV1 B;  4Z2M G;  3AV2 B;  4YM6 C;  2FJ7 B;  4H9P A;  4XUJ C;  5AY8 D;  5KDM B;  3AFA A;  1EQZ A;  5AV5 D;  5GSU B;  3REH C;  3A6N C;  5B1L C;  3AZK B;  1HQ3 B;  3AZL C;  4R8P C;  5AVB C;  5F99 B;  2YFW A;  1P3I C;  3W97 B;  3MVD D;  1P3O C;  3LZ0 D;  4J8W A;  1JFI B;  1P3F D;  5AVC D;  3WKJ A;  5B0Y A;  3WTP A;  1N1J B;  4WU9 A;  5AY8 B;  3AV2 C;  3MGP A;  1M18 D;  3VH6 W;  1KX4 D;  5G49 A;  5AV5 B;  3WA9 A;  4X23 A;  3O62 A;  3NQJ A;  3AZF D;  3W99 D;  4H9N B;  3MVD B;  1P3B A;  2NQB C;  4XZQ D;  1P3F B;  5AVC B;  1S32 B;  5CPJ C;  4LD9 C;  5B40 C;  1P3P D;  1KX5 D;  5GT0 A;  5B0Z B;  3AZH C;  1ID3 A;  1M18 B;  3AZL A;  4DRB A;  4ZUX D;  5AVB A;  3REL B;  1KX4 B;  5JRG C;  1KX3 B;  1A7W A;  1P3O A;  3REJ D;  3REK D;  5B33 C;  2JSS A;  2PYO A;  3KWQ D;  3AZF B;  3W99 B;  4Z5T D;  4XZQ B;  4Z66 D;  1TZY C;  3AZM D;  5B31 G;  5AV8 A;  3KXB B;  5B1M D;  2ARO A;  3LZ0 C;  4JJN A;  3TU4 D;  3AZJ A;  4G92 C;  1P3P B;  5CP6 A;  1BH8 A; 
#chains in the Genus database with same CATH topology
 5JA4 A;  3C1B A;  5B2I D;  3AZI B;  1ZLA A;  4WNN A;  4H9Q A;  3MGR C;  1U35 D;  3REI A;  3X1S A;  4YS3 C;  4H9O A;  3AFA D;  1P34 C;  1TAF B;  2BYK A;  3W98 A;  3REJ B;  3REK B;  3UT9 A;  2CV5 C;  3X1V A;  1WWS A;  4J8X A;  4KUD B;  3LEL A;  1B6W A;  4Z5T B;  4Z66 B;  3X1T A;  3AZM B;  5B40 A;  3C1C D;  1PZR A;  5B1M B;  4EO5 B;  4XZQ C;  3TU4 B;  1P3A D;  4J8W D;  5B2J C;  5CPI A;  1M1A A;  1Z2C B;  2HIO A;  5B2I B;  5B0Y D;  1R4V A;  3KUY C;  4WU9 D;  1P3M D;  2BYM A;  5C3I C;  4H9P B;  5E5A D;  3AFA B;  4ZUX C;  1F66 C;  1EQZ B;  3KWQ C;  4X23 D;  3W96 D;  3LZ1 C;  3EG5 B;  1HTA A;  1P3A B;  4J8W B;  3UTA C;  5DNM A;  5B0Y B;  3WTP B;  1P3G C;  5B32 A;  2FJ7 D;  4QLC C;  4WU9 B;  2CV5 A;  5GT0 D;  4H9S C;  1ID3 D;  5BS7 C;  1U35 C;  1M19 A;  3X1U A;  5GT3 C;  4KHA A;  2ZY4 A;  5GSU D;  5G49 B;  5BT1 D;  1AOI A;  4X23 B;  3O62 B;  3NQJ B;  5B2J A;  3A1I A;  2PYO D;  2NZD C;  2BG1 A;  2ZY5 A;  3MNN A;  3C1C C;  4AWL B;  2ARO D;  2IO5 C;  3AZJ D;  5CP6 D;  3AZG C;  3H0R C;  5CPK A;  5DNN A;  5GT0 B;  3B6F C;  3C1B D;  1P3K A;  1ID3 B;  1P3M C;  1ZLA D;  3EPL A;  3AZE A;  