5BO0A

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
b'TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Chaperone/dna binding protein
source organism Homo sapiens
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bo0A00
3MGPC 1P3BB 4AWLB 3AZLD 4J8WB 4R8PD 5C3IC 3LZ0B 4J8UB 3AZFC 4H9QA 2NZDB 3AYWD 5B1LB 3AN2D 5B1MB 3AZLC 4WU9B 1TAFA 5GT0C 2YFVA 1ID3C 5BO0B 1AOID 4WZSB 1N1JA 4UUZB 3W99C 4X23D 5B2JA 5BNXB 3KUYB 2IO5C 4CSRB 4XZQC 4WNNA 2YFWB 3B6GD 5CPKC 4Z2MG 5AV5B 1H3OA 3REKD 5B0YB 5B0YC 5BNVA 1HQ3D 5B33D 2HIOC 3W99B 3AV2A 4KGCD 2PYOC 3NQJA 1P3LD 3O62B 3AZFD 1M1AD 5B24C 3KXBB 4Z2MH 1M19D 1HQ3C 5B33C 1P3OB 1AOIA 3AZLB 3AZGB 3UT9D 4WNNB 2F8NH 1M18D 4NE3A 3AFAB 2AROC 4J8VD 5B32G 1P3BC 4QLCC 2FJ7C 4H9RB 1R4VA 4YM6C 3MGPB 5CPKD 4G91B 3UT9C 1WWIA 5AY8C 5E5AD 4NFTA 4JJNB 5DNNC 4J8VC 3MGRC 5CPJA 5AV6C 3W97C 1P3LA 3MNNB 1P3FD 3AZFA 1S32D 2AROA 5B2IB 1P3PD 5JRGC 2FJ7A 2PYOD 1KX5A 3LZ1D 3UT9A 3MVDA 1M18A 4J8UA 3NQUA 4XZQB 3REID 5GSUA 4H9SC 1P3PC 3TU4B 5AV9A 1P3BA 3A6ND 5JA4A 3WTPC 3UTBD 2NQBA 3AFAA 5CPKA 5B1MC 1KX5C 3W96C 5AY8A 5B2JB 3X1VC 4YM6D 3X1UC 1KX4D 4J8UC 3B0CW 1ID3D 3A6NC 1P3FA 1S32A 4J8WC 3O62D 3KSYA 4CAYA 3W99D 5C3IB 4X23C 3AV2C 2PYOA 1KX5D 2NZDA 3C1CA 1TZYD 4HGAC 1M18C 3W96A 3X1VB 3AZHB 3C1BB 3AZKC 5GXQB 2NQBD 3AFAD 4G92C 1P3KC 3WKJC 2RVQD 3WTPA 4LD9C 5B32C 5B31G 4ZUXA 5BNXA 5E5AC 5AY8D 3KUYA 5DNND 3MGRD 3X1VA 1ID3A 2BYKB 5CP6D 3MGQC 3AZNB 1ZLAB 5B40C 1EQZA 3X1UD 5JRGD 1BH8A 5G49B 5F99B 4WU8A 5B1LA 3UTAC 1P3KA 4LD9A 5B0ZB 3O62C 1TZYA 5AVCC 4XUJC 5CP6C 3X1SD 3REJD 1ZLAA 5B0YA 3MGRB 5DNNB 4NE6A 2CV5A 5AY8B 1B6WA 1F66A 3AZEB 4DRBA 5GT3D 3WTPD 4Z66C 4J8XB 3KUYD 3WKJD 5AVBD 2NQBC 1P3MD 5CP6A 3X1UA 3AZGA 4WU8D 2BYMA 3MGSB 1A7WA 1BH9A 3MNNA 3LELB 3NQJB 3UTAD 3KWQC 5BS7C 4QLCB 3RELD 5CPJB 2CV5D 3B0DC 1P3AC 5B31B 3AV1D 3B6FD 1P3IB 5GXQA 1H3OB 3RELC 3TU4D 3REIB 2CWEA 5GSUB 2F8NB 3WA9D 1P34D 3W96B 5B31D 3AZGD 3MVDC 3MVDB 3V9RA 1P3OD 5B0ZC 3AZIB 4Z5TA 3VH5T 3AZMB 4WU8C 1P3PB 5B1LC 3UTAA 3RELA 3AZKD 1P34C 3WAAB 3V9RB 1U35C 1ZLAC 1P3GD 1P3AA 4JJND 5B24A 2F8ND 3MGPA 3WA9B 5B2IC 3X1TD 3AZMC 3REHB 5GXQC 3WKJB 5AV9B 3AZIC 4J8XA 4KHAA 3B0BA 5B31A 4XZQD 5KDMB 4JJNC 3UT9B 4G91C 1P3GB 2CV5B 3AZLA 4H9OA 3WAAD 4HGAB 3REHC 4QLCD 3RELB 3AYWC 3AN2C 2AROB 2FJ7B 1BFMA 3AZKA 3W98D 5B0ZD 5GT0D 3AZIA 3AZJA 1P3GA 3X1UB 1EQZB 1P34B 5B24D 2F8NA 3MGPD 3MGQA 5FUGA 5AV5A 4J8XD 1Q9CA 1P3IA 4KUDA 4H9NA 3WTPB 2HIOA 3LJAB 3B6GA 3WAAA 2HUEC 5CHLB 3W98A 5GT0A 5AV8D 1HQ3A 5B33A 1AOIC 4YS3C 5B1MD 1BH8B 4H9PA 5G49A 4Z5TC 3AZJD 5JRGB 4KUDC 4KGCA 5F99D 5CPJC 1ID3B 4E44A 3LZ0A 1U35A 3LELC 1M19A 4YM6B 5AV5D 3REKB 4KUDD 1P3IC 2HIOD 5FUGB 4X23B 4J8VA 3MGQB 1U35B 3WAAC 4R8PA 1KU5A 3X1SB 5DNMC 3REJB 5AV8A 5CPIC 5E5AA 1KX5B 5B1MA 1JFIA 1BH9B 4YS3A 1P3KB 4LD9B 1KX4C 4CAYB 3W98B 3REKC 3C1BC 3AZHC 4EO5B 2AROD 1P3PA 2FJ7D 3LZ0D 4R8PB 5CP6B 4XUJB 4Z5TB 1F1EA 3VH6T 3REIC 1JFIB 3LZ1A 5B2JD 3UTBB 3UTBC 5JA4B 4Z66B 1M1AC 3REKA 3X1TB 5AV9D 3A6NA 1P3FC 1KX3B 2RVQC 4R8PC 5B32B 1TZYB 4YS3D 3C1CB 4YM6A 3AV2D 1KX4A 5GT0B 5F99C 2JSSA 1M1AA 5B40B 3W99A 1EQZC 1B67A 3C1CD 3LZ0C 4ZUXB 3WTPE 4H9NB 3W96D 3B0CT 1P3MB 3A6NB 1KX3A 5AV6B 3W97B 2CV5C 4KUDB 3NQUB 4ZUXD 5AV9C 1M18B 2LY8A 5CPJD 3UTAB 3LELD 1TAFB 5AV5C 3AZJB 1P3KD 3AZGC 1S32C 4LD9D 3MVDD 2L5AA 5E5AB 5B2JC 4J8UD 1HQ3B 5B33B 1P3OC 3X1SA 3REIA 3REJA 5GSUD 5B0YD 4J8WD 3MNNC 1KX3D 1P3BD 4WV4B 5DNMD 3UTBA 5AVBB 3VH6W 5GT3A 3B6FC 5AV6A 3W97A 3VH5A 3C1BD 3AZHD 5GSUC 4DRAA 3WKJA 1P3MA 3LELA 1M19C 1M19B 3AFAC 3O62A 4AWLC 4ZBJC 1P3AB 3AYWB 3AN2B 4H9QB 4M6BA 2NZDD 5AV8B 4H9PB 3B0DB 4EO5C 5B40A 4H9SA 4J8WA 1HTAA 3VH5W 5BNVB 1P3MC 3MGSC 1TZYC 5DNMA 4H9OB 2NZDC 3VH6A 3TU4C 4CSRA 2HIOB 3R45B 3B6FA 5AV6D 4ZBJB 5AVCD 3C1BA 3X1TC 3AZHA 5GT3B 3W97D 5GXQD 5DNNA 3AZED 2NQBB 3MGRA 3X1VD 4Z66A 5BO0A 3KXBC 5B24B 1P34A 1EQZD 3WA9A 5JRGA 3C1CC 5BT1C 4WU9D 5B1LD 4E45A 3AZEC 5B40D 1ULYA 1ZLAD 5B2IA 1KX4B 3AZMA 2BYMB 3MGSA 1F66D 5B32A 4ZUXC 5B31C 4JJNA 3KWQA 5CPKB 2HUEB 5AVCA 2IO5B 4KHAB 5AVBA 3X1TA 3AZEA 4Z66D 3REHA 1F66C 3KWQB 3LZ1B 4WU9A 2PYOB 5CPIB 4G92B 4XUJA 3AZKB 3B6GC 3KXBD 2F8NG 3AZFB 3MNND 1P3FB 4QLCA 1KX3C 5B2ID 5AV8C 3AZMD 5B0ZA 2BYKA 4YS3B 3MGSD 3AZID 3AV2B 5B32D 5CPID 5KDMA 3KWQD 3AV1A 3AZNA 4J8XC 4KGCC 4H9RA 3KUYC 3MGQD 5BS7A 1P3LC 3TU4A 5AVBC 3REHD 5AVCB 3LJAA 3B6GB 3R45A 3B6FB 1P3ID 3W98C 3AV1B 5BT1D 4WU9C 1P3OA 1AOIB 1N1JB 4UUZA 4XUJD 3REJC 3KXBA 3X1SC 1F66B 3AZNC 3WA9C 1WWSA 4Z5TD 3AZJC 1P3LB 2F8NK 1M1AB 1S32B 4KGCB 2YFVB 5GT3C 3LJAC 5CPIA 3AYWA 3AN2A 1P3AD 5F99A 4WU8B 3AZND 3AV1C 1U35D 1P3GC 2YFWA 3LJAD 4X23A 4J8VB 4XZQA 4NE5A 3LZ1C 5DNMB
