5BO0A

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bo0A00
2F8NB 1BH9A 1KX3C 3RELD 5B2IB 3WAAA 4YS3B 1P3GD 4KGCA 4Z66B 3C1CC 3NQJB 4ZUXD 5F99D 5B40A 3W98D 5B31D 1A7WA 3AZJB 5B32D 1P3OD 3LELD 3W99A 2YFVB 5CPJB 5BT1C 5AV6D 2FJ7C 4J8VC 3MGSC 3AZFC 1ZLAA 5BS7C 3AZID 1P3LC 4JJND 5B33A 5C3IC 1P3KB 3AFAC 5AVCA 3REKB 3KWQD 5JRGD 4J8XA 3X1VB 1TAFA 3AZED 3MGQC 3WKJA 3W96C 3V9RB 1U35B 3X1TD 4UUZB 5CP6A 4H9QA 5B0YB 5KDMA 3KUYA 2F8NK 3RELB 3NQUA 1P3GB 1WWIA 4KHAB 5E5AB 2BYKA 4G92C 4ZUXB 5F99B 4X23C 3AZGD 5B31B 3AN2D 3W98B 1KX5A 3C1CD 5CPIC 5B32B 1P3OB 1H3OA 5FUGA 3WAAD 5DNND 5AV6B 5B2IA 5CPKC 4YS3A 4M6BA 1KU5A 3AZIB 2HIOD 4JJNB 3NQJA 3MGSD 5AVBC 5DNMC 3X1SD 3KWQB 5JRGB 1F66C 3AZJA 3AZEB 4J8UC 2YFVA 3X1TB 5CPJA 1HQ3C 3MGPC 3AV1C 1P3MC 3MGQD 3W96D 4DRBA 4J8XD 1S32C 1P3KA 4H9OB 3WKJD 1KX4D 3REKA 4Z5TC 3UT9C 3X1VA 2BYMA 3B6GC 3AZGB 3AN2B 3V9RA 1U35A 5B2JC 4UUZA 3C1CB 5GXQD 5B0YA 1N1JB 4X23D 3WAAB 5DNNB 3AZHC 4KUDC 2YFWB 5BNVB 5CPID 3RELA 1P3GA 5B1LD 5E5AA 2NZDC 5AY8C 5AV8C 4NE3A 2HIOB 4H9RB 3MGSB 4EO5C 3O62A 5CPKD 5F99A 3X1SB 1EQZD 5B31A 5B32A 1P3OA 2CV5C 5AVBD 5DNMD 4LD9C 5AV6A 3MGQB 3W96B 2AROC 1HQ3D 1M19C 3AZIA 1P3MD 4J8WC 5GT3D 3WKJB 3AZLC 3WTPC 1KX4B 3AZNC 3KWQA 5JRGA 4AWLC 4XZQC 3AZEA 3AZKC 5B0ZC 3X1TA 3KSYA 1P3PC 4Z5TD 3MGRC 5GXQB 3REJC 4G92B 4X23B 5B2JD 1P3IA 4DRAA 5CPIB 1M18A 2BYKB 5B1LB 4H9OA 3AZHD 1KX3A 5CPKB 3AZGA 2NZDD 5BO0B 1EQZB 1H3OB 5AY8D 5AV8D 3C1CA 4WU9C 1N1JA 3AV2C 5AVBB 5DNMB 4NE5A 3VH6T 5E5AD 5DNNA 2YFWA 5BNVA 2CV5D 3O62D 4LD9D 1HQ3B 2HIOA 4H9PB 4H9RA 4QLCC 3MGSA 1P3MB 1P3FD 2FJ7A 2LY8A 5GT3B 2AROD 3X1SA 5AV9C 3B6FC 2F8NG 1P3LA 1P3AC 3AFAA 3AZND 4Z5TB 4YM6C 5B24D 3MGQA 3AZKD 3W96A 4ZBJC 5B2JB 4WZSB 3REIC 2PYOD 4G91C 3REJD 3B0DC 2BYMB 1KX4A 3AZHB 4KUDB 4KGCC 1M1AC 2NZDB 5AY8B 5AV8B 1P3ID 5GXQA 4EO5B 1P34C 4X23A 3X1UC 1M18D 5CPIA 3AV2D 2CV5B 3O62B 5B1LA 1KX3D 4LD9B 1BH8B 1P3FB 5CPKA 3WTPE 2AROB 5BO0A 1EQZA 3AYWC 3LZ0C 5AVCC 5AVBA 5DNMA 5AV9D 3A6NC 3LJAC 3AZNB 3B6FD 4AWLB 4XZQB 5BT1D 5B24B 3LZ1C 3AZKB 2FJ7D 4J8VD 3AZFD 1P3AD 1TZYC 3MNNC 3W97C 1P3PB 1HQ3A 4YM6D 1AOIC 4H9PA 3VH5T 1P3MA 2PYOB 1P3LD 5B1MC 3REJB 5B32G 5GT3A 3C1BC 2L5AA 3AFAD 3KUYC 4Z2MG 5GT0C 4XUJC 4Z5TA 1P3IB 5GSUC 4HGAC 1M18B 5B2JA 3B0BA 3AV2B 1P34D 3X1UD 1KX3B 3AZHA 4KUDA 3TU4C 5B2IC 4YS3C 1B6WA 2NZDA 4Z66C 5AY8A 5AV8A 3UTBC 3VH6W 2JSSA 4R8PC 4CAYA 5AV5C 5AV9B 3B6FB 3AYWD 2FJ7B 4J8VB 5CHLB 3AZFB 2CV5A 1P3AB 5CPJC 4LD9A 3A6ND 3LJAD 4YM6B 1BH8A 1P3FA 3KXBC 1P3LB 5C3IB 3MNND 2AROA 3VH6A 3W97D 3AFAB 1M19A 1F66D 4G91B 5B1MD 3C1BD 4J8UD 3AZLA 3WTPA 3AZNA 4XZQA 5B24A 3MGPD 3AZKA 3AV1D 5GT0D 1U35C 2F8NH 3AZMC 4WU8C 1P3PA 4XUJD 1Q9CA 2PYOA 5GSUD 5BNXB 3REJA 1P34B 1S32D 3X1UB 3B0CT 3REHC 2IO5C 3UT9D 3B6GD 4E45A 3TU4D 4ZUXC 3W98C 3MVDC 4H9SA 3AYWB 5B32C 3UTAC 3UTBD 3LELC 4KUDD 3AV2A 5AV5D 4R8PD 3A6NB 3LJAB 4H9NB 3MNNB 3W97B 5G49B 3AZIC 4JJNC 1F66B 4QLCA 3KXBD 5B1MB 3C1BB 4J8UB 3R45B 5AV9A 1P3BC 3B6FA 3MGPB 3AV1B 4J8VA 5GT0B 3AZFA 1P3AA 3VH5W 4XUJB 5BS7A 4YM6A 2RVQC 5GSUB 1M19D 3WA9C 1S32B 4HGAB 3AZMD 4J8WD 4WU8D 1ID3C 3AZLD 4NFTA 3WTPD 3REIA 3UT9B 4XZQD 2NQBC 1WWSA 3B6GB 3REHD 5B0ZD 3VH5A 1P3PD 3MGRD 3TU4B 5JA4B 1HTAA 3AZGC 3AN2C 1M1AA 4Z2MH 3UTBB 4CSRB 5BNXA 1P34A 4R8PB 3WAAC 5AV5B 3X1UA 3MVDD 5DNNC 1BFMA 3UTAD 5B40C 2HUEC 4CAYB 2HIOC 3KXBB 4WU9D 3X1SC 3W99C 3AYWA 4NE6A 3LZ0A 1ZLAC 1P3BD 3A6NA 3LJAA 3LZ1A 1M19B 5B33C 4QLCD 2CWEA 1TZYA 4H9NA 4WU8B 3MNNA 3W97A 4J8WB 3AZMB 5G49A 3AZLB 3WTPB 4J8XC 4WV4B 1AOIA 2RVQD 1F66A 5B1MA 3WKJC 3WA9D 3C1BA 4WNNB 1KX4C 4J8UA 3R45A 3REHB 1ID3D 2IO5B 5CP6C 5B0ZB 5B31G 1B67A 3MGPA 3MGRB 3AV1A 2NQBD 5GT0A 