5E5A C;  3REI D;  3X1S D;  4WU8 C;  3F6T A;  3UT9 D;  3X1V D;  4J8X D;  2PYO B;  3LEL D;  3AYW A;  1S32 D;  3W96 C;  2DQN C;  5GXQ A;  3UTB A;  5BO0 A;  5AV8 B;  4J8V A;  2ARO B;  5AV9 A;  5B24 C;  3AZJ B;  3AV1 C;  3AZN A;  5AV6 D;  5CP6 B;  5B0Z D;  5CPI D;  2Y2K A;  1M1A D;  1BH8 B;  5JA4 B;  3C1B B;  2FJ7 C;  1ZLA B;  4WNN B;  4H9Q B;  4E44 A;  4J8U A;  3REL D;  3WAA A;  1KX3 D;  3REI B;  3X1S B;  3VH6 A;  4H9O B;  4UUZ B;  1P3L A;  5GSU C;  2BYK B;  3W98 B;  4KGC A;  3UT9 B;  3LJA A;  1F1E A;  3AZK C;  3X1V B;  1HQ3 C;  4J8X B;  3V9R A;  3AN2 A;  5F99 C;  3LEL B;  3W97 C;  2DF4 C;  3X1T B;  2HUE B;  4NE6 A;  2FFF B;  4CSR B;  4YM6 A;  1H3O A;  4XUJ A;  3KXB D;  3AZG A;  2RIQ A;  3B6F A;  5B31 D;  1BFM A;  5AV6 B;  5CPI B;  3AZI D;  1M1A B;  2HIO B;  5DNM D;  3A6N A;  3REH A;  5B1L A;  2XD5 A;  5AY8 C;  4R8P A;  2G5I C;  3B6G D;  2BYM B;  3MGQ D;  1P3I A;  3X1U D;  5AV5 C;  4NE3 A;  4KUD D;  1AOI D;  4NE5 A;  3MVD C;  3AV1 A;  3AV2 A;  1P3F C;  3MGS D;  5AVC C;  1S32 C;  5B31 B;  3MNN D;  1ULY A;  5B32 G;  2Y2G A;  5DNM B;  5B0Z C;  5B32 B;  1M18 C;  3B6G B;  3FDD A;  4H9R A;  3MGQ B;  5DNN D;  2NQB A;  1KX4 C;  3REL C;  1M19 B;  3X1U B;  1KX3 C;  4KHA B;  1B67 A;  1EQZ D;  2CWE A;  1T3U A;  2ZY3 A;  5CPJ A;  3AZF C;  4LD9 A;  3W99 C;  1AOI B;  1P3G D;  3AZH A;  3MGS B;  4ZBJ B;  3MNN B;  3KXB C;  5AY8 A;  3AYW D;  5GXQ D;  3WKJ D;  5JRG A;  3WTP D;  4J8V D;  1P3P C;  4CAY A;  5AV9 D;  1KX5 C;  1Q9C A;  3EPK A;  5B33 A;  3AZI C;  4HGA B;  3AZN D;  5CPK B;  2L5A A;  5DNN B;  3MGP D;  1P3K B;  1TZY A;  3MVD A;  5FUG A;  4J8U D;  3AZE B;  3REJ C;  3REK C;  3LZ0 A;  1P3F A;  5AVC A;  3WA9 D;  3NQU A;  3O62 D;  1P3L D;  4DRA A;  4KGC D;  4KUD C;  4Z5T C;  3LJA D;  2YFW B;  3H0L C;  4Z66 C;  1W2E A;  3AZM C;  1P3B D;  5B1M C;  4EO5 C;  3MGR A;  2UWX A;  3AYW B;  4YM6 D;  3TU4 C;  5GXQ B;  3WKJ B;  3UTB B;  5BO0 B;  4J8V B;  4YS3 A;  2Y2H A;  5AV9 B;  1P34 A;  5B2I C;  3AZN B;  1KX5 B;  3MGP B;  3REH D;  4M6B A;  3B0D B;  3IP4 C;  5B1L D;  3A6N D;  3AZL D;  4R8P D;  5AVB D;  3VH6 T;  4J8U B;  3AFA C;  3AL0 C;  4XZQ A;  1P3I D;  4G91 B;  1P3O D;  1EQZ C;  3WA9 B;  1P3L B;  4KGC B;  3LJA B;  3VH5 W;  2Y2O A;  3V9R B;  1P3B B;  3AN2 B;  3KUY A;  1P3P A;  4WZS B;  1BH9 A;  5AV8 D;  4YM6 B;  1P3A C;  1H3O B;  3R45 A;  4XUJ B;  4J8W C;  4JJN D;  5BNX A;  4ZUX A;  3WKJ C;  5B0Y C;  3WTP C;  1F66 A;  2W8S A;  4WU9 C;  3REH B;  2F8N A;  3A6N B;  5B1L B;  3KWQ A;  3AZL B;  4R8P B;  5AVB B;  3B0C W;  2Y2L A;  4Z5T A;  3LZ1 A;  1P3I B;  2Y2J A;  3A1K A;  1P3O B;  2NQB D;  3W98 D;  2XD1 A;  3UTA A;  2Y2P A;  3TU4 A;  4X23 C;  3O62 C;  1P3G A;  2LY8 A;  5CPJ D;  2Y2M A;  5BNV A;  3X1T D;  4QLC A;  5B40 D;  4LD9 D;  4H9S A;  4AWL C;  4JJN B;  5BS7 A;  3AZH D;  1U35 A;  3WTP E;  5GT3 A;  3KFU G;  2HIO D;  5JRG D;  5GT0 C;  4UPK A;  5B33 D;  1ID3 C;  2NZD A;  4H9R B;  2YFV A;  3C1C A;  2NQB B;  1TZY D;  5BT1 C;  1P3A A;  2F8N K;  5CPJ B;  2PYO C;  4LD9 B;  5B40 B;  4E45 A;  2RVQ D;  3AZH B;  1P3M A;  5AV8 C;  2ARO C;  3MGR D;  1WWI A;  4JJN C;  5E5A A;  3AZJ C;  4NFT A;  5JRG B;  5CP6 C;  4YS3 D;  4CAY B;  5B32 D;  4WU8 A;  1P34 D;  3C1B C;  5B33 B;  2CV5 D;  1ZLA C;  1M19 D;  3REI C;  3X1S C;  1TZY B;  3W96 A;  5FUG B;  3W98 C;  3UT9 C;  2Y2N A;  3LZ0 B;  5B24 A;  3X1V C;  4J8X C;  3NQU B;  4G92 B;  5B2J D;  3LEL C;  3X1T C;  2HUE C;  2FJ7 A;  3KUY D;  5KDM A;  3MGR B;  5AV6 C;  4YS3 B;  5CPI C;  1M1A C;  2ZY2 A;  1P34 B;  2HIO C;  5GSU A;  2CV5 B;  5CPK D;  3AZK A;  1F66 D;  1HQ3 A;  1P3K D;  2F8N D;  5F99 A;  3W97 A;  2ZM5 A;  3AZE D;  1JFI A;  5CHL B;  3LZ1 D;  3B0B A;  4WV4 B;  1N1J A;  5B2J B;  3UTA D;  2JCH A;  1KU5 A;  3KUY B;  3VH5 T;  2RVQ C;  4QLC D;  3UTB D;  5B31 C;  1BH9 B;  5C3I B;  3R45 B;  3KSY A;  5BNX B;  2F8N H;  5AV5 A;  4ZUX B;  5GT3 D;  5DNM C;  2F8N G;  1F66 B;  5B32 C;  4UUZ A;  3B6G C;  2F8N B;  3MGQ C;  4H9N A;  3WAA D;  3KWQ B;  1M19 C;  3X1U C;  2NZD D;  2F2A C;  3LZ1 B;  1S32 A;  3B0C T;  4CSR A;  3UTA B;  1AOI C;  3AN2 D;  3EPJ A;  5AV6 A;  5B0Z A;  1P3G B;  5BNV B;  2J8P A;  3MGS C;  4QLC B;  4ZBJ C;  4XUJ D;  3MNN C;  3AZG D;  1M18 A;  3B6F D;  1KX4 A;  3REL A;  1U35 B;  2Y2I A;  2VQR A;  1KX3 A;  5GT3 B;  4HGA C;  3AZF A;  5CPK C;  3W99 A;  5DNN C;  4WU8 D;  3WAA B;  1P3K C;  4DQY