chains in the Genus database with same CATH superfamily
3MGPC 1P3BB 4AWLB 3AZLD 4J8WB 2Y2QA 4R8PD 5C3IC 3LZ0B 4J8UB 3KFUG 3AZFC 4H9QA 2NZDB 3AYWD 5B1LB 3AN2D 5B1MB 3AZLC 4WU9B 1TAFA 5GT0C 2YFVA 1ID3C 5BO0B 1AOID 4WZSB 1N1JA 4UUZB 3W99C 4X23D 5B2JA 5BNXB 3KUYB 2IO5C 4CSRB 4XZQC 4WNNA 2YFWB 3B6GD 5CPKC 4Z2MG 5AV5B 1H3OA 3REKD 5B0YB 5B0YC 5BNVA 1HQ3D 5B33D 2HIOC 3W99B 3AV2A 4KGCD 2PYOC 3NQJA 1P3LD 3O62B 3AZFD 1M1AD 3EPHA 5B24C 3KXBB 4Z2MH 1M19D 1HQ3C 5B33C 1P3OB 1AOIA 3AZLB 3AZGB 3UT9D 4WNNB 2F8NH 3FDDA 1M18D 4NE3A 3AFAB 2AROC 4J8VD 5B32G 1P3BC 4QLCC 2FJ7C 4H9RB 1R4VA 4YM6C 1PZRA 3MGPB 5CPKD 4G91B 3UT9C 1WWIA 5AY8C 5E5AD 4NFTA 4JJNB 5DNNC 4J8VC 3MGRC 5CPJA 5AV6C 3W97C 1P3LA 3MNNB 1P3FD 3AZFA 1S32D 2AROA 5B2IB 1P3PD 5JRGC 2FJ7A 2PYOD 1KX5A 3LZ1D 1Z2CB 3UT9A 3MVDA 1M18A 4J8UA 3NQUA 4XZQB 3REID 2Y2IA 4H9SC 5GSUA 1P3PC 3TU4B 5AV9A 1P3BA 3A6ND 5JA4A 3WTPC 3UTBD 2NQBA 3AFAA 5CPKA 5B1MC 1KX5C 3W96C 5AY8A 5B2JB 3X1VC 4YM6D 3X1UC 1KX4D 4J8UC 3B0CW 1ID3D 3A6NC 1P3FA 1S32A 4J8WC 4UPKA 3O62D 3KSYA 4CAYA 3W99D 5C3IB 4X23C 3AV2C 3EG5B 2PYOA 1KX5D 2NZDA 3C1CA 2DF4C 1TZYD 4HGAC 1M18C 3W96A 3X1VB 3AZHB 3C1BB 3AZKC 5GXQB 2NQBD 3AFAD 4G92C 1P3KC 3WKJC 2RVQD 3WTPA 4LD9C 2ZY4A 5B32C 5B31G 4ZUXA 5BNXA 5AY8D 5E5AC 2G5HC 3KUYA 5DNND 3MGRD 3X1VA 1ID3A 2BYKB 5CP6D 3MGQC 3AZNB 1ZLAB 5B40C 1EQZA 3X1UD 5JRGD 1BH8A 5G49B 5F99B 4WU8A 5B1LA 3UTAC 1P3KA 4LD9A 5B0ZB 3O62C 1TZYA 5AVCC 4XUJC 5CP6C 3X1SD 3REJD 1ZLAA 5B0YA 3MGRB 2FFFB 5DNNB 4NE6A 2CV5A 5AY8B 1B6WA 1F66A 3AZEB 4DRBA 2RIQA 5GT3D 3WTPD 2ZM5A 4Z66C 4J8XB 3KUYD 3WKJD 5AVBD 2NQBC 1P3MD 5CP6A 3X1UA 3AZGA 4WU8D 2BYMA 3MGSB 1A7WA 1BH9A 3MNNA 3LELB 3NQJB 3A1KA 3UTAD 3KWQC 5BS7C 4QLCB 3RELD 5CPJB 2CV5D 3B0DC 1P3AC 5B31B 3AV1D 3B6FD 1P3IB 5GXQA 1H3OB 3RELC 3TU4D 3REIB 2CWEA 2UWXA 5GSUB 2F8NB 3WA9D 1P34D 3W96B 5B31D 2VQRA 3AZGD 3MVDC 3MVDB 3V9RA 1P3OD 5B0ZC 3AZIB 2JE5A 4Z5TA 3VH5T 3AZMB 4WU8C 1P3PB 5B1LC 3UTAA 3RELA 3AZKD 3EPJA 1P34C 3WAAB 3V9RB 1U35C 1ZLAC 1P3GD 1P3AA 4JJND 5B24A 2F8ND 3MGPA 3WA9B 5B2IC 3X1TD 3AZMC 3REHB 5GXQC 3WKJB 5AV9B 3AZIC 4J8XA 4KHAA 3B0BA 5B31A 4XZQD 5KDMB 4JJNC 2JCHA 4G91C 3UT9B 1P3GB 2CV5B 2Y2GA 4H9OA 3AZLA 3WAAD 4HGAB 3REHC 4QLCD 3RELB 3AYWC 3AN2C 2AROB 2FJ7B 1BFMA 3AZKA 3W98D 5B0ZD 5GT0D 3AZIA 3AL0C 3AZJA 1P3GA 3X1UB 2J8PA 1EQZB 1P34B 5B24D 2F8NA 3MGPD 2Y2HA 3MGQA 5FUGA 5AV5A 4J8XD 1Q9CA 1P3IA 4KUDA 4H9NA 3WTPB 2HIOA 3LJAB 3B6GA 2Y2LA 3WAAA 2HUEC 5CHLB 3W98A 5GT0A 5AV8D 1HQ3A 5B33A 1AOIC 4YS3C 5B1MD 1BH8B 4H9PA 5G49A 4Z5TC 3AZJD 5JRGB 4KUDC 4KGCA 5F99D 5CPJC 1ID3B 4E44A 3LZ0A 1U35A 3LELC 1M19A 4YM6B 5AV5D 3REKB 4KUDD 1P3IC 2HIOD 1W2EA 5FUGB 4X23B 4J8VA 3MGQB 1U35B 3WAAC 4R8PA 1KU5A 3X1SB 5DNMC 3REJB 5AV8A 5CPIC 5E5AA 2ZY3A 1KX5B 5B1MA 1JFIA 1BH9B 4YS3A 1P3KB 4LD9B 1KX4C 4CAYB 3W98B 3REKC 3C1BC 2F2AC 3AZHC 4EO5B 2AROD 3H0LC 1P3PA 4R8PB 3LZ0D 2FJ7D 5CP6B 4XUJB 4Z5TB 1F1EA 3VH6T 3REIC 1JFIB 3LZ1A 5B2JD 3UTBB 3UTBC 5JA4B 4Z66B 1M1AC 3REKA 3X1TB 5AV9D 3A6NA 1P3FC 1KX3B 2RVQC 4R8PC 5B32B 1TZYB 4YS3D 3C1CB 4YM6A 3AV2D 1KX4A 5GT0B 5F99C 2JSSA 1M1AA 5B40B 3W99A 1EQZC 1B67A 3C1CD 3LZ0C 4ZUXB 3WTPE 4H9NB 3W96D 3B0CT 1P3MB 3A6NB 1KX3A 5AV6B 3W97B 2CV5C 4KUDB 3IP4C 3NQUB 4ZUXD 5AV9C 1M18B 2DQNC 2LY8A 2XD1A 5CPJD 1T3UA 3UTAB 2Y2PA 3LELD 1TAFB 5AV5C 3AZJB 1P3KD 3AZGC 1S32C 4LD9D 3MVDD 2L5AA 5E5AB 5B2JC 4J8UD 1HQ3B 5B33B 1P3OC 3X1SA 3REIA 3REJA 5GSUD 5B0YD 4J8WD 3F6TA 4WJ3C 3MNNC 1KX3D 1P3BD 2G5IC 4WV4B 5DNMD 2ZY5A 5AVBB 3UTBA 3VH6W 5GT3A 3H0MC 3B6FC 5AV6A 3W97A 3VH5A 3C1BD 3AZHD 5GSUC 4DRAA 3WKJA 3A1IA 1P3MA 3LELA 1M19C 1M19B 3AFAC 3O62A 4AWLC 4ZBJC 1P3AB 3AYWB 3AN2B 4H9QB 4M6BA 2NZDD 5AV8B 4H9PB 3B0DB 4EO5C 5B40A 4H9SA 4J8WA 1HTAA 3VH5W 5BNVB 1P3MC 3MGSC 3EPLA 1TZYC 5DNMA 4H9OB 2NZDC 3VH6A 3TU4C 4CSRA 2HIOB 3R45B 3B6FA 5AV6D 4ZBJB 5AVCD 3C1BA 3X1TC 3AZHA 5GT3B 3W97D 5GXQD 5DNNA 3AZED 2NQBB 3MGRA 3X1VD 4Z66A 5BO0A 5B24B 3KXBC 1P34A 1EQZD 2Y2KA 3WA9A 5JRGA 3C1CC 5BT1C 4WU9D 2W8SA 3H0RC 5B1LD 4E45A 3AZEC 5B40D 1ULYA 1ZLAD 5B2IA 1KX4B 3AZMA 2BYMB 3MGSA 1F66D 4DQYB 5B32A 4ZUXC 5B31C 4JJNA 3KWQA 5CPKB 2HUEB 5AVCA 3EPKA 2IO5B 4KHAB 5AVBA 3X1TA 3AZEA 4Z66D 3REHA 1F66C 3KWQB 3LZ1B 4WU9A 2Y2MA 2PYOB 5CPIB 3P5JB 4G92B 4XUJA 3AZKB 3B6GC 3KXBD 2F8NG 3AZFB 3MNND 1P3FB 4QLCA 1KX3C 5B2ID 5AV8C 3AZMD 5B0ZA 2BYKA 4YS3B 3MGSD 2BG1A 3AZID 3AV2B 5B32D 5CPID 5KDMA 2Y2NA 3KWQD 3AV1A 3AZNA 4J8XC 4KGCC 4H9RA 2XD5A 3KUYC 3MGQD 5BS7A 1P3LC 3TU4A 5AVBC 2Y2JA 3REHD 5AVCB 3LJAA 3B6GB 3R45A 3B6FB 1P3ID 3W98C 3AV1B 5BT1D 4WU9C 1P3OA 1AOIB 1N1JB 4UUZA 4XUJD 3REJC 3KXBA 3X1SC 1F66B 2Y2OA 3AZNC 3WA9C 1WWSA 4Z5TD 3AZJC 1P3LB 2F8NK 1M1AB 1S32B 4KGCB 2YFVB 5GT3C 3LJAC 2ZY2A 5CPIA 3AYWA 3AN2A 1P3AD 4WU8B 5F99A 3AZND 3AV1C 1U35D 1P3GC 2YFWA 3LJAD 4X23A 4J8VB 4XZQA 4NE5A 3LZ1C 5DNMB
chains in the Genus database with same CATH topology
3MGPC 1P3BB 4AWLB 3AZLD 4J8WB 2Y2QA 4R8PD 5C3IC 3LZ0B 4J8UB 3KFUG 3AZFC 4H9QA 2NZDB 3AYWD 5B1LB 3AN2D 5B1MB 3AZLC 4WU9B 1TAFA 5GT0C 2YFVA 1ID3C 5BO0B 1AOID 4WZSB 1N1JA 4UUZB 3W99C 4X23D 5B2JA 5BNXB 3KUYB 2IO5C 4CSRB 4XZQC 4WNNA 2YFWB 3B6GD 5CPKC 4Z2MG 5AV5B 1H3OA 3REKD 5B0YB 5B0YC 5BNVA 1HQ3D 5B33D 2HIOC 3W99B 3AV2A 4KGCD 2PYOC 3NQJA 1P3LD 3O62B 3AZFD 1M1AD 3EPHA 5B24C 3KXBB 4Z2MH 1M19D 1HQ3C 5B33C 1P3OB 1AOIA 3AZLB 3AZGB 3UT9D 4WNNB 2F8NH 3FDDA 1M18D 4NE3A 3AFAB 2AROC 4J8VD 5B32G 1P3BC 4QLCC 2FJ7C 4H9RB 1R4VA 4YM6C 1PZRA 3MGPB 5CPKD 4G91B 3UT9C 1WWIA 5AY8C 5E5AD 4NFTA 4JJNB 5DNNC 4J8VC 3MGRC 5CPJA 5AV6C 3W97C 1P3LA 3MNNB 1P3FD 3AZFA 1S32D 2AROA 5B2IB 1P3PD 5JRGC 2FJ7A 2PYOD 1KX5A 3LZ1D 1Z2CB 3UT9A 3MVDA 1M18A 4J8UA 3NQUA 4XZQB 3REID 2Y2IA 4H9SC 5GSUA 1P3PC 3TU4B 5AV9A 1P3BA 3A6ND 5JA4A 3WTPC 3UTBD 2NQBA 3AFAA 5CPKA 5B1MC 1KX5C 3W96C 5AY8A 5B2JB 3X1VC 4YM6D 3X1UC 1KX4D 4J8UC 3B0CW 1ID3D 3A6NC 1P3FA 1S32A 4J8WC 4UPKA 3O62D 3KSYA 4CAYA 3W99D 5C3IB 4X23C 3AV2C 3EG5B 2PYOA 1KX5D 2NZDA 3C1CA 2DF4C 1TZYD 4HGAC 1M18C 3W96A 3X1VB 3AZHB 3C1BB 3AZKC 5GXQB 2NQBD 3AFAD 4G92C 1P3KC 3WKJC 2RVQD 3WTPA 4LD9C 2ZY4A 5B32C 5B31G 4ZUXA 5BNXA 5AY8D 5E5AC 2G5HC 3KUYA 5DNND 3MGRD 3X1VA 1ID3A 2BYKB 5CP6D 3MGQC 3AZNB 1ZLAB 5B40C 1EQZA 3X1UD 5JRGD 1BH8A 5G49B 5F99B 4WU8A 5B1LA 3UTAC 1P3KA 4LD9A 5B0ZB 3O62C 1TZYA 5AVCC 4XUJC 5CP6C 3X1SD 3REJD 1ZLAA 5B0YA 3MGRB 2FFFB 5DNNB 4NE6A 2CV5A 5AY8B 1B6WA 1F66A 3AZEB 4DRBA 2RIQA 5GT3D 3WTPD 2ZM5A 4Z66C 4J8XB 3KUYD 3WKJD 5AVBD 2NQBC 1P3MD 5CP6A 3X1UA 3AZGA 4WU8D 2BYMA 3MGSB 1A7WA 1BH9A 3MNNA 3LELB 3NQJB 3A1KA 3UTAD 3KWQC 5BS7C 4QLCB 3RELD 5CPJB 2CV5D 3B0DC 1P3AC 5B31B 3AV1D 3B6FD 1P3IB 5GXQA 1H3OB 3RELC 3TU4D 3REIB 2CWEA 2UWXA 5GSUB 2F8NB 3WA9D 1P34D 3W96B 5B31D 2VQRA 3AZGD 3MVDC 3MVDB 3V9RA 1P3OD 5B0ZC 3AZIB 2JE5A 4Z5TA 3VH5T 3AZMB 4WU8C 1P3PB 5B1LC 3UTAA 3RELA 3AZKD 3EPJA 1P34C 3WAAB 3V9RB 1U35C 1ZLAC 1P3GD 1P3AA 4JJND 5B24A 2F8ND 3MGPA 3WA9B 5B2IC 3X1TD 3AZMC 3REHB 5GXQC 3WKJB 5AV9B 3AZIC 4J8XA 4KHAA 3B0BA 5B31A 4XZQD 5KDMB 4JJNC 2JCHA 4G91C 3UT9B 1P3GB 2CV5B 2Y2GA 4H9OA 3AZLA 3WAAD 4HGAB 3REHC 4QLCD 3RELB 3AYWC 3AN2C 2AROB 2FJ7B 1BFMA 3AZKA 3W98D 5B0ZD 5GT0D 3AZIA 3AL0C 3AZJA 1P3GA 3X1UB 2J8PA 1EQZB 1P34B 5B24D 2F8NA 3MGPD 2Y2HA 3MGQA 5FUGA 5AV5A 4J8XD 1Q9CA 1P3IA 4KUDA 4H9NA 3WTPB 2HIOA 3LJAB 3B6GA 2Y2LA 3WAAA 2HUEC 5CHLB 3W98A 5GT0A 5AV8D 1HQ3A 5B33A 1AOIC 4YS3C 5B1MD 1BH8B 4H9PA 5G49A 4Z5TC 3AZJD 5JRGB 4KUDC 4KGCA 5F99D 5CPJC 1ID3B 4E44A 3LZ0A 1U35A 3LELC 1M19A 4YM6B 5AV5D 3REKB 4KUDD 1P3IC 2HIOD 1W2EA 5FUGB 4X23B 4J8VA 3MGQB 1U35B 3WAAC 4R8PA 1KU5A 3X1SB 5DNMC 3REJB 5AV8A 5CPIC 5E5AA 2ZY3A 1KX5B 5B1MA 1JFIA 1BH9B 4YS3A 1P3KB 4LD9B 1KX4C 4CAYB 3W98B 3REKC 3C1BC 2F2AC 3AZHC 4EO5B 2AROD 3H0LC 1P3PA 4R8PB 3LZ0D 2FJ7D 5CP6B 4XUJB 4Z5TB 1F1EA 3VH6T 3REIC 1JFIB 3LZ1A 5B2JD 3UTBB 3UTBC 5JA4B 4Z66B 1M1AC 3REKA 3X1TB 5AV9D 3A6NA 1P3FC 1KX3B 2RVQC 4R8PC 5B32B 1TZYB 4YS3D 3C1CB 4YM6A 3AV2D 1KX4A 5GT0B 5F99C 2JSSA 1M1AA 5B40B 3W99A 1EQZC 1B67A 3C1CD 3LZ0C 4ZUXB 3WTPE 4H9NB 3W96D 3B0CT 1P3MB 3A6NB 1KX3A 5AV6B 3W97B 2CV5C 4KUDB 3IP4C 3NQUB 4ZUXD 5AV9C 1M18B 2DQNC 2LY8A 2XD1A 5CPJD 1T3UA 3UTAB 2Y2PA 3LELD 1TAFB 5AV5C 3AZJB 1P3KD 3AZGC 1S32C 4LD9D 3MVDD 2L5AA 5E5AB 5B2JC 4J8UD 1HQ3B 5B33B 1P3OC 3X1SA 3REIA 3REJA 5GSUD 5B0YD 4J8WD 3F6TA 4WJ3C 3MNNC 1KX3D 1P3BD 2G5IC 4WV4B 5DNMD 2ZY5A 5AVBB 3UTBA 3VH6W 5GT3A 3H0MC 3B6FC 5AV6A 3W97A 3VH5A 3C1BD 3AZHD 5GSUC 4DRAA 3WKJA 3A1IA 1P3MA 3LELA 1M19C 1M19B 3AFAC 3O62A 4AWLC 4ZBJC 1P3AB 3AYWB 3AN2B 4H9QB 4M6BA 2NZDD 5AV8B 4H9PB 3B0DB 4EO5C 5B40A 4H9SA 4J8WA 1HTAA 3VH5W 5BNVB 1P3MC 3MGSC 3EPLA 1TZYC 5DNMA 4H9OB 2NZDC 3VH6A 3TU4C 4CSRA 