4XUJA 5GXQC 5GSUA 3REID 3B0CW 1S32A 3MVDB 3UTAB 3LELB 3UT9A 5B1LC 2F8NA 3B6GA 4KGCD 1M1AD 1KX5C 3TU4A 5JA4A 4WU9B 1EQZC 5B40D 4Z66A 3UTBA 4CSRA 3W99D 5AV5A 4R8PA 1P3BB 4QLCB 1ZLAD 1JFIB 3AZJC 3KXBA 5GT3C 5B33D 3LZ0D 3WA9B 1ID3B 5AVCD 3LZ1D 2NQBB 1TZYD 4ZBJB 5CP6D 1ULYA 3REIB 1AOID 1P3KC 4WU8A 4J8WA 3AZMA 3B0DB 3REKC 1BH9B 3X1VC 3KUYD 4WNNA 3REHA 1M1AB 4KGCB 5B0ZA 3MGRA 5B0YC 4KHAA 5B40B 2HUEB 1KX5D 4ZUXA 3W98A 3RELC 3W99B 1P3GC 5E5AC 3MVDA 2F8ND 3UTAA 3LELA 1F1EA 3O62C 1ZLAB 5B2ID 4YS3D 5F99C 5B31C 4Z66D 1R4VA 1P3FC 5B33B 3LZ0B 4WU9A 1P3OC 5AVCB 4JJNA 4J8XB 5AV6C 1TAFB 3AZJD 3LZ1B 1P3BA 1TZYB 4E44A 5CPJD 5CP6B 5B24C 4H9QB 1AOIB 1JFIA 5KDMB 2PYOC 3KWQC 5JRGC 3KUYB 3AZEC 3WA9A 1P3KD 3NQUB 1ID3A 3X1TC 3REKD 3X1VD 2NQBA 1U35D 1P3IC 1KX5B 5B0YD 3AN2A 1M18C 4H9SC 5FUGB
chains in the Genus database with same CATH superfamily
2F8NB 1BH9A 1KX3C 3RELD 5B2IB 3WAAA 4YS3B 1P3GD 4KGCA 4Z66B 3C1CC 3NQJB 4ZUXD 5F99D 5B40A 3W98D 5B31D 1A7WA 3AZJB 3P5JB 5B32D 1P3OD 3LELD 3W99A 3KFUG 2YFVB 5CPJB 5BT1C 5AV6D 2FJ7C 4J8VC 3MGSC 3AZFC 1ZLAA 5BS7C 3AZID 1P3LC 4JJND 5B33A 5C3IC 1P3KB 3AFAC 5AVCA 3REKB 3KWQD 5JRGD 4J8XA 3X1VB 1TAFA 3AZED 3MGQC 3WKJA 3W96C 3V9RB 1U35B 3X1TD 4UUZB 5CP6A 4H9QA 5B0YB 5KDMA 3KUYA 2F8NK 3RELB 3NQUA 1P3GB 1WWIA 4KHAB 5E5AB 2BYKA 4G92C 4ZUXB 5F99B 4X23C 3AZGD 5B31B 3AN2D 3W98B 1KX5A 3C1CD 5CPIC 5B32B 1P3OB 1H3OA 5FUGA 3WAAD 5DNND 5AV6B 5B2IA 5CPKC 4YS3A 4M6BA 1KU5A 3AZIB 2HIOD 4UPKA 4JJNB 3NQJA 3MGSD 5AVBC 5DNMC 3X1SD 3KWQB 5JRGB 1F66C 3AZJA 2Y2HA 3AZEB 4J8UC 2F2AC 3H0RC 2YFVA 3X1TB 2Y2OA 5CPJA 1HQ3C 3MGPC 3AV1C 1P3MC 3MGQD 3W96D 4DRBA 4J8XD 1S32C 1P3KA 4H9OB 3WKJD 1KX4D 3REKA 4Z5TC 3UT9C 3X1VA 2BYMA 3B6GC 3AZGB 3AN2B 3V9RA 1U35A 5B2JC 4UUZA 3C1CB 2J8PA 5GXQD 5B0YA 1N1JB 4X23D 3WAAB 5DNNB 3AZHC 4KUDC 2YFWB 5BNVB 5CPID 3RELA 1P3GA 5B1LD 5E5AA 2NZDC 5AY8C 5AV8C 4NE3A 2HIOB 4H9RB 3MGSB 4EO5C 3O62A 5CPKD 5F99A 3X1SB 1EQZD 5B31A 2Y2JA 5B32A 1P3OA 2CV5C 5AVBD 5DNMD 4LD9C 5AV6A 3MGQB 2JCHA 3EPLA 3W96B 2AROC 1HQ3D 1M19C 3AZIA 1P3MD 1W2EA 2XD1A 4J8WC 5GT3D 3WKJB 3A1KA 3AZLC 3WTPC 1KX4B 3AZNC 3KWQA 5JRGA 4AWLC 4XZQC 3AZEA 3AZKC 2ZY2A 5B0ZC 3X1TA 3KSYA 2Y2NA 4Z5TD 3MGRC 1P3PC 5GXQB 3REJC 4G92B 4X23B 5B2JD 1P3IA 2RIQA 4DRAA 5CPIB 1M18A 2BYKB 5B1LB 4H9OA 3AZHD 2BG1A 1KX3A 5CPKB 4WJ3C 3AZGA 2NZDD 5BO0B 1EQZB 1H3OB 5AY8D 5AV8D 3C1CA 4WU9C 1N1JA 3AV2C 5AVBB 5DNMB 4NE5A 3VH6T 5E5AD 5DNNA 2YFWA 5BNVA 2CV5D 3O62D 4LD9D 1HQ3B 2VQRA 2HIOA 4H9PB 4H9RA 4QLCC 3MGSA 1P3MB 1P3FD 2FJ7A 2LY8A 5GT3B 2AROD 3X1SA 5AV9C 3B6FC 2F8NG 1P3LA 1P3AC 3AFAA 3AZND 4Z5TB 4YM6C 5B24D 3MGQA 3AZKD 3W96A 4ZBJC 5B2JB 4WZSB 3REIC 2PYOD 4G91C 3REJD 3B0DC 2BYMB 1KX4A 3AZHB 4KUDB 4KGCC 1M1AC 2NZDB 5AY8B 5AV8B 1P3ID 5GXQA 4EO5B 1P34C 4X23A 3X1UC 1M18D 2W8SA 5CPIA 3AV2D 2CV5B 3O62B 5B1LA 1KX3D 4LD9B 1BH8B 1P3FB 2Y2QA 5CPKA 3WTPE 2AROB 5BO0A 1EQZA 3AYWC 2FFFB 3LZ0C 3AL0C 5AVCC 5AVBA 5DNMA 5AV9D 3A6NC 3LJAC 3AZNB 3B6FD 4AWLB 4XZQB 5BT1D 5B24B 3LZ1C 3AZKB 2FJ7D 4J8VD 3AZFD 2JE5A 1TZYC 1Z2CB 3MNNC 2ZY4A 1P3AD 3W97C 1P3PB 1HQ3A 4YM6D 1AOIC 4H9PA 3VH5T 1P3MA 2PYOB 1P3LD 5B1MC 3REJB 5B32G 5GT3A 3C1BC 2L5AA 3AFAD 3KUYC 4Z2MG 5GT0C 3H0MC 4XUJC 4Z5TA 1P3IB 5GSUC 4HGAC 1M18B 5B2JA 3B0BA 3AV2B 1P34D 3X1UD 1KX3B 3AZHA 4KUDA 3TU4C 5B2IC 4YS3C 1B6WA 2NZDA 4Z66C 5AY8A 5AV8A 3UTBC 3VH6W 2JSSA 4R8PC 4CAYA 5AV5C 5AV9B 3B6FB 3AYWD 2FJ7B 4J8VB 5CHLB 3AZFB 2CV5A 1P3AB 5CPJC 4LD9A 3A6ND 3LJAD 4YM6B 1BH8A 1P3FA 3KXBC 1P3LB 5C3IB 3MNND 2AROA 3VH6A 3W97D 3AFAB 1M19A 1F66D 4G91B 2G5HC 5B1MD 3C1BD 4J8UD 3AZLA 3WTPA 3AZNA 4XZQA 5B24A 3MGPD 3AZKA 3AV1D 5GT0D 1U35C 2F8NH 3AZMC 4WU8C 