B;  2NZD B;  2YFV B;  3KXB A;  3AZE C;  3C1C B;  5B31 A;  2IO5 B;  5B24 D;  1KX5 A;  3AZI A;  3AV1 D;  3VH5 A;  3AZG B;  3AV2 D;  3AYW C;  3B6F B;  5GXQ C;  3UTB C;  1P3M B;  3B6G A;  4J8V C;  3MGQ A;  5AV9 C;  1TAF A;  5E5A B;  3REJ A;  3REK A;  3AZN C;  4WU8 B;  3MGP C;  4KUD A;  3B0D C;  4Z66 A;  3AZK D;  1HQ3 D;  3AZM A;  3WAA C;  4J8U C;  5B1M A;  5F99 D;  3W97 D;  4G91 C;  3W96 B;  3MGS A;  3WA9 C;  1P3L C;  4KGC C;  3LJA C;  5B24 B;  4Z2M H;  5B2I A;  1P3B C;  3AN2 C;  3AV1 B;  4Z2M G;  3AV2 B;  4YM6 C;  2FJ7 B;  4H9P A;  4XUJ C;  5AY8 D;  5KDM B;  3AFA A;  1EQZ A;  5AV5 D;  5GSU B;  3REH C;  3A6N C;  5B1L C;  3AZK B;  1HQ3 B;  3AZL C;  4R8P C;  5AVB C;  5F99 B;  2YFW A;  1P3I C;  3W97 B;  3MVD D;  1P3O C;  3LZ0 D;  4J8W A;  1JFI B;  1P3F D;  3EPH A;  5AVC D;  3WKJ A;  5B0Y A;  3WTP A;  1N1J B;  4WU9 A;  5AY8 B;  3AV2 C;  3MGP A;  1M18 D;  3VH6 W;  1KX4 D;  5G49 A;  5AV5 B;  3P5J B;  3WA9 A;  4X23 A;  3O62 A;  3NQJ A;  3AZF D;  3W99 D;  4H9N B;  3MVD B;  1P3B A;  2NQB C;  4XZQ D;  2G5H C;  2JE5 A;  1P3F B;  5AVC B;  1S32 B;  2Y2Q A;  5CPJ C;  4LD9 C;  5B40 C;  1P3P D;  1KX5 D;  5GT0 A;  5B0Z B;  3AZH C;  1ID3 A;  1M18 B;  3AZL A;  4DRB A;  4ZUX D;  5AVB A;  3REL B;  1KX4 B;  4WJ3 C;  5JRG C;  1KX3 B;  1A7W A;  3H0M C;  1P3O A;  3REJ D;  3REK D;  5B33 C;  2JSS A;  2PYO A;  3KWQ D;  3AZF B;  3W99 B;  4Z5T D;  4XZQ B;  4Z66 D;  1TZY C;  3AZM D;  5B31 G;  5AV8 A;  3KXB B;  5B1M D;  2ARO A;  3LZ0 C;  4JJN A;  3TU4 D;  3AZJ A;  4G92 C;  1P3P B;  5CP6 A;  1BH8 A; 
#chains in the Genus database with same CATH homology
 5JA4 A;  3C1B A;  5B2I D;  3AZI B;  1ZLA A;  4WNN A;  4H9Q A;  3MGR C;  1U35 D;  3REI A;  3X1S A;  4YS3 C;  4H9O A;  3AFA D;  1P34 C;  1TAF B;  2BYK A;  3W98 A;  3REJ B;  3REK B;  3UT9 A;  2CV5 C;  3X1V A;  1WWS A;  4J8X A;  4KUD B;  3LEL A;  1B6W A;  4Z5T B;  4Z66 B;  3X1T A;  3AZM B;  5B40 A;  3C1C D;  1PZR A;  5B1M B;  4EO5 B;  4XZQ C;  3TU4 B;  1P3A D;  4J8W D;  5B2J C;  5CPI A;  1M1A A;  1Z2C B;  2HIO A;  5B2I B;  5B0Y D;  1R4V A;  3KUY C;  4WU9 D;  1P3M D;  2BYM A;  5C3I C;  4H9P B;  5E5A D;  3AFA B;  4ZUX C;  1F66 C;  1EQZ B;  