2HIOB 3R45B 3B6FA 5AV6D 4ZBJB 5AVCD 3C1BA 3X1TC 3AZHA 5GT3B 3W97D 5GXQD 5DNNA 3AZED 2NQBB 3MGRA 3X1VD 4Z66A 5BO0A 5B24B 3KXBC 1P34A 1EQZD 2Y2KA 3WA9A 5JRGA 3C1CC 5BT1C 4WU9D 2W8SA 3H0RC 5B1LD 4E45A 3AZEC 5B40D 1ULYA 1ZLAD 5B2IA 1KX4B 3AZMA 2BYMB 3MGSA 1F66D 4DQYB 5B32A 4ZUXC 5B31C 4JJNA 3KWQA 5CPKB 2HUEB 5AVCA 3EPKA 2IO5B 4KHAB 5AVBA 3X1TA 3AZEA 4Z66D 3REHA 1F66C 3KWQB 3LZ1B 4WU9A 2Y2MA 2PYOB 5CPIB 3P5JB 4G92B 4XUJA 3AZKB 3B6GC 3KXBD 2F8NG 3AZFB 3MNND 1P3FB 4QLCA 1KX3C 5B2ID 5AV8C 3AZMD 5B0ZA 2BYKA 4YS3B 3MGSD 2BG1A 3AZID 3AV2B 5B32D 5CPID 5KDMA 2Y2NA 3KWQD 3AV1A 3AZNA 4J8XC 4KGCC 4H9RA 2XD5A 3KUYC 3MGQD 5BS7A 1P3LC 3TU4A 5AVBC 2Y2JA 3REHD 5AVCB 3LJAA 3B6GB 3R45A 3B6FB 1P3ID 3W98C 3AV1B 5BT1D 4WU9C 1P3OA 1AOIB 1N1JB 4UUZA 4XUJD 3REJC 3KXBA 3X1SC 1F66B 2Y2OA 3AZNC 3WA9C 1WWSA 4Z5TD 3AZJC 1P3LB 2F8NK 1M1AB 1S32B 4KGCB 2YFVB 5GT3C 3LJAC 2ZY2A 5CPIA 3AYWA 3AN2A 1P3AD 4WU8B 5F99A 3AZND 3AV1C 1U35D 1P3GC 2YFWA 3LJAD 4X23A 4J8VB 4XZQA 4NE5A 3LZ1C 5DNMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP C;  1P3B B;  4AWL B;  3AZL D;  4J8W B;  4R8P D;  5C3I C;  3LZ0 B;  4J8U B;  3AZF C;  4H9Q A;  2NZD B;  3AYW D;  5B1L B;  3AN2 D;  5B1M B;  3AZL C;  4WU9 B;  1TAF A;  5GT0 C;  2YFV A;  1ID3 C;  5BO0 B;  1AOI D;  4WZS B;  1N1J A;  4UUZ B;  3W99 C;  4X23 D;  5B2J A;  5BNX B;  3KUY B;  2IO5 C;  4CSR B;  4XZQ C;  4WNN A;  2YFW B;  3B6G D;  5CPK C;  4Z2M G;  5AV5 B;  1H3O A;  3REK D;  5B0Y B;  5B0Y C;  5BNV A;  1HQ3 D;  5B33 D;  2HIO C;  3W99 B;  3AV2 A;  4KGC D;  2PYO C;  3NQJ A;  1P3L D;  3O62 B;  3AZF D;  1M1A D;  5B24 C;  3KXB B;  4Z2M H;  1M19 D;  1HQ3 C;  5B33 C;  1P3O B;  1AOI A;  3AZL B;  3AZG B;  3UT9 D;  4WNN B;  2F8N H;  1M18 D;  4NE3 A;  3AFA B;  2ARO C;  4J8V D;  5B32 G;  1P3B C;  4QLC C;  2FJ7 C;  4H9R B;  1R4V A;  4YM6 C;  3MGP B;  5CPK D;  4G91 B;  3UT9 C;  1WWI A;  5AY8 C;  5E5A D;  4NFT A;  4JJN B;  5DNN C;  4J8V C;  3MGR C;  5CPJ A;  5AV6 C;  3W97 C;  1P3L A;  3MNN B;  1P3F D;  3AZF A;  1S32 D;  2ARO A;  5B2I B;  1P3P D;  5JRG C;  2FJ7 A;  2PYO D;  1KX5 A;  3LZ1 D;  3UT9 A;  3MVD A;  1M18 A;  4J8U A;  3NQU A;  4XZQ B;  3REI D;  5GSU A;  4H9S C;  1P3P C;  3TU4 B;  5AV9 A;  1P3B A;  3A6N D;  5JA4 A;  3WTP C;  3UTB D;  2NQB A;  3AFA A;  5CPK A;  5B1M C;  1KX5 C;  3W96 C;  5AY8 A;  5B2J B;  3X1V C;  4YM6 D;  3X1U C;  1KX4 D;  4J8U C;  3B0C W;  1ID3 D;  3A6N C;  1P3F A;  1S32 A;  4J8W C;  3O62 D;  3KSY A;  4CAY A;  3W99 D;  5C3I B;  4X23 C;  3AV2 C;  2PYO A;  1KX5 D;  2NZD A;  3C1C A;  1TZY D;  4HGA C;  1M18 C;  3W96 A;  3X1V B;  3AZH B;  3C1B B;  3AZK C;  5GXQ B;  2NQB D;  3AFA D;  4G92 C;  1P3K C;  3WKJ C;  2RVQ D;  3WTP A;  4LD9 C;  5B32 C;  5B31 G;  4ZUX A;  5BNX A;  5E5A C;  5AY8 D;  3KUY A;  5DNN D;  3MGR D;  3X1V A;  1ID3 A;  2BYK B;  5CP6 D;  3MGQ C;  3AZN B;  1ZLA B;  5B40 C;  1EQZ A;  3X1U D;  5JRG D;  1BH8 A;  5G49 B;  5F99 B;  4WU8 A;  5B1L A;  3UTA C;  1P3K A;  4LD9 A;  5B0Z B;  3O62 C;  1TZY A;  5AVC C;  4XUJ C;  5CP6 C;  3X1S D;  3REJ D;  1ZLA A;  5B0Y A;  3MGR B;  5DNN B;  4NE6 A;  2CV5 A;  5AY8 B;  1B6W A;  1F66 A;  3AZE B;  4DRB A;  5GT3 D;  3WTP D;  4Z66 C;  4J8X B;  3KUY D;  3WKJ D;  5AVB D;  2NQB C;  1P3M D;  5CP6 A;  3X1U A;  3AZG A;  4WU8 D;  2BYM A;  3MGS B;  1A7W A;  1BH9 A;  3MNN A;  3LEL B;  3NQJ B;  3UTA D;  3KWQ C;  5BS7 C;  4QLC B;  3REL D;  5CPJ B;  2CV5 D;  3B0D C;  1P3A C;  5B31 B;  3AV1 D;  3B6F D;  1P3I B;  5GXQ A;  1H3O B;  3REL C;  3TU4 D;  3REI B;  2CWE A;  5GSU B;  2F8N B;  3WA9 D;  1P34 D;  3W96 B;  5B31 D;  3AZG D;  3MVD C;  3MVD B;  3V9R A;  1P3O D;  5B0Z C;  3AZI B;  4Z5T A;  3VH5 T;  3AZM B;  4WU8 C;  1P3P B;  5B1L C;  3UTA A;  3REL A;  3AZK D;  1P34 C;  3WAA B;  3V9R B;  1U35 C;  1ZLA C;  1P3G D;  1P3A A;  4JJN D;  5B24 A;  2F8N D;  3MGP A;  3WA9 B;  5B2I C;  3X1T D;  3AZM C;  3REH B;  5GXQ C;  3WKJ B;  5AV9 B;  3AZI C;  4J8X A;  4KHA A;  3B0B A;  5B31 A;  4XZQ D;  5KDM B;  4JJN C;  3UT9 B;  4G91 C;  1P3G B;  2CV5 B;  3AZL A;  4H9O A;  3WAA D;  4HGA B;  3REH C;  4QLC D;  3REL B;  3AYW C;  3AN2 C;  2ARO B;  2FJ7 B;  1BFM A;  3AZK A;  3W98 D;  5B0Z D;  5GT0 D;  3AZI A;  3AZJ A;  1P3G A;  3X1U B;  1EQZ B;  1P34 B;  5B24 D;  2F8N A;  3MGP D;  3MGQ A;  5FUG A;  5AV5 A;  4J8X D;  1Q9C A;  1P3I A;  4KUD A;  4H9N A;  3WTP B;  2HIO A;  3LJA B;  3B6G A;  3WAA A;  2HUE C;  