1P3PA 4XUJD 1Q9CA 2PYOA 5GSUD 5BNXB 3REJA 1P34B 1S32D 3X1UB 3B0CT 3REHC 2IO5C 3UT9D 3B6GD 4E45A 1T3UA 3TU4D 4ZUXC 3W98C 3MVDC 4H9SA 3AYWB 5B32C 3UTAC 3UTBD 3LELC 4KUDD 3AV2A 5AV5D 4R8PD 3A6NB 3LJAB 4H9NB 3MNNB 3W97B 5G49B 3AZIC 4JJNC 1F66B 4QLCA 3KXBD 5B1MB 3C1BB 4J8UB 3R45B 5AV9A 2ZY3A 1P3BC 3B6FA 3MGPB 3AV1B 4J8VA 5GT0B 3AZFA 1P3AA 3VH5W 4XUJB 5BS7A 4YM6A 2RVQC 5GSUB 1M19D 3WA9C 3F6TA 1S32B 4HGAB 3AZMD 4J8WD 4WU8D 1ID3C 3AZLD 4NFTA 3WTPD 3REIA 3UT9B 4XZQD 2NQBC 1WWSA 3B6GB 3REHD 5B0ZD 3VH5A 1P3PD 3MGRD 2DF4C 5JA4B 3TU4B 1HTAA 3AZGC 3AN2C 1M1AA 4Z2MH 3UTBB 2Y2IA 4CSRB 5BNXA 1P34A 3WAAC 5AV5B 3X1UA 4R8PB 3MVDD 5DNNC 1BFMA 4DQYB 3UTAD 5B40C 2HUEC 4CAYB 2HIOC 3KXBB 4WU9D 3X1SC 3W99C 3AYWA 4NE6A 3LZ0A 1ZLAC 2Y2KA 3EPKA 3A6NA 3LJAA 1P3BD 3LZ1A 1M19B 5B33C 4QLCD 2CWEA 1TZYA 4H9NA 4WU8B 3MNNA 3W97A 4J8WB 2G5IC 3AZMB 5G49A 3AZLB 3WTPB 4J8XC 4WV4B 1AOIA 2RVQD 1F66A 5B1MA 3WKJC 3WA9D 3C1BA 4WNNB 1KX4C 4J8UA 3R45A 3REHB 1ID3D 2IO5B 5CP6C 5B0ZB 5B31G 1B67A 3MGPA 3MGRB 3A1IA 3AV1A 2NQBD 5GT0A 4XUJA 5GXQC 5GSUA 3REID 3B0CW 1S32A 3MVDB 2Y2GA 2ZM5A 3UTAB 3LELB 3UT9A 5B1LC 2F8NA 3B6GA 4KGCD 1M1AD 1KX5C 3TU4A 5JA4A 4WU9B 1EQZC 3EG5B 5B40D 4Z66A 2XD5A 3UTBA 4CSRA 3W99D 5AV5A 4R8PA 1P3BB 3IP4C 4QLCB 1ZLAD 1JFIB 3AZJC 3KXBA 3FDDA 5GT3C 5B33D 3LZ0D 3WA9B 1ID3B 5AVCD 3LZ1D 2NQBB 1TZYD 4ZBJB 5CP6D 1ULYA 3REIB 1AOID 2ZY5A 1P3KC 4WU8A 4J8WA 3AZMA 3B0DB 3REKC 1BH9B 3X1VC 3KUYD 3EPJA 4WNNA 3REHA 1M1AB 4KGCB 5B0ZA 3MGRA 5B0YC 2UWXA 4KHAA 5B40B 2HUEB 1KX5D 2Y2MA 3EPHA 4ZUXA 3W98A 3RELC 3W99B 1P3GC 5E5AC 3MVDA 2F8ND 3UTAA 3LELA 1F1EA 3O62C 1ZLAB 5B2ID 4YS3D 5F99C 5B31C 4Z66D 1R4VA 1P3FC 5B33B 3LZ0B 4WU9A 1P3OC 5AVCB 3H0LC 4JJNA 4J8XB 5AV6C 1TAFB 3AZJD 2DQNC 2Y2LA 3LZ1B 1P3BA 1TZYB 4E44A 5CPJD 5CP6B 5B24C 4H9QB 1AOIB 1JFIA 5KDMB 2PYOC 3KWQC 5JRGC 3KUYB 2Y2PA 3AZEC 3WA9A 1P3KD 3NQUB 1ID3A 3X1TC 3REKD 3X1VD 2NQBA 1PZRA 1U35D 1P3IC 1KX5B 5B0YD 3AN2A 1M18C 4H9SC 5FUGB
chains in the Genus database with same CATH topology
2F8NB 1BH9A 1KX3C 3RELD 5B2IB 3WAAA 4YS3B 1P3GD 4KGCA 4Z66B 3C1CC 3NQJB 4ZUXD 5F99D 5B40A 3W98D 5B31D 1A7WA 3AZJB 3P5JB 5B32D 1P3OD 3LELD 3W99A 3KFUG 2YFVB 5CPJB 5BT1C 5AV6D 2FJ7C 4J8VC 3MGSC 3AZFC 1ZLAA 5BS7C 3AZID 1P3LC 4JJND 5B33A 5C3IC 1P3KB 3AFAC 5AVCA 3REKB 3KWQD 5JRGD 4J8XA 3X1VB 1TAFA 3AZED 3MGQC 3WKJA 3W96C 3V9RB 1U35B 3X1TD 4UUZB 5CP6A 4H9QA 5B0YB 5KDMA 3KUYA 2F8NK 3RELB 3NQUA 1P3GB 1WWIA 4KHAB 5E5AB 2BYKA 4G92C 4ZUXB 5F99B 4X23C 3AZGD 5B31B 3AN2D 3W98B 1KX5A 3C1CD 5CPIC 5B32B 1P3OB 1H3OA 5FUGA 3WAAD 5DNND 5AV6B 5B2IA 5CPKC 4YS3A 4M6BA 1KU5A 3AZIB 2HIOD 4UPKA 4JJNB 3NQJA 3MGSD 5AVBC 5DNMC 3X1SD 3KWQB 5JRGB 1F66C 3AZJA 2Y2HA 3AZEB 4J8UC 2F2AC 3H0RC 2YFVA 3X1TB 2Y2OA 5CPJA 1HQ3C 3MGPC 3AV1C 1P3MC 3MGQD 3W96D 4DRBA 4J8XD 1S32C 1P3KA 4H9OB 3WKJD 1KX4D 3REKA 4Z5TC 3UT9C 3X1VA 2BYMA 3B6GC 3AZGB 3AN2B 3V9RA 1U35A 5B2JC 4UUZA 3C1CB 2J8PA 5GXQD 5B0YA 1N1JB 4X23D 3WAAB 5DNNB 3AZHC 4KUDC 2YFWB 5BNVB 5CPID 3RELA 1P3GA 5B1LD 5E5AA 2NZDC 5AY8C 5AV8C 4NE3A 2HIOB 4H9RB 3MGSB 4EO5C 3O62A 5CPKD 5F99A 3X1SB 1EQZD 5B31A 2Y2JA 5B32A 1P3OA 2CV5C 5AVBD 5DNMD 4LD9C 5AV6A 3MGQB 2JCHA 3EPLA 3W96B 2AROC 1HQ3D 1M19C 3AZIA 1P3MD 1W2EA 2XD1A 4J8WC 5GT3D 3WKJB 3A1KA 3AZLC 3WTPC 1KX4B 3AZNC 3KWQA 5JRGA 4AWLC 4XZQC 3AZEA 3AZKC 2ZY2A 5B0ZC 3X1TA 3KSYA 2Y2NA 4Z5TD 3MGRC 1P3PC 5GXQB 3REJC 4G92B 4X23B 5B2JD 1P3IA 2RIQA 4DRAA 5CPIB 1M18A 2BYKB 5B1LB 4H9OA 3AZHD 2BG1A 1KX3A 5CPKB 4WJ3C 3AZGA 2NZDD 5BO0B 1EQZB 1H3OB 5AY8D 5AV8D 3C1CA 4WU9C 1N1JA 3AV2C 5AVBB 5DNMB 4NE5A 3VH6T 5E5AD 5DNNA 2YFWA 5BNVA 2CV5D 3O62D 4LD9D 1HQ3B 2VQRA 2HIOA 4H9PB 4H9RA 4QLCC 