3KWQ C;  4X23 D;  3W96 D;  3LZ1 C;  3EG5 B;  1HTA A;  1P3A B;  4J8W B;  3UTA C;  5DNM A;  5B0Y B;  3WTP B;  1P3G C;  5B32 A;  2FJ7 D;  4QLC C;  4WU9 B;  2CV5 A;  5GT0 D;  4H9S C;  1ID3 D;  5BS7 C;  1U35 C;  1M19 A;  3X1U A;  5GT3 C;  4KHA A;  2ZY4 A;  5GSU D;  5G49 B;  5BT1 D;  1AOI A;  4X23 B;  3O62 B;  3NQJ B;  5B2J A;  3A1I A;  2PYO D;  2NZD C;  2BG1 A;  2ZY5 A;  3MNN A;  3C1C C;  4AWL B;  2ARO D;  2IO5 C;  3AZJ D;  5CP6 D;  3AZG C;  3H0R C;  5CPK A;  5DNN A;  5GT0 B;  3B6F C;  3C1B D;  1P3K A;  1ID3 B;  1P3M C;  1ZLA D;  3EPL A;  3AZE A;  5E5A C;  3REI D;  3X1S D;  4WU8 C;  3F6T A;  3UT9 D;  3X1V D;  4J8X D;  2PYO B;  3LEL D;  3AYW A;  1S32 D;  3W96 C;  2DQN C;  5GXQ A;  3UTB A;  5BO0 A;  5AV8 B;  4J8V A;  2ARO B;  5AV9 A;  5B24 C;  3AZJ B;  3AV1 C;  3AZN A;  5AV6 D;  5CP6 B;  5B0Z D;  5CPI D;  2Y2K A;  1M1A D;  1BH8 B;  5JA4 B;  3C1B B;  2FJ7 C;  1ZLA B;  4WNN B;  4H9Q B;  4E44 A;  4J8U A;  3REL D;  3WAA A;  1KX3 D;  3REI B;  3X1S B;  3VH6 A;  4H9O B;  4UUZ B;  1P3L A;  5GSU C;  2BYK B;  3W98 B;  4KGC A;  3UT9 B;  3LJA A;  1F1E A;  3AZK C;  3X1V B;  1HQ3 C;  4J8X B;  3V9R A;  3AN2 A;  5F99 C;  3LEL B;  3W97 C;  2DF4 C;  3X1T B;  2HUE B;  4NE6 A;  2FFF B;  4CSR B;  4YM6 A;  1H3O A;  4XUJ A;  3KXB D;  3AZG A;  2RIQ A;  3B6F A;  5B31 D;  1BFM A;  5AV6 B;  5CPI B;  3AZI D;  1M1A B;  2HIO B;  5DNM D;  3A6N A;  3REH A;  5B1L A;  2XD5 A;  5AY8 C;  4R8P A;  2G5I C;  3B6G D;  2BYM B;  3MGQ D;  1P3I A;  3X1U D;  5AV5 C;  4NE3 A;  4KUD D;  1AOI D;  4NE5 A;  3MVD C;  3AV1 A;  3AV2 A;  1P3F C;  3MGS D;  5AVC C;  1S32 C;  5B31 B;  3MNN D;  1ULY A;  5B32 G;  2Y2G A;  5DNM B;  5B0Z C;  5B32 B;  1M18 C;  3B6G B;  3FDD A;  4H9R A;  3MGQ B;  5DNN D;  2NQB A;  1KX4 C;  3REL C;  1M19 B;  3X1U B;  1KX3 C;  4KHA B;  1B67 A;  1EQZ D;  2CWE A;  1T3U A;  2ZY3 A;  5CPJ A;  3AZF C;  4LD9 A;  3W99 C;  1AOI B;  1P3G D;  3AZH A;  3MGS B;  4ZBJ B;  3MNN B;  3KXB C;  5AY8 A;  3AYW D;  5GXQ D;  3WKJ D;  5JRG A;  3WTP D;  4J8V D;  1P3P C;  4CAY A;  5AV9 D;  1KX5 C;  1Q9C A;  3EPK A;  5B33 A;  3AZI C;  4HGA B;  3AZN D;  5CPK B;  2L5A A;  5DNN B;  3MGP D;  1P3K B;  1TZY A;  3MVD A;  