5CHL B;  3W98 A;  5GT0 A;  5AV8 D;  1HQ3 A;  5B33 A;  1AOI C;  4YS3 C;  5B1M D;  1BH8 B;  4H9P A;  5G49 A;  4Z5T C;  3AZJ D;  5JRG B;  4KUD C;  4KGC A;  5F99 D;  5CPJ C;  1ID3 B;  4E44 A;  3LZ0 A;  1U35 A;  3LEL C;  1M19 A;  4YM6 B;  5AV5 D;  3REK B;  4KUD D;  1P3I C;  2HIO D;  5FUG B;  4X23 B;  4J8V A;  3MGQ B;  1U35 B;  3WAA C;  4R8P A;  1KU5 A;  3X1S B;  5DNM C;  3REJ B;  5AV8 A;  5CPI C;  5E5A A;  1KX5 B;  5B1M A;  1JFI A;  1BH9 B;  4YS3 A;  1P3K B;  4LD9 B;  1KX4 C;  4CAY B;  3W98 B;  3REK C;  3C1B C;  3AZH C;  4EO5 B;  2ARO D;  1P3P A;  2FJ7 D;  3LZ0 D;  4R8P B;  5CP6 B;  4XUJ B;  4Z5T B;  1F1E A;  3VH6 T;  3REI C;  1JFI B;  3LZ1 A;  5B2J D;  3UTB B;  3UTB C;  5JA4 B;  4Z66 B;  1M1A C;  3REK A;  3X1T B;  5AV9 D;  3A6N A;  1P3F C;  1KX3 B;  2RVQ C;  4R8P C;  5B32 B;  1TZY B;  4YS3 D;  3C1C B;  4YM6 A;  3AV2 D;  1KX4 A;  5GT0 B;  5F99 C;  2JSS A;  1M1A A;  5B40 B;  3W99 A;  1EQZ C;  1B67 A;  3C1C D;  3LZ0 C;  4ZUX B;  3WTP E;  4H9N B;  3W96 D;  3B0C T;  1P3M B;  3A6N B;  1KX3 A;  5AV6 B;  3W97 B;  2CV5 C;  4KUD B;  3NQU B;  4ZUX D;  5AV9 C;  1M18 B;  2LY8 A;  5CPJ D;  3UTA B;  3LEL D;  1TAF B;  5AV5 C;  3AZJ B;  1P3K D;  3AZG C;  1S32 C;  4LD9 D;  3MVD D;  2L5A A;  5E5A B;  5B2J C;  4J8U D;  1HQ3 B;  5B33 B;  1P3O C;  3X1S A;  3REI A;  3REJ A;  5GSU D;  5B0Y D;  4J8W D;  3MNN C;  1KX3 D;  1P3B D;  4WV4 B;  5DNM D;  3UTB A;  5AVB B;  3VH6 W;  5GT3 A;  3B6F C;  5AV6 A;  3W97 A;  3VH5 A;  3C1B D;  3AZH D;  5GSU C;  4DRA A;  3WKJ A;  1P3M A;  3LEL A;  1M19 C;  1M19 B;  3AFA C;  3O62 A;  4AWL C;  4ZBJ C;  1P3A B;  3AYW B;  3AN2 B;  4H9Q B;  4M6B A;  2NZD D;  5AV8 B;  4H9P B;  3B0D B;  4EO5 C;  5B40 A;  4H9S A;  4J8W A;  1HTA A;  3VH5 W;  5BNV B;  1P3M C;  3MGS C;  1TZY C;  5DNM A;  4H9O B;  2NZD C;  3VH6 A;  3TU4 C;  4CSR A;  2HIO B;  3R45 B;  3B6F A;  5AV6 D;  4ZBJ B;  5AVC D;  3C1B A;  3X1T C;  3AZH A;  5GT3 B;  3W97 D;  5GXQ D;  5DNN A;  3AZE D;  2NQB B;  3MGR A;  3X1V D;  4Z66 A;  5BO0 A;  3KXB C;  5B24 B;  1P34 A;  1EQZ D;  3WA9 A;  5JRG A;  3C1C C;  5BT1 C;  4WU9 D;  5B1L D;  4E45 A;  3AZE C;  5B40 D;  1ULY A;  1ZLA D;  5B2I A;  1KX4 B;  3AZM A;  2BYM B;  3MGS A;  1F66 D;  5B32 A;  4ZUX C;  5B31 C;  4JJN A;  3KWQ A;  5CPK B;  2HUE B;  5AVC A;  2IO5 B;  4KHA B;  5AVB A;  3X1T A;  3AZE A;  4Z66 D;  3REH A;  1F66 C;  3KWQ B;  3LZ1 B;  4WU9 A;  2PYO B;  5CPI B;  4G92 B;  4XUJ A;  3AZK B;  3B6G C;  3KXB D;  2F8N G;  3AZF B;  3MNN D;  1P3F B;  4QLC A;  1KX3 C;  5B2I D;  5AV8 C;  3AZM D;  5B0Z A;  2BYK A;  4YS3 B;  3MGS D;  3AZI D;  3AV2 B;  5B32 D;  5CPI D;  5KDM A;  3KWQ D;  3AV1 A;  3AZN A;  4J8X C;  4KGC C;  4H9R A;  3KUY C;  3MGQ D;  5BS7 A;  1P3L C;  3TU4 A;  5AVB C;  3REH D;  5AVC B;  3LJA A;  3B6G B;  3R45 A;  3B6F B;  1P3I D;  3W98 C;  3AV1 B;  5BT1 D;  4WU9 C;  1P3O A;  1AOI B;  1N1J B;  4UUZ A;  4XUJ D;  3REJ C;  3KXB A;  3X1S C;  1F66 B;  3AZN C;  3WA9 C;  1WWS A;  4Z5T D;  3AZJ C;  1P3L B;  2F8N K;  1M1A B;  1S32 B;  4KGC B;  2YFV B;  5GT3 C;  3LJA C;  5CPI A;  3AYW A;  3AN2 A;  1P3A D;  5F99 A;  4WU8 B;  3AZN D;  3AV1 C;  1U35 D;  1P3G C;  2YFW A;  3LJA D;  4X23 A;  4J8V B;  4XZQ A;  4NE5 A;  3LZ1 C;  5DNM B; 
#chains in the Genus database with same CATH topology
 3MGP C;  1P3B B;  4AWL B;  3AZL D;  4J8W B;  2Y2Q A;  4R8P D;  5C3I C;  3LZ0 B;  4J8U B;  3KFU G;  3AZF C;  4H9Q A;  2NZD B;  3AYW D;  5B1L B;  3AN2 D;  5B1M B;  3AZL C;  4WU9 B;  1TAF A;  5GT0 C;  2YFV A;  1ID3 C;  5BO0 B;  1AOI D;  4WZS B;  1N1J A;  4UUZ B;  3W99 C;  4X23 D;  5B2J A;  5BNX B;  3KUY B;  2IO5 C;  4CSR B;  4XZQ C;  4WNN A;  2YFW B;  3B6G D;  5CPK C;  4Z2M G;  5AV5 B;  1H3O A;  3REK D;  5B0Y B;  5B0Y C;  5BNV A;  1HQ3 D;  5B33 D;  2HIO C;  3W99 B;  3AV2 A;  4KGC D;  2PYO C;  3NQJ A;  1P3L D;  3O62 B;  3AZF D;  1M1A D;  3EPH A;  5B24 C;  3KXB B;  4Z2M H;  1M19 D;  1HQ3 C;  5B33 C;  1P3O B;  1AOI A;  3AZL B;  3AZG B;  3UT9 D;  4WNN B;  2F8N H;  3FDD A;  1M18 D;  4NE3 A;  3AFA B;  2ARO C;  4J8V D;  5B32 G;  1P3B C;  4QLC C;  2FJ7 C;  4H9R B;  1R4V A;  4YM6 C;  1PZR A;  3MGP B;  5CPK D;  4G91 B;  3UT9 C;  1WWI A;  5AY8 C;  5E5A D;  4NFT A;  4JJN B;  5DNN C;  4J8V C;  3MGR C;  5CPJ A;  5AV6 C;  3W97 C;  1P3L A;  3MNN B;  1P3F D;  3AZF A;  1S32 D;  2ARO A;  5B2I B;  1P3P D;  5JRG C;  2FJ7 A;  2PYO D;  1KX5 A;  3LZ1 D;  1Z2C B;  