3MGSA 1P3MB 1P3FD 2FJ7A 2LY8A 5GT3B 2AROD 3X1SA 5AV9C 3B6FC 2F8NG 1P3LA 1P3AC 3AFAA 3AZND 4Z5TB 4YM6C 5B24D 3MGQA 3AZKD 3W96A 4ZBJC 5B2JB 4WZSB 3REIC 2PYOD 4G91C 3REJD 3B0DC 2BYMB 1KX4A 3AZHB 4KUDB 4KGCC 1M1AC 2NZDB 5AY8B 5AV8B 1P3ID 5GXQA 4EO5B 1P34C 4X23A 3X1UC 1M18D 2W8SA 5CPIA 3AV2D 2CV5B 3O62B 5B1LA 1KX3D 4LD9B 1BH8B 1P3FB 2Y2QA 5CPKA 3WTPE 2AROB 5BO0A 1EQZA 3AYWC 2FFFB 3LZ0C 3AL0C 5AVCC 5AVBA 5DNMA 5AV9D 3A6NC 3LJAC 3AZNB 3B6FD 4AWLB 4XZQB 5BT1D 5B24B 3LZ1C 3AZKB 2FJ7D 4J8VD 3AZFD 2JE5A 1TZYC 1Z2CB 3MNNC 2ZY4A 1P3AD 3W97C 1P3PB 1HQ3A 4YM6D 1AOIC 4H9PA 3VH5T 1P3MA 2PYOB 1P3LD 5B1MC 3REJB 5B32G 5GT3A 3C1BC 2L5AA 3AFAD 3KUYC 4Z2MG 5GT0C 3H0MC 4XUJC 4Z5TA 1P3IB 5GSUC 4HGAC 1M18B 5B2JA 3B0BA 3AV2B 1P34D 3X1UD 1KX3B 3AZHA 4KUDA 3TU4C 5B2IC 4YS3C 1B6WA 2NZDA 4Z66C 5AY8A 5AV8A 3UTBC 3VH6W 2JSSA 4R8PC 4CAYA 5AV5C 5AV9B 3B6FB 3AYWD 2FJ7B 4J8VB 5CHLB 3AZFB 2CV5A 1P3AB 5CPJC 4LD9A 3A6ND 3LJAD 4YM6B 1BH8A 1P3FA 3KXBC 1P3LB 5C3IB 3MNND 2AROA 3VH6A 3W97D 3AFAB 1M19A 1F66D 4G91B 2G5HC 5B1MD 3C1BD 4J8UD 3AZLA 3WTPA 3AZNA 4XZQA 5B24A 3MGPD 3AZKA 3AV1D 5GT0D 1U35C 2F8NH 3AZMC 4WU8C 1P3PA 4XUJD 1Q9CA 2PYOA 5GSUD 5BNXB 3REJA 1P34B 1S32D 3X1UB 3B0CT 3REHC 2IO5C 3UT9D 3B6GD 4E45A 1T3UA 3TU4D 4ZUXC 3W98C 3MVDC 4H9SA 3AYWB 5B32C 3UTAC 3UTBD 3LELC 4KUDD 3AV2A 5AV5D 4R8PD 3A6NB 3LJAB 4H9NB 3MNNB 3W97B 5G49B 3AZIC 4JJNC 1F66B 4QLCA 3KXBD 5B1MB 3C1BB 4J8UB 3R45B 5AV9A 2ZY3A 1P3BC 3B6FA 3MGPB 3AV1B 4J8VA 5GT0B 3AZFA 1P3AA 3VH5W 4XUJB 5BS7A 4YM6A 2RVQC 5GSUB 1M19D 3WA9C 3F6TA 1S32B 4HGAB 3AZMD 4J8WD 4WU8D 1ID3C 3AZLD 4NFTA 3WTPD 3REIA 3UT9B 4XZQD 2NQBC 1WWSA 3B6GB 3REHD 5B0ZD 3VH5A 1P3PD 3MGRD 2DF4C 5JA4B 3TU4B 1HTAA 3AZGC 3AN2C 1M1AA 4Z2MH 3UTBB 2Y2IA 4CSRB 5BNXA 1P34A 3WAAC 5AV5B 3X1UA 4R8PB 3MVDD 5DNNC 1BFMA 4DQYB 3UTAD 5B40C 2HUEC 4CAYB 2HIOC 3KXBB 4WU9D 3X1SC 3W99C 3AYWA 4NE6A 3LZ0A 1ZLAC 2Y2KA 3EPKA 3A6NA 3LJAA 1P3BD 3LZ1A 1M19B 5B33C 4QLCD 2CWEA 1TZYA 4H9NA 4WU8B 3MNNA 3W97A 4J8WB 2G5IC 3AZMB 5G49A 3AZLB 3WTPB 4J8XC 4WV4B 1AOIA 2RVQD 1F66A 5B1MA 3WKJC 3WA9D 3C1BA 4WNNB 1KX4C 4J8UA 3R45A 3REHB 1ID3D 2IO5B 5CP6C 5B0ZB 5B31G 1B67A 3MGPA 3MGRB 3A1IA 3AV1A 2NQBD 5GT0A 4XUJA 5GXQC 5GSUA 3REID 3B0CW 1S32A 3MVDB 2Y2GA 2ZM5A 3UTAB 3LELB 3UT9A 5B1LC 2F8NA 3B6GA 4KGCD 1M1AD 1KX5C 3TU4A 5JA4A 4WU9B 1EQZC 3EG5B 5B40D 4Z66A 2XD5A 3UTBA 4CSRA 3W99D 5AV5A 4R8PA 1P3BB 3IP4C 4QLCB 1ZLAD 1JFIB 3AZJC 3KXBA 3FDDA 5GT3C 5B33D 3LZ0D 3WA9B 1ID3B 5AVCD 3LZ1D 2NQBB 1TZYD 4ZBJB 5CP6D 1ULYA 3REIB 1AOID 2ZY5A 1P3KC 4WU8A 4J8WA 3AZMA 3B0DB 3REKC 1BH9B 3X1VC 3KUYD 3EPJA 4WNNA 3REHA 1M1AB 4KGCB 5B0ZA 3MGRA 5B0YC 2UWXA 4KHAA 5B40B 2HUEB 1KX5D 2Y2MA 3EPHA 4ZUXA 3W98A 3RELC 3W99B 1P3GC 5E5AC 3MVDA 2F8ND 3UTAA 3LELA 1F1EA 3O62C 1ZLAB 5B2ID 4YS3D 5F99C 5B31C 4Z66D 1R4VA 1P3FC 5B33B 3LZ0B 4WU9A 1P3OC 5AVCB 3H0LC 4JJNA 4J8XB 5AV6C 1TAFB 3AZJD 2DQNC 2Y2LA 3LZ1B 1P3BA 1TZYB 4E44A 5CPJD 5CP6B 5B24C 4H9QB 1AOIB 1JFIA 5KDMB 2PYOC 3KWQC 5JRGC 3KUYB 2Y2PA 3AZEC 3WA9A 1P3KD 3NQUB 1ID3A 3X1TC 3REKD 3X1VD 2NQBA 1PZRA 1U35D 1P3IC 1KX5B 5B0YD 3AN2A 1M18C 4H9SC 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N B;  1BH9 A;  1KX3 C;  3REL D;  5B2I B;  3WAA A;  4YS3 B;  1P3G D;  4KGC A;  4Z66 B;  3C1C C;  3NQJ B;  4ZUX D;  5F99 D;  5B40 A;  3W98 D;  5B31 D;  1A7W A;  3AZJ B;  5B32 D;  1P3O D;  3LEL D;  3W99 A;  2YFV B;  5CPJ B;  5BT1 C;  5AV6 D;  2FJ7 C;  4J8V C;  3MGS C;  3AZF C;  1ZLA A;  5BS7 C;  3AZI D;  1P3L C;  4JJN D;  5B33 A;  5C3I C;  1P3K B;  3AFA C;  5AVC A;  3REK B;  3KWQ D;  5JRG D;  4J8X A;  3X1V B;  1TAF A;  3AZE D;  3MGQ C;  3WKJ A;  3W96 C;  3V9R