5FUG A;  4J8U D;  3AZE B;  3REJ C;  3REK C;  3LZ0 A;  1P3F A;  5AVC A;  3WA9 D;  3NQU A;  3O62 D;  1P3L D;  4DRA A;  4KGC D;  4KUD C;  4Z5T C;  3LJA D;  2YFW B;  3H0L C;  4Z66 C;  1W2E A;  3AZM C;  1P3B D;  5B1M C;  4EO5 C;  3MGR A;  2UWX A;  3AYW B;  4YM6 D;  3TU4 C;  5GXQ B;  3WKJ B;  3UTB B;  5BO0 B;  4J8V B;  4YS3 A;  2Y2H A;  5AV9 B;  1P34 A;  5B2I C;  3AZN B;  1KX5 B;  3MGP B;  3REH D;  4M6B A;  3B0D B;  3IP4 C;  5B1L D;  3A6N D;  3AZL D;  4R8P D;  5AVB D;  3VH6 T;  4J8U B;  3AFA C;  3AL0 C;  4XZQ A;  1P3I D;  4G91 B;  1P3O D;  1EQZ C;  3WA9 B;  1P3L B;  4KGC B;  3LJA B;  3VH5 W;  2Y2O A;  3V9R B;  1P3B B;  3AN2 B;  3KUY A;  1P3P A;  4WZS B;  1BH9 A;  5AV8 D;  4YM6 B;  1P3A C;  1H3O B;  3R45 A;  4XUJ B;  4J8W C;  4JJN D;  5BNX A;  4ZUX A;  3WKJ C;  5B0Y C;  3WTP C;  1F66 A;  2W8S A;  4WU9 C;  3REH B;  2F8N A;  3A6N B;  5B1L B;  3KWQ A;  3AZL B;  4R8P B;  5AVB B;  3B0C W;  2Y2L A;  4Z5T A;  3LZ1 A;  1P3I B;  2Y2J A;  3A1K A;  1P3O B;  2NQB D;  3W98 D;  2XD1 A;  3UTA A;  2Y2P A;  3TU4 A;  4X23 C;  3O62 C;  1P3G A;  2LY8 A;  5CPJ D;  2Y2M A;  5BNV A;  3X1T D;  4QLC A;  5B40 D;  4LD9 D;  4H9S A;  4AWL C;  4JJN B;  5BS7 A;  3AZH D;  1U35 A;  3WTP E;  5GT3 A;  3KFU G;  2HIO D;  5JRG D;  5GT0 C;  4UPK A;  5B33 D;  1ID3 C;  2NZD A;  4H9R B;  2YFV A;  3C1C A;  2NQB B;  1TZY D;  5BT1 C;  1P3A A;  2F8N K;  5CPJ B;  2PYO C;  4LD9 B;  5B40 B;  4E45 A;  2RVQ D;  3AZH B;  1P3M A;  5AV8 C;  2ARO C;  3MGR D;  1WWI A;  4JJN C;  5E5A A;  3AZJ C;  4NFT A;  5JRG B;  5CP6 C;  4YS3 D;  4CAY B;  5B32 D;  4WU8 A;  1P34 D;  3C1B C;  5B33 B;  2CV5 D;  1ZLA C;  1M19 D;  3REI C;  3X1S C;  1TZY B;  3W96 A;  5FUG B;  3W98 C;  3UT9 C;  2Y2N A;  3LZ0 B;  5B24 A;  3X1V C;  4J8X C;  3NQU B;  4G92 B;  5B2J D;  3LEL C;  3X1T C;  2HUE C;  2FJ7 A;  3KUY D;  5KDM A;  3MGR B;  5AV6 C;  4YS3 B;  5CPI C;  1M1A C;  2ZY2 A;  1P34 B;  2HIO C;  5GSU A;  2CV5 B;  5CPK D;  3AZK A;  1F66 D;  1HQ3 A;  1P3K D;  2F8N D;  5F99 A;  3W97 A;  2ZM5 A;  3AZE D;  1JFI A;  5CHL B;  3LZ1 D;  3B0B A;  4WV4 B;  1N1J A;  5B2J B;  3UTA D;  2JCH A;  1KU5 A;  3KUY B;  3VH5 T;  2RVQ C;  4QLC D;  3UTB D;  5B31 