3UT9 A;  3MVD A;  1M18 A;  4J8U A;  3NQU A;  4XZQ B;  3REI D;  2Y2I A;  4H9S C;  5GSU A;  1P3P C;  3TU4 B;  5AV9 A;  1P3B A;  3A6N D;  5JA4 A;  3WTP C;  3UTB D;  2NQB A;  3AFA A;  5CPK A;  5B1M C;  1KX5 C;  3W96 C;  5AY8 A;  5B2J B;  3X1V C;  4YM6 D;  3X1U C;  1KX4 D;  4J8U C;  3B0C W;  1ID3 D;  3A6N C;  1P3F A;  1S32 A;  4J8W C;  4UPK A;  3O62 D;  3KSY A;  4CAY A;  3W99 D;  5C3I B;  4X23 C;  3AV2 C;  3EG5 B;  2PYO A;  1KX5 D;  2NZD A;  3C1C A;  2DF4 C;  1TZY D;  4HGA C;  1M18 C;  3W96 A;  3X1V B;  3AZH B;  3C1B B;  3AZK C;  5GXQ B;  2NQB D;  3AFA D;  4G92 C;  1P3K C;  3WKJ C;  2RVQ D;  3WTP A;  4LD9 C;  2ZY4 A;  5B32 C;  5B31 G;  4ZUX A;  5BNX A;  5AY8 D;  5E5A C;  2G5H C;  3KUY A;  5DNN D;  3MGR D;  3X1V A;  1ID3 A;  2BYK B;  5CP6 D;  3MGQ C;  3AZN B;  1ZLA B;  5B40 C;  1EQZ A;  3X1U D;  5JRG D;  1BH8 A;  5G49 B;  5F99 B;  4WU8 A;  5B1L A;  3UTA C;  1P3K A;  4LD9 A;  5B0Z B;  3O62 C;  1TZY A;  5AVC C;  4XUJ C;  5CP6 C;  3X1S D;  3REJ D;  1ZLA A;  5B0Y A;  3MGR B;  2FFF B;  5DNN B;  4NE6 A;  2CV5 A;  5AY8 B;  1B6W A;  1F66 A;  3AZE B;  4DRB A;  2RIQ A;  5GT3 D;  3WTP D;  2ZM5 A;  4Z66 C;  4J8X B;  3KUY D;  3WKJ D;  5AVB D;  2NQB C;  1P3M D;  5CP6 A;  3X1U A;  3AZG A;  4WU8 D;  2BYM A;  3MGS B;  1A7W A;  1BH9 A;  3MNN A;  3LEL B;  3NQJ B;  3A1K A;  3UTA D;  3KWQ C;  5BS7 C;  4QLC B;  3REL D;  5CPJ B;  2CV5 D;  3B0D C;  1P3A C;  5B31 B;  3AV1 D;  3B6F D;  1P3I B;  5GXQ A;  1H3O B;  3REL C;  3TU4 D;  3REI B;  2CWE A;  2UWX A;  5GSU B;  2F8N B;  3WA9 D;  1P34 D;  3W96 B;  5B31 D;  2VQR A;  3AZG D;  3MVD C;  3MVD B;  3V9R A;  1P3O D;  5B0Z C;  3AZI B;  2JE5 A;  4Z5T A;  3VH5 T;  3AZM B;  4WU8 C;  1P3P B;  5B1L C;  3UTA A;  3REL A;  3AZK D;  3EPJ A;  1P34 C;  3WAA B;  3V9R B;  1U35 C;  1ZLA C;  1P3G D;  1P3A A;  4JJN D;  5B24 A;  2F8N D;  3MGP A;  3WA9 B;  5B2I C;  3X1T D;  3AZM C;  3REH B;  5GXQ C;  3WKJ B;  5AV9 B;  3AZI C;  4J8X A;  4KHA A;  3B0B A;  5B31 A;  4XZQ D;  5KDM B;  4JJN C;  2JCH A;  4G91 C;  3UT9 B;  1P3G B;  2CV5 B;  2Y2G A;  4H9O A;  3AZL A;  3WAA D;  4HGA B;  3REH C;  4QLC D;  3REL B;  3AYW C;  3AN2 C;  2ARO B;  2FJ7 B;  1BFM A;  3AZK A;  3W98 D;  5B0Z D;  5GT0 D;  3AZI A;  3AL0 C;  3AZJ A;  1P3G A;  3X1U B;  2J8P A;  1EQZ B;  1P34 B;  5B24 D;  2F8N A;  3MGP D;  2Y2H A;  3MGQ A;  5FUG A;  5AV5 A;  4J8X D;  1Q9C A;  1P3I A;  4KUD A;  4H9N A;  3WTP B;  2HIO A;  3LJA B;  3B6G A;  2Y2L A;  3WAA A;  2HUE C;  5CHL B;  3W98 A;  5GT0 A;  5AV8 D;  1HQ3 A;  5B33 A;  1AOI C;  4YS3 C;  5B1M D;  1BH8 B;  4H9P A;  5G49 A;  4Z5T C;  3AZJ D;  5JRG B;  4KUD C;  4KGC A;  5F99 D;  5CPJ C;  1ID3 B;  4E44 A;  3LZ0 A;  1U35 A;  3LEL C;  1M19 A;  4YM6 B;  5AV5 D;  3REK B;  4KUD D;  1P3I C;  2HIO D;  1W2E A;  5FUG B;  4X23 B;  4J8V A;  3MGQ B;  1U35 B;  3WAA C;  4R8P A;  1KU5 A;  3X1S B;  5DNM C;  3REJ B;  5AV8 A;  5CPI C;  5E5A A;  2ZY3 A;  1KX5 B;  5B1M A;  1JFI A;  1BH9 B;  4YS3 A;  1P3K B;  4LD9 B;  1KX4 C;  4CAY B;  3W98 B;  3REK C;  3C1B C;  2F2A C;  3AZH C;  4EO5 B;  2ARO D;  3H0L C;  1P3P A;  4R8P B;  3LZ0 D;  2FJ7 D;  5CP6 B;  4XUJ B;  4Z5T B;  1F1E A;  3VH6 T;  3REI C;  1JFI B;  3LZ1 A;  5B2J D;  3UTB B;  3UTB C;  5JA4 B;  4Z66 B;  1M1A C;  3REK A;  3X1T B;  5AV9 D;  3A6N A;  1P3F C;  1KX3 B;  2RVQ C;  4R8P C;  5B32 B;  1TZY B;  4YS3 D;  3C1C B;  4YM6 A;  3AV2 D;  1KX4 A;  5GT0 B;  5F99 C;  2JSS A;  1M1A A;  5B40 B;  3W99 A;  1EQZ C;  1B67 A;  3C1C D;  3LZ0 C;  4ZUX B;  3WTP E;  4H9N B;  3W96 D;  3B0C T;  1P3M B;  3A6N B;  1KX3 A;  5AV6 B;  3W97 B;  2CV5 C;  4KUD B;  3IP4 C;  3NQU B;  4ZUX D;  5AV9 C;  1M18 B;  2DQN C;  2LY8 A;  2XD1 A;  5CPJ D;  1T3U A;  3UTA B;  2Y2P A;  3LEL D;  1TAF B;  5AV5 C;  3AZJ B;  1P3K D;  3AZG C;  1S32 C;  4LD9 D;  3MVD D;  2L5A A;  5E5A B;  5B2J C;  4J8U D;  1HQ3 B;  5B33 B;  1P3O C;  3X1S A;  3REI A;  3REJ A;  5GSU D;  5B0Y D;  4J8W D;  3F6T A;  4WJ3 C;  3MNN C;  1KX3 D;  1P3B D;  2G5I C;  4WV4 B;  5DNM D;  2ZY5 A;  5AVB B;  3UTB A;  3VH6 W;  5GT3 A;  3H0M C;  3B6F C;  5AV6 A;  3W97 A;  3VH5 A;  3C1B D;  3AZH D;  5GSU C;  4DRA A;  3WKJ A;  3A1I A;  1P3M A;  3LEL A;  1M19 C;  1M19 B;  3AFA C;  3O62 A;  4AWL C;  4ZBJ C;  1P3A B;  3AYW B;  3AN2 B;  4H9Q B;  4M6B A;  2NZD D;  5AV8 B;  4H9P B;  3B0D B;  4EO5 C;  5B40 A;  4H9S A;  4J8W A;  1HTA A;  3VH5 W;  5BNV B;  1P3M C;  3MGS C;  