B;  1U35 B;  3X1T D;  4UUZ B;  5CP6 A;  4H9Q A;  5B0Y B;  5KDM A;  3KUY A;  2F8N K;  3REL B;  3NQU A;  1P3G B;  1WWI A;  4KHA B;  5E5A B;  2BYK A;  4G92 C;  4ZUX B;  5F99 B;  4X23 C;  3AZG D;  5B31 B;  3AN2 D;  3W98 B;  1KX5 A;  3C1C D;  5CPI C;  5B32 B;  1P3O B;  1H3O A;  5FUG A;  3WAA D;  5DNN D;  5AV6 B;  5B2I A;  5CPK C;  4YS3 A;  4M6B A;  1KU5 A;  3AZI B;  2HIO D;  4JJN B;  3NQJ A;  3MGS D;  5AVB C;  5DNM C;  3X1S D;  3KWQ B;  5JRG B;  1F66 C;  3AZJ A;  3AZE B;  4J8U C;  2YFV A;  3X1T B;  5CPJ A;  1HQ3 C;  3MGP C;  3AV1 C;  1P3M C;  3MGQ D;  3W96 D;  4DRB A;  4J8X D;  1S32 C;  1P3K A;  4H9O B;  3WKJ D;  1KX4 D;  3REK A;  4Z5T C;  3UT9 C;  3X1V A;  2BYM A;  3B6G C;  3AZG B;  3AN2 B;  3V9R A;  1U35 A;  5B2J C;  4UUZ A;  3C1C B;  5GXQ D;  5B0Y A;  1N1J B;  4X23 D;  3WAA B;  5DNN B;  3AZH C;  4KUD C;  2YFW B;  5BNV B;  5CPI D;  3REL A;  1P3G A;  5B1L D;  5E5A A;  2NZD C;  5AY8 C;  5AV8 C;  4NE3 A;  2HIO B;  4H9R B;  3MGS B;  4EO5 C;  3O62 A;  5CPK D;  5F99 A;  3X1S B;  1EQZ D;  5B31 A;  5B32 A;  1P3O A;  2CV5 C;  5AVB D;  5DNM D;  4LD9 C;  5AV6 A;  3MGQ B;  3W96 B;  2ARO C;  1HQ3 D;  1M19 C;  3AZI A;  1P3M D;  4J8W C;  5GT3 D;  3WKJ B;  3AZL C;  3WTP C;  1KX4 B;  3AZN C;  3KWQ A;  5JRG A;  4AWL C;  4XZQ C;  3AZE A;  3AZK C;  5B0Z C;  3X1T A;  3KSY A;  1P3P C;  4Z5T D;  3MGR C;  5GXQ B;  3REJ C;  4G92 B;  4X23 B;  5B2J D;  1P3I A;  4DRA A;  5CPI B;  1M18 A;  2BYK B;  5B1L B;  4H9O A;  3AZH D;  1KX3 A;  5CPK B;  3AZG A;  2NZD D;  5BO0 B;  1EQZ B;  1H3O B;  5AY8 D;  5AV8 D;  3C1C A;  4WU9 C;  1N1J A;  3AV2 C;  5AVB B;  5DNM B;  4NE5 A;  3VH6 T;  5E5A D;  5DNN A;  2YFW A;  5BNV A;  2CV5 D;  3O62 D;  4LD9 D;  1HQ3 B;  2HIO A;  4H9P B;  4H9R A;  4QLC C;  3MGS A;  1P3M B;  1P3F D;  2FJ7 A;  2LY8 A;  5GT3 B;  2ARO D;  3X1S A;  5AV9 C;  3B6F C;  2F8N G;  1P3L A;  1P3A C;  3AFA A;  3AZN D;  4Z5T B;  4YM6 C;  5B24 D;  3MGQ A;  3AZK D;  3W96 A;  4ZBJ C;  5B2J B;  4WZS B;  3REI C;  2PYO D;  4G91 C;  3REJ D;  3B0D C;  2BYM B;  1KX4 A;  3AZH B;  4KUD B;  4KGC C;  1M1A C;  2NZD B;  5AY8 B;  5AV8 B;  1P3I D;  5GXQ A;  4EO5 B;  1P34 C;  4X23 A;  3X1U C;  1M18 D;  5CPI A;  3AV2 D;  2CV5 B;  3O62 B;  5B1L A;  1KX3 D;  4LD9 B;  1BH8 B;  1P3F B;  5CPK A;  3WTP E;  2ARO B;  5BO0 A;  1EQZ A;  3AYW C;  3LZ0 C;  5AVC C;  5AVB A;  5DNM A;  5AV9 D;  3A6N C;  3LJA C;  3AZN B;  3B6F D;  4AWL B;  4XZQ B;  5BT1 D;  5B24 B;  3LZ1 C;  3AZK B;  2FJ7 D;  4J8V D;  3AZF D;  1P3A D;  1TZY C;  3MNN C;  3W97 C;  1P3P B;  1HQ3 A;  4YM6 D;  1AOI C;  4H9P A;  3VH5 T;  1P3M A;  2PYO B;  1P3L D;  5B1M C;  3REJ B;  5B32 G;  5GT3 A;  3C1B C;  2L5A A;  3AFA D;  3KUY C;  4Z2M G;  5GT0 C;  4XUJ C;  4Z5T A;  1P3I B;  5GSU C;  4HGA C;  1M18 B;  5B2J A;  3B0B A;  3AV2 B;  1P34 D;  3X1U D;  1KX3 B;  3AZH A;  4KUD A;  3TU4 C;  5B2I C;  4YS3 C;  1B6W A;  2NZD A;  4Z66 C;  5AY8 A;  5AV8 A;  3UTB C;  3VH6 W;  2JSS A;  4R8P C;  4CAY A;  5AV5 C;  5AV9 B;  3B6F B;  3AYW D;  2FJ7 B;  4J8V B;  5CHL B;  3AZF B;  2CV5 A;  1P3A B;  5CPJ C;  4LD9 A;  3A6N D;  3LJA D;  4YM6 B;  1BH8 A;  1P3F A;  3KXB C;  1P3L B;  5C3I B;  3MNN D;  2ARO A;  3VH6 A;  3W97 D;  3AFA B;  1M19 A;  1F66 D;  4G91 B;  5B1M D;  3C1B D;  4J8U D;  3AZL A;  3WTP A;  3AZN A;  4XZQ A;  5B24 A;  3MGP D;  3AZK A;  3AV1 D;  5GT0 D;  1U35 C;  2F8N H;  3AZM C;  4WU8 C;  1P3P A;  4XUJ D;  1Q9C A;  2PYO A;  5GSU D;  5BNX B;  3REJ A;  1P34 B;  1S32 D;  3X1U B;  3B0C T;  3REH C;  2IO5 C;  3UT9 D;  3B6G D;  4E45 A;  3TU4 D;  4ZUX C;  3W98 C;  3MVD C;  4H9S A;  3AYW B;  5B32 C;  3UTA C;  3UTB D;  3LEL C;  4KUD