C;  1BH9 B;  5C3I B;  3R45 B;  3KSY A;  5BNX B;  2F8N H;  5AV5 A;  4ZUX B;  5GT3 D;  5DNM C;  2F8N G;  1F66 B;  5B32 C;  4UUZ A;  3B6G C;  2F8N B;  3MGQ C;  4H9N A;  3WAA D;  3KWQ B;  1M19 C;  3X1U C;  2NZD D;  2F2A C;  3LZ1 B;  1S32 A;  3B0C T;  4CSR A;  3UTA B;  1AOI C;  3AN2 D;  3EPJ A;  5AV6 A;  5B0Z A;  1P3G B;  5BNV B;  2J8P A;  3MGS C;  4QLC B;  4ZBJ C;  4XUJ D;  3MNN C;  3AZG D;  1M18 A;  3B6F D;  1KX4 A;  3REL A;  1U35 B;  2Y2I A;  2VQR A;  1KX3 A;  5GT3 B;  4HGA C;  3AZF A;  5CPK C;  3W99 A;  5DNN C;  4WU8 D;  3WAA B;  1P3K C;  4DQY B;  2NZD B;  2YFV B;  3KXB A;  3AZE C;  3C1C B;  5B31 A;  2IO5 B;  5B24 D;  1KX5 A;  3AZI A;  3AV1 D;  3VH5 A;  3AZG B;  3AV2 D;  3AYW C;  3B6F B;  5GXQ C;  3UTB C;  1P3M B;  3B6G A;  4J8V C;  3MGQ A;  5AV9 C;  1TAF A;  5E5A B;  3REJ A;  3REK A;  3AZN C;  4WU8 B;  3MGP C;  4KUD A;  3B0D C;  4Z66 A;  3AZK D;  1HQ3 D;  3AZM A;  3WAA C;  4J8U C;  5B1M A;  5F99 D;  3W97 D;  4G91 C;  3W96 B;  3MGS A;  3WA9 C;  1P3L C;  4KGC C;  3LJA C;  5B24 B;  4Z2M H;  5B2I A;  1P3B C;  3AN2 C;  3AV1 B;  4Z2M G;  3AV2 B;  4YM6 C;  2FJ7 B;  4H9P A;  4XUJ C;  5AY8 D;  5KDM B;  3AFA A;  1EQZ A;  5AV5 D;  5GSU B;  3REH C;  3A6N C;  5B1L C;  3AZK B;  1HQ3 B;  3AZL C;  4R8P C;  5AVB C;  5F99 B;  2YFW A;  1P3I C;  3W97 B;  3MVD D;  1P3O C;  3LZ0 D;  4J8W A;  1JFI B;  1P3F D;  3EPH A;  5AVC D;  3WKJ A;  5B0Y A;  3WTP A;  1N1J B;  4WU9 A;  5AY8 B;  3AV2 C;  3MGP A;  1M18 D;  3VH6 W;  1KX4 D;  5G49 A;  5AV5 B;  3P5J B;  3WA9 A;  4X23 A;  3O62 A;  3NQJ A;  3AZF D;  3W99 D;  4H9N B;  3MVD B;  1P3B A;  2NQB C;  4XZQ D;  2G5H C;  2JE5 A;  1P3F B;  5AVC B;  1S32 B;  2Y2Q A;  5CPJ C;  4LD9 C;  5B40 C;  1P3P D;  1KX5 D;  5GT0 A;  5B0Z B;  3AZH C;  1ID3 A;  1M18 B;  3AZL A;  4DRB A;  4ZUX D;  5AVB A;  3REL B;  1KX4 B;  4WJ3 C;  5JRG C;  1KX3 B;  1A7W A;  3H0M C;  1P3O A;  3REJ D;  3REK D;  5B33 C;  2JSS A;  2PYO A;  3KWQ D;  3AZF B;  3W99 B;  4Z5T D;  4XZQ B;  4Z66 D;  1TZY C;  3AZM D;  5B31 G;  5AV8 A;  3KXB B;  5B1M D;  2ARO A;  3LZ0 C;  4JJN A;  3TU4 D;  3AZJ A;  4G92 C;  1P3P B;  5CP6 A;  1BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...