3EPL A;  1TZY C;  5DNM A;  4H9O B;  2NZD C;  3VH6 A;  3TU4 C;  4CSR A;  2HIO B;  3R45 B;  3B6F A;  5AV6 D;  4ZBJ B;  5AVC D;  3C1B A;  3X1T C;  3AZH A;  5GT3 B;  3W97 D;  5GXQ D;  5DNN A;  3AZE D;  2NQB B;  3MGR A;  3X1V D;  4Z66 A;  5BO0 A;  5B24 B;  3KXB C;  1P34 A;  1EQZ D;  2Y2K A;  3WA9 A;  5JRG A;  3C1C C;  5BT1 C;  4WU9 D;  2W8S A;  3H0R C;  5B1L D;  4E45 A;  3AZE C;  5B40 D;  1ULY A;  1ZLA D;  5B2I A;  1KX4 B;  3AZM A;  2BYM B;  3MGS A;  1F66 D;  4DQY B;  5B32 A;  4ZUX C;  5B31 C;  4JJN A;  3KWQ A;  5CPK B;  2HUE B;  5AVC A;  3EPK A;  2IO5 B;  4KHA B;  5AVB A;  3X1T A;  3AZE A;  4Z66 D;  3REH A;  1F66 C;  3KWQ B;  3LZ1 B;  4WU9 A;  2Y2M A;  2PYO B;  5CPI B;  3P5J B;  4G92 B;  4XUJ A;  3AZK B;  3B6G C;  3KXB D;  2F8N G;  3AZF B;  3MNN D;  1P3F B;  4QLC A;  1KX3 C;  5B2I D;  5AV8 C;  3AZM D;  5B0Z A;  2BYK A;  4YS3 B;  3MGS D;  2BG1 A;  3AZI D;  3AV2 B;  5B32 D;  5CPI D;  5KDM A;  2Y2N A;  3KWQ D;  3AV1 A;  3AZN A;  4J8X C;  4KGC C;  4H9R A;  2XD5 A;  3KUY C;  3MGQ D;  5BS7 A;  1P3L C;  3TU4 A;  5AVB C;  2Y2J A;  3REH D;  5AVC B;  3LJA A;  3B6G B;  3R45 A;  3B6F B;  1P3I D;  3W98 C;  3AV1 B;  5BT1 D;  4WU9 C;  1P3O A;  1AOI B;  1N1J B;  4UUZ A;  4XUJ D;  3REJ C;  3KXB A;  3X1S C;  1F66 B;  2Y2O A;  3AZN C;  3WA9 C;  1WWS A;  4Z5T D;  3AZJ C;  1P3L B;  2F8N K;  1M1A B;  1S32 B;  4KGC B;  2YFV B;  5GT3 C;  3LJA C;  2ZY2 A;  5CPI A;  3AYW A;  3AN2 A;  1P3A D;  4WU8 B;  5F99 A;  3AZN D;  3AV1 C;  1U35 D;  1P3G C;  2YFW A;  3LJA D;  4X23 A;  4J8V B;  4XZQ A;  4NE5 A;  3LZ1 C;  5DNM B; 
#chains in the Genus database with same CATH homology
 3MGP C;  1P3B B;  4AWL B;  3AZL D;  4J8W B;  2Y2Q A;  4R8P D;  5C3I C;  3LZ0 B;  4J8U B;  3KFU G;  3AZF C;  4H9Q A;  2NZD B;  3AYW D;  5B1L B;  3AN2 D;  5B1M B;  3AZL C;  4WU9 B;  1TAF A;  5GT0 C;  2YFV A;  1ID3 C;  5BO0 B;  1AOI D;  4WZS B;  1N1J A;  4UUZ B;  3W99 C;  4X23 D;  5B2J A;  5BNX B;  3KUY B;  2IO5 C;  4CSR B;  4XZQ C;  4WNN A;  2YFW B;  3B6G D;  5CPK C;  4Z2M G;  5AV5 B;  1H3O A;  3REK D;  5B0Y B;  5B0Y C;  5BNV A;  1HQ3 D;  5B33 D;  2HIO C;  3W99 B;  3AV2 A;  4KGC D;  2PYO C;  3NQJ A;  1P3L D;  3O62 B;  3AZF D;  1M1A D;  3EPH A;  5B24 C;  3KXB B;  4Z2M H;  1M19 D;  1HQ3 C;  5B33 C;  1P3O B;  1AOI A;  3AZL B;  3AZG B;  3UT9 D;  4WNN B;  2F8N H;  3FDD A;  1M18 D;  4NE3 A;  3AFA B;  2ARO C;  4J8V D;  5B32 G;  1P3B C;  4QLC C;  2FJ7 C;  4H9R B;  1R4V A;  4YM6 C;  1PZR A;  3MGP B;  5CPK D;  4G91 B;  3UT9 C;  1WWI A;  5AY8 C;  5E5A D;  4NFT A;  4JJN B;  5DNN C;  4J8V C;  3MGR C;  5CPJ A;  5AV6 C;  3W97 C;  1P3L A;  3MNN B;  1P3F D;  3AZF A;  1S32 D;  2ARO A;  5B2I B;  1P3P D;  5JRG C;  2FJ7 A;  2PYO D;  1KX5 A;  3LZ1 D;  1Z2C B;  3UT9 A;  3MVD A;  1M18 A;  4J8U A;  3NQU A;  4XZQ B;  3REI D;  2Y2I A;  4H9S C;  5GSU A;  1P3P C;  3TU4 B;  5AV9 A;  1P3B A;  3A6N D;  5JA4 A;  3WTP C;  3UTB D;  2NQB A;  3AFA A;  5CPK A;  5B1M C;  1KX5 C;  3W96 C;  5AY8 A;  5B2J B;  3X1V C;  4YM6 D;  3X1U C;  1KX4 D;  4J8U C;  3B0C W;  1ID3 D;  3A6N C;  1P3F A;  1S32 A;  4J8W C;  4UPK A;  3O62 D;  3KSY A;  4CAY A;  3W99 D;  5C3I B;  4X23 C;  3AV2 C;  3EG5 B;  2PYO A;  1KX5 D;  2NZD A;  3C1C A;  2DF4 C;  1TZY D;  4HGA C;  1M18 C;  3W96 A;  3X1V B;  3AZH B;  3C1B B;  3AZK C;  5GXQ B;  2NQB D;  3AFA D;  4G92 C;  1P3K C;  3WKJ C;  2RVQ D;  3WTP A;  4LD9 C;  2ZY4 A;  5B32 C;  5B31 G;  4ZUX A;  5BNX A;  5AY8 D;  5E5A C;  2G5H C;  3KUY A;  5DNN D;  3MGR D;  3X1V A;  1ID3 A;  2BYK B;  5CP6 D;  3MGQ C;  3AZN B;  1ZLA B;  5B40 C;  1EQZ A;  3X1U D;  5JRG D;  1BH8 A;  5G49 B;  5F99 B;  4WU8 A;  5B1L A;  3UTA C;  1P3K A;  4LD9 A;  5B0Z B;  3O62 C;  1TZY A;  5AVC C;  4XUJ C;  5CP6 C;  3X1S D;  3REJ D;  1ZLA A;  5B0Y A;  3MGR B;  2FFF B;  5DNN B;  4NE6 A;  2CV5 A;  5AY8 B;  1B6W A;  1F66 A;  3AZE B;  4DRB A;  2RIQ A;  5GT3 D;  3WTP D;  2ZM5 A;  4Z66 C;  4J8X B;  3KUY D;  3WKJ D;  5AVB D;  2NQB C;  1P3M D;  5CP6 A;  3X1U A;  3AZG A;  4WU8 D;  2BYM A;  3MGS B;  1A7W A;  1BH9 A;  3MNN A;  3LEL B;  3NQJ B;  3A1K A;  3UTA D;  3KWQ C;  5BS7 C;  4QLC B;  3REL D;  5CPJ B;  2CV5 D;  3B0D C;  1P3A C;  5B31 B;  3AV1 D;  3B6F D;  1P3I B;  5GXQ A;  1H3O B;  3REL C;  3TU4 D;  3REI B;  2CWE A;  2UWX A;  5GSU B;  2F8N B;  3WA9 D;  1P34 D;  3W96 B;  5B31 D;  2VQR A;  3AZG D;  3MVD C;  3MVD B;  3V9R A;  1P3O D;  5B0Z