D;  3AV2 A;  5AV5 D;  4R8P D;  3A6N B;  3LJA B;  4H9N B;  3MNN B;  3W97 B;  5G49 B;  3AZI C;  4JJN C;  1F66 B;  4QLC A;  3KXB D;  5B1M B;  3C1B B;  4J8U B;  3R45 B;  5AV9 A;  1P3B C;  3B6F A;  3MGP B;  3AV1 B;  4J8V A;  5GT0 B;  3AZF A;  1P3A A;  3VH5 W;  4XUJ B;  5BS7 A;  4YM6 A;  2RVQ C;  5GSU B;  1M19 D;  3WA9 C;  1S32 B;  4HGA B;  3AZM D;  4J8W D;  4WU8 D;  1ID3 C;  3AZL D;  4NFT A;  3WTP D;  3REI A;  3UT9 B;  4XZQ D;  2NQB C;  1WWS A;  3B6G B;  3REH D;  5B0Z D;  3VH5 A;  1P3P D;  3MGR D;  3TU4 B;  5JA4 B;  1HTA A;  3AZG C;  3AN2 C;  1M1A A;  4Z2M H;  3UTB B;  4CSR B;  5BNX A;  1P34 A;  4R8P B;  3WAA C;  5AV5 B;  3X1U A;  3MVD D;  5DNN C;  1BFM A;  3UTA D;  5B40 C;  2HUE C;  4CAY B;  2HIO C;  3KXB B;  4WU9 D;  3X1S C;  3W99 C;  3AYW A;  4NE6 A;  3LZ0 A;  1ZLA C;  1P3B D;  3A6N A;  3LJA A;  3LZ1 A;  1M19 B;  5B33 C;  4QLC D;  2CWE A;  1TZY A;  4H9N A;  4WU8 B;  3MNN A;  3W97 A;  4J8W B;  3AZM B;  5G49 A;  3AZL B;  3WTP B;  4J8X C;  4WV4 B;  1AOI A;  2RVQ D;  1F66 A;  5B1M A;  3WKJ C;  3WA9 D;  3C1B A;  4WNN B;  1KX4 C;  4J8U A;  3R45 A;  3REH B;  1ID3 D;  2IO5 B;  5CP6 C;  5B0Z B;  5B31 G;  1B67 A;  3MGP A;  3MGR B;  3AV1 A;  2NQB D;  5GT0 A;  4XUJ A;  5GXQ C;  5GSU A;  3REI D;  3B0C W;  1S32 A;  3MVD B;  3UTA B;  3LEL B;  3UT9 A;  5B1L C;  2F8N A;  3B6G A;  4KGC D;  1M1A D;  1KX5 C;  3TU4 A;  5JA4 A;  4WU9 B;  1EQZ C;  5B40 D;  4Z66 A;  3UTB A;  4CSR A;  3W99 D;  5AV5 A;  4R8P A;  1P3B B;  4QLC B;  1ZLA D;  1JFI B;  3AZJ C;  3KXB A;  5GT3 C;  5B33 D;  3LZ0 D;  3WA9 B;  1ID3 B;  5AVC D;  3LZ1 D;  2NQB B;  1TZY D;  4ZBJ B;  5CP6 D;  1ULY A;  3REI B;  1AOI D;  1P3K C;  4WU8 A;  4J8W A;  3AZM A;  3B0D B;  3REK C;  1BH9 B;  3X1V C;  3KUY D;  4WNN A;  3REH A;  1M1A B;  4KGC B;  5B0Z A;  3MGR A;  5B0Y C;  4KHA A;  5B40 B;  2HUE B;  1KX5 D;  4ZUX A;  3W98 A;  3REL C;  3W99 B;  1P3G C;  5E5A C;  3MVD A;  2F8N D;  3UTA A;  3LEL A;  1F1E A;  3O62 C;  1ZLA B;  5B2I D;  4YS3 D;  5F99 C;  5B31 C;  4Z66 D;  1R4V A;  1P3F C;  5B33 B;  3LZ0 B;  4WU9 A;  1P3O C;  5AVC B;  4JJN A;  4J8X B;  5AV6 C;  1TAF B;  3AZJ D;  3LZ1 B;  1P3B A;  1TZY B;  4E44 A;  5CPJ D;  5CP6 B;  5B24 C;  4H9Q B;  1AOI B;  1JFI A;  5KDM B;  2PYO C;  3KWQ C;  5JRG C;  3KUY B;  3AZE C;  3WA9 A;  1P3K D;  3NQU B;  1ID3 A;  3X1T C;  3REK D;  3X1V D;  2NQB A;  1U35 D;  1P3I C;  1KX5 B;  5B0Y D;  3AN2 A;  1M18 C;  4H9S C;  5FUG B; 
#chains in the Genus database with same CATH topology
 2F8N B;  1BH9 A;  1KX3 C;  3REL D;  5B2I B;  3WAA A;  4YS3 B;  1P3G D;  4KGC A;  4Z66 B;  3C1C C;  3NQJ B;  4ZUX D;  5F99 D;  5B40 A;  3W98 D;  5B31 D;  1A7W A;  3AZJ B;  3P5J B;  5B32 D;  1P3O D;  3LEL D;  3W99 A;  3KFU G;  2YFV B;  5CPJ B;  5BT1 C;  5AV6 D;  2FJ7 C;  4J8V C;  3MGS C;  3AZF C;  1ZLA A;  5BS7 C;  3AZI D;  1P3L C;  4JJN D;  5B33 A;  5C3I C;  1P3K B;  3AFA C;  5AVC A;  3REK B;  3KWQ D;  5JRG D;  4J8X A;  3X1V B;  1TAF A;  3AZE D;  3MGQ C;  3WKJ A;  3W96 C;  3V9R B;  1U35 B;  3X1T D;  4UUZ B;  5CP6 A;  4H9Q A;  5B0Y B;  5KDM A;  3KUY A;  2F8N K;  3REL B;  3NQU A;  1P3G B;  1WWI A;  4KHA B;  5E5A B;  2BYK A;  4G92 C;  4ZUX B;  5F99 B;  4X23 C;  3AZG D;  5B31 B;  3AN2 D;  3W98 B;  1KX5 A;  3C1C D;  5CPI C;  5B32 B;  1P3O B;  1H3O A;  5FUG A;  3WAA D;  5DNN D;  5AV6 B;  5B2I A;  5CPK C;  4YS3 A;  4M6B A;  1KU5 A;  3AZI B;  2HIO D;  4UPK A;  4JJN B;  3NQJ A;  3MGS D;  5AVB C;  5DNM C;  3X1S D;  3KWQ B;  5JRG B;  1F66 C;  3AZJ A;  2Y2H A;  3AZE B;  4J8U C;  2F2A C;  3H0R C;  2YFV A;  3X1T B;  2Y2O A;  5CPJ A;  1HQ3 C;  3MGP C;  3AV1 C;  1P3M C;  3MGQ D;  3W96 D;  4DRB A;  4J8X D;  1S32 C;  1P3K A;  4H9O B;  3WKJ D;  1KX4 D;  3REK A;  4Z5T C;  3UT9 C;  3X1V A;  2BYM A;  3B6G C;  3AZG B;  3AN2 B;  3V9R A;  1U35 A;  5B2J C;  4UUZ A;  3C1C B;  2J8P A;  5GXQ D;  5B0Y A;  1N1J B;  4X23 D;  3WAA B;  5DNN B;  3AZH C;  4KUD C;  2YFW B;  5BNV B;  5CPI D;  3REL A;  1P3G A;  5B1L D;  5E5A A;  2NZD C;  5AY8 C;  5AV8 C;  4NE3 A;  2HIO B;  4H9R B;  3MGS B;  4EO5 C;  3O62 A;  5CPK D;  5F99 A;  3X1S B;  1EQZ D;  5B31 A;  2Y2J A;  5B32 A;  1P3O A;  2CV5 C;  5AVB D;  5DNM D;  4LD9 C;  5AV6 A;  3MGQ B;  2JCH A;  3EPL A;  3W96 B;  2ARO C;  1HQ3 D;  1M19 C;  3AZI A;  1P3M D;  1W2E A;  2XD1 A;  4J8W C;  5GT3 D;  3WKJ B;  3A1K A;  3AZL C;  3WTP C;  1KX4 B;  3AZN C;  3KWQ A;  5JRG A;  4AWL C;  4XZQ C;  3AZE A;  3AZK C;  2ZY2 A;  5B0Z C;  3X1T A;  3KSY A;  2Y2N A;  4Z5T D;  3MGR C;  1P3P C;  5GXQ B;  3REJ C;  4G92 B;  4X23 B;  5B2J D;  1P3I A;  2RIQ A;  4DRA A;  5CPI B;  1M18 A;  2BYK B;  5B1L B;  4H9O A;  3AZH D;  2BG1 A;  1KX3 A;  5CPK B;  4WJ3 C;  3AZG A;  2NZD D;  5BO0 B;  1EQZ B;  1H3O B;  5AY8 D;  5AV8 D;  3C1C A;  4WU9 C;  1N1J A;  3AV2 C;  5AVB B;  5DNM B;  4NE5 A;  3VH6 T;  5E5A D;  5DNN A;  2YFW A;  5BNV A;  2CV5 D;  3O62 D;  4LD9 D;  1HQ3 B;  2VQR A;  2HIO A;  4H9P B;  4H9R A;  4QLC C;  3MGS A;  1P3M B;  1P3F D;  2FJ7 A;  2LY8 A;  5GT3 B;  2ARO D;  3X1S A;  5AV9 C;  3B6F C;  2F8N G;  1P3L A;  1P3A C;  3AFA A;  3AZN D;  4Z5T B;  4YM6 C;  5B24 D;  3MGQ A;  3AZK D;  3W96 A;  4ZBJ C;  5B2J B;  4WZS B;  3REI C;  2PYO D;  4G91 C;  3REJ D;  3B0D C;  2BYM B;  1KX4 A;  3AZH B;  4KUD B;  4KGC C;  1M1A C;  2NZD B;  5AY8 B;  5AV8 B;  1P3I D;  5GXQ A;  4EO5 B;  1P34 C;  4X23 A;  3X1U C;  1M18 D;  2W8S A;  5CPI A;  3AV2 D;  2CV5 B;  3O62 B;  5B1L A;  1KX3 D;  4LD9 B;  1BH8 B;  1P3F B;  2Y2Q A;  5CPK A;  3WTP E;  2ARO B;  5BO0 A;  1EQZ A;  3AYW C;  2FFF B;  3LZ0 C;  3AL0 C;  5AVC C;  5AVB A;  5DNM A;  5AV9 D;  3A6N C;  3LJA C;  3AZN B;  3B6F D;  4AWL B;  4XZQ B;  5BT1 D;  5B24 B;  3LZ1 C;  3AZK B;  2FJ7 D;  4J8V D;  3AZF D;  2JE5 A;  1TZY C;  1Z2C B;  3MNN C;  2ZY4 A;  1P3A D;  3W97 C;  1P3P B;  1HQ3 A;  4YM6 D;  1AOI C;  4H9P A;  3VH5 T;  1P3M A;  2PYO B;  1P3L D;  5B1M C;  3REJ B;  5B32 G;  5GT3 A;  3C1B C;  2L5A A;  3AFA D;  3KUY C;  4Z2M G;  5GT0 C;  3H0M C;  4XUJ C;  4Z5T A;  1P3I B;  5GSU C;  4HGA C;  1M18 B;  5B2J A;  3B0B A;  3AV2 B;  1P34 D;  3X1U D;  1KX3 B;  3AZH A;  4KUD A;  3TU4 C;  5B2I C;  4YS3 C;  1B6W A;  2NZD A;  4Z66 C;  5AY8 A;  5AV8 A;  3UTB C;  3VH6 W;  2JSS A;  4R8P C;  4CAY A;  5AV5 C;  5AV9 B;  3B6F B;  3AYW D;  2FJ7 B;  4J8V B;  5CHL B;  3AZF B;  2CV5 A;  1P3A B;  5CPJ C;  4LD9 A;  3A6N D;  3LJA D;  4YM6 B;  1BH8 A;  1P3F A;  3KXB C;  1P3L B;  5C3I B;  3MNN D;  2ARO A;  3VH6 A;  3W97 D;  3AFA B;  1M19 A;  1F66 D;  4G91 B;  2G5H C;  5B1M D;  3C1B D;  4J8U D;  3AZL A;  3WTP A;  3AZN A;  4XZQ A;  5B24 A;  3MGP D;  3AZK A;  3AV1 D;  5GT0 D;  1U35 C;  2F8N H;  3AZM C;  4WU8 C;  1P3P A;  4XUJ D;  1Q9C A;  2PYO A;  5GSU D;  5BNX B;  3REJ A;  1P34 B;  1S32 D;  3X1U B;  3B0C T;  3REH C;  2IO5 C;  3UT9 D;  3B6G D;  4E45 A;  1T3U A;  3TU4 D;  4ZUX C;  3W98 C;  3MVD C;  4H9S A;  3AYW B;  5B32 C;  3UTA C;  3UTB D;  3LEL C;  4KUD D;  3AV2 A;  5AV5 D;  4R8P D;  3A6N B;  3LJA B;  4H9N B;  3MNN B;  3W97 B;  5G49 B;  3AZI C;  4JJN C;  1F66 B;  4QLC A;  3KXB D;  5B1M B;  3C1B B;  4J8U B;  3R45 B;  5AV9 A;  2ZY3 A;  1P3B C;  3B6F A;  3MGP B;  3AV1 B;  4J8V A;  5GT0 B;  3AZF A;  1P3A A;  3VH5 W;  4XUJ B;  5BS7 A;  4YM6 A;  2RVQ C;  5GSU B;  1M19 D;  3WA9 C;  3F6T A;  1S32 B;  4HGA