C;  3AZI B;  2JE5 A;  4Z5T A;  3VH5 T;  3AZM B;  4WU8 C;  1P3P B;  5B1L C;  3UTA A;  3REL A;  3AZK D;  3EPJ A;  1P34 C;  3WAA B;  3V9R B;  1U35 C;  1ZLA C;  1P3G D;  1P3A A;  4JJN D;  5B24 A;  2F8N D;  3MGP A;  3WA9 B;  5B2I C;  3X1T D;  3AZM C;  3REH B;  5GXQ C;  3WKJ B;  5AV9 B;  3AZI C;  4J8X A;  4KHA A;  3B0B A;  5B31 A;  4XZQ D;  5KDM B;  4JJN C;  2JCH A;  4G91 C;  3UT9 B;  1P3G B;  2CV5 B;  2Y2G A;  4H9O A;  3AZL A;  3WAA D;  4HGA B;  3REH C;  4QLC D;  3REL B;  3AYW C;  3AN2 C;  2ARO B;  2FJ7 B;  1BFM A;  3AZK A;  3W98 D;  5B0Z D;  5GT0 D;  3AZI A;  3AL0 C;  3AZJ A;  1P3G A;  3X1U B;  2J8P A;  1EQZ B;  1P34 B;  5B24 D;  2F8N A;  3MGP D;  2Y2H A;  3MGQ A;  5FUG A;  5AV5 A;  4J8X D;  1Q9C A;  1P3I A;  4KUD A;  4H9N A;  3WTP B;  2HIO A;  3LJA B;  3B6G A;  2Y2L A;  3WAA A;  2HUE C;  5CHL B;  3W98 A;  5GT0 A;  5AV8 D;  1HQ3 A;  5B33 A;  1AOI C;  4YS3 C;  5B1M D;  1BH8 B;  4H9P A;  5G49 A;  4Z5T C;  3AZJ D;  5JRG B;  4KUD C;  4KGC A;  5F99 D;  5CPJ C;  1ID3 B;  4E44 A;  3LZ0 A;  1U35 A;  3LEL C;  1M19 A;  4YM6 B;  5AV5 D;  3REK B;  4KUD D;  1P3I C;  2HIO D;  1W2E A;  5FUG B;  4X23 B;  4J8V A;  3MGQ B;  1U35 B;  3WAA C;  4R8P A;  1KU5 A;  3X1S B;  5DNM C;  3REJ B;  5AV8 A;  5CPI C;  5E5A A;  2ZY3 A;  1KX5 B;  5B1M A;  1JFI A;  1BH9 B;  4YS3 A;  1P3K B;  4LD9 B;  1KX4 C;  4CAY B;  3W98 B;  3REK C;  3C1B C;  2F2A C;  3AZH C;  4EO5 B;  2ARO D;  3H0L C;  1P3P A;  4R8P B;  3LZ0 D;  2FJ7 D;  5CP6 B;  4XUJ B;  4Z5T B;  1F1E A;  3VH6 T;  3REI C;  1JFI B;  3LZ1 A;  5B2J D;  3UTB B;  3UTB C;  5JA4 B;  4Z66 B;  1M1A C;  3REK A;  3X1T B;  5AV9 D;  3A6N A;  1P3F C;  1KX3 B;  2RVQ C;  4R8P C;  5B32 B;  1TZY B;  4YS3 D;  3C1C B;  4YM6 A;  3AV2 D;  1KX4 A;  5GT0 B;  5F99 C;  2JSS A;  1M1A A;  5B40 B;  3W99 A;  1EQZ C;  1B67 A;  3C1C D;  3LZ0 C;  4ZUX B;  3WTP E;  4H9N B;  3W96 D;  3B0C T;  1P3M B;  3A6N B;  1KX3 A;  5AV6 B;  3W97 B;  2CV5 C;  4KUD B;  3IP4 C;  3NQU B;  4ZUX D;  5AV9 C;  1M18 B;  2DQN C;  2LY8 A;  2XD1 A;  5CPJ D;  1T3U A;  3UTA B;  2Y2P A;  3LEL D;  1TAF B;  5AV5 C;  3AZJ B;  1P3K D;  3AZG C;  1S32 C;  4LD9 D;  3MVD D;  2L5A A;  5E5A B;  5B2J C;  4J8U D;  1HQ3 B;  5B33 B;  1P3O C;  3X1S A;  3REI A;  3REJ A;  5GSU D;  5B0Y D;  4J8W D;  3F6T A;  4WJ3 C;  3MNN C;  1KX3 D;  1P3B D;  2G5I C;  4WV4 B;  5DNM D;  2ZY5 A;  5AVB B;  3UTB A;  3VH6 W;  5GT3 A;  3H0M C;  3B6F C;  5AV6 A;  3W97 A;  3VH5 A;  3C1B D;  3AZH D;  5GSU C;  4DRA A;  3WKJ A;  3A1I A;  1P3M A;  3LEL A;  1M19 C;  1M19 B;  3AFA C;  3O62 A;  4AWL C;  4ZBJ C;  1P3A B;  3AYW B;  3AN2 B;  4H9Q B;  4M6B A;  2NZD D;  5AV8 B;  4H9P B;  3B0D B;  4EO5 C;  5B40 A;  4H9S A;  4J8W A;  1HTA A;  3VH5 W;  5BNV B;  1P3M C;  3MGS C;  3EPL A;  1TZY C;  5DNM A;  4H9O B;  2NZD C;  3VH6 A;  3TU4 C;  4CSR A;  2HIO B;  3R45 B;  3B6F A;  5AV6 D;  4ZBJ B;  5AVC D;  3C1B A;  3X1T C;  3AZH A;  5GT3 B;  3W97 D;  5GXQ D;  5DNN A;  3AZE D;  2NQB B;  3MGR A;  3X1V D;  4Z66 A;  5BO0 A;  5B24 B;  3KXB C;  1P34 A;  1EQZ D;  2Y2K A;  3WA9 A;  5JRG A;  3C1C C;  5BT1 C;  4WU9 D;  2W8S A;  3H0R C;  5B1L D;  4E45 A;  3AZE C;  5B40 D;  1ULY A;  1ZLA D;  5B2I A;  1KX4 B;  3AZM A;  2BYM B;  3MGS A;  1F66 D;  4DQY B;  5B32 A;  4ZUX C;  5B31 C;  4JJN A;  3KWQ A;  5CPK B;  2HUE B;  5AVC A;  3EPK A;  2IO5 B;  4KHA B;  5AVB A;  3X1T A;  3AZE A;  4Z66 D;  3REH A;  1F66 C;  3KWQ B;  3LZ1 B;  4WU9 A;  2Y2M A;  2PYO B;  5CPI B;  3P5J B;  4G92 B;  4XUJ A;  3AZK B;  3B6G C;  3KXB D;  2F8N G;  3AZF B;  3MNN D;  1P3F B;  4QLC A;  1KX3 C;  5B2I D;  5AV8 C;  3AZM D;  5B0Z A;  2BYK A;  4YS3 B;  3MGS D;  2BG1 A;  3AZI D;  3AV2 B;  5B32 D;  5CPI D;  5KDM A;  2Y2N A;  3KWQ D;  3AV1 A;  3AZN A;  4J8X C;  4KGC C;  4H9R A;  2XD5 A;  3KUY C;  3MGQ D;  5BS7 A;  1P3L C;  3TU4 A;  5AVB C;  2Y2J A;  3REH D;  5AVC B;  3LJA A;  3B6G B;  3R45 A;  3B6F B;  1P3I D;  3W98 C;  3AV1 B;  5BT1 D;  4WU9 C;  1P3O A;  1AOI B;  1N1J B;  4UUZ A;  4XUJ D;  3REJ C;  3KXB A;  3X1S C;  1F66 B;  2Y2O A;  3AZN C;  3WA9 C;  1WWS A;  4Z5T D;  3AZJ C;  1P3L B;  2F8N K;  1M1A B;  1S32 B;  4KGC B;  2YFV B;  5GT3 C;  3LJA C;  2ZY2 A;  5CPI A;  3AYW A;  3AN2 A;  1P3A D;  4WU8 B;  5F99 A;  3AZN D;  3AV1 C;  1U35 D;  1P3G C;  2YFW A;  3LJA D;  4X23 A;  4J8V B;  4XZQ A;  4NE5 A;  3LZ1 C;  5DNM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...