B;  3AZM D;  4J8W D;  4WU8 D;  1ID3 C;  3AZL D;  4NFT A;  3WTP D;  3REI A;  3UT9 B;  4XZQ D;  2NQB C;  1WWS A;  3B6G B;  3REH D;  5B0Z D;  3VH5 A;  1P3P D;  3MGR D;  2DF4 C;  5JA4 B;  3TU4 B;  1HTA A;  3AZG C;  3AN2 C;  1M1A A;  4Z2M H;  3UTB B;  2Y2I A;  4CSR B;  5BNX A;  1P34 A;  3WAA C;  5AV5 B;  3X1U A;  4R8P B;  3MVD D;  5DNN C;  1BFM A;  4DQY B;  3UTA D;  5B40 C;  2HUE C;  4CAY B;  2HIO C;  3KXB B;  4WU9 D;  3X1S C;  3W99 C;  3AYW A;  4NE6 A;  3LZ0 A;  1ZLA C;  2Y2K A;  3EPK A;  3A6N A;  3LJA A;  1P3B D;  3LZ1 A;  1M19 B;  5B33 C;  4QLC D;  2CWE A;  1TZY A;  4H9N A;  4WU8 B;  3MNN A;  3W97 A;  4J8W B;  2G5I C;  3AZM B;  5G49 A;  3AZL B;  3WTP B;  4J8X C;  4WV4 B;  1AOI A;  2RVQ D;  1F66 A;  5B1M A;  3WKJ C;  3WA9 D;  3C1B A;  4WNN B;  1KX4 C;  4J8U A;  3R45 A;  3REH B;  1ID3 D;  2IO5 B;  5CP6 C;  5B0Z B;  5B31 G;  1B67 A;  3MGP A;  3MGR B;  3A1I A;  3AV1 A;  2NQB D;  5GT0 A;  4XUJ A;  5GXQ C;  5GSU A;  3REI D;  3B0C W;  1S32 A;  3MVD B;  2Y2G A;  2ZM5 A;  3UTA B;  3LEL B;  3UT9 A;  5B1L C;  2F8N A;  3B6G A;  4KGC D;  1M1A D;  1KX5 C;  3TU4 A;  5JA4 A;  4WU9 B;  1EQZ C;  3EG5 B;  5B40 D;  4Z66 A;  2XD5 A;  3UTB A;  4CSR A;  3W99 D;  5AV5 A;  4R8P A;  1P3B B;  3IP4 C;  4QLC B;  1ZLA D;  1JFI B;  3AZJ C;  3KXB A;  3FDD A;  5GT3 C;  5B33 D;  3LZ0 D;  3WA9 B;  1ID3 B;  5AVC D;  3LZ1 D;  2NQB B;  1TZY D;  4ZBJ B;  5CP6 D;  1ULY A;  3REI B;  1AOI D;  2ZY5 A;  1P3K C;  4WU8 A;  4J8W A;  3AZM A;  3B0D B;  3REK C;  1BH9 B;  3X1V C;  3KUY D;  3EPJ A;  4WNN A;  3REH A;  1M1A B;  4KGC B;  5B0Z A;  3MGR A;  5B0Y C;  2UWX A;  4KHA A;  5B40 B;  2HUE B;  1KX5 D;  2Y2M A;  3EPH A;  4ZUX A;  3W98 A;  3REL C;  3W99 B;  1P3G C;  5E5A C;  3MVD A;  2F8N D;  3UTA A;  3LEL A;  1F1E A;  3O62 C;  1ZLA B;  5B2I D;  4YS3 D;  5F99 C;  5B31 C;  4Z66 D;  1R4V A;  1P3F C;  5B33 B;  3LZ0 B;  4WU9 A;  1P3O C;  5AVC B;  3H0L C;  4JJN A;  4J8X B;  5AV6 C;  1TAF B;  3AZJ D;  2DQN C;  2Y2L A;  3LZ1 B;  1P3B A;  1TZY B;  4E44 A;  5CPJ D;  5CP6 B;  5B24 C;  4H9Q B;  1AOI B;  1JFI A;  5KDM B;  2PYO C;  3KWQ C;  5JRG C;  3KUY B;  2Y2P A;  3AZE C;  3WA9 A;  1P3K D;  3NQU B;  1ID3 A;  3X1T C;  3REK D;  3X1V D;  2NQB A;  1PZR A;  1U35 D;  1P3I C;  1KX5 B;  5B0Y D;  3AN2 A;  1M18 C;  4H9S C;  5FUG B; 
#chains in the Genus database with same CATH homology
 2F8N B;  1BH9 A;  1KX3 C;  3REL D;  5B2I B;  3WAA A;  4YS3 B;  1P3G D;  4KGC A;  4Z66 B;  3C1C C;  3NQJ B;  4ZUX D;  5F99 D;  5B40 A;  3W98 D;  5B31 D;  1A7W A;  3AZJ B;  3P5J B;  5B32 D;  1P3O D;  3LEL D;  3W99 A;  3KFU G;  2YFV B;  5CPJ B;  5BT1 C;  5AV6 D;  2FJ7 C;  4J8V C;  3MGS C;  3AZF C;  1ZLA A;  5BS7 C;  3AZI D;  1P3L C;  4JJN D;  5B33 A;  5C3I C;  1P3K B;  3AFA C;  5AVC A;  3REK B;  3KWQ D;  5JRG D;  4J8X A;  3X1V B;  1TAF A;  3AZE D;  3MGQ C;  3WKJ A;  3W96 C;  3V9R B;  1U35 B;  3X1T D;  4UUZ B;  5CP6 A;  4H9Q A;  5B0Y B;  5KDM A;  3KUY A;  2F8N K;  3REL B;  3NQU A;  1P3G B;  1WWI A;  4KHA B;  5E5A B;  2BYK A;  4G92 C;  4ZUX B;  5F99 B;  4X23 C;  3AZG D;  5B31 B;  3AN2 D;  3W98 B;  1KX5 A;  3C1C D;  5CPI C;  5B32 B;  1P3O B;  1H3O A;  5FUG A;  3WAA D;  5DNN D;  5AV6 B;  5B2I A;  5CPK C;  4YS3 A;  4M6B A;  1KU5 A;  3AZI B;  2HIO D;  4UPK A;  4JJN B;  3NQJ A;  3MGS D;  5AVB C;  5DNM C;  3X1S D;  3KWQ B;  5JRG B;  1F66 C;  3AZJ A;  2Y2H A;  3AZE B;  4J8U C;  2F2A C;  3H0R C;  2YFV A;  3X1T B;  2Y2O A;  5CPJ A;  1HQ3 C;  3MGP C;  3AV1 C;  1P3M C;  3MGQ D;  3W96 D;  4DRB A;  4J8X D;  1S32 C;  1P3K A;  4H9O B;  3WKJ D;  1KX4 D;  3REK A;  4Z5T C;  3UT9 C;  3X1V A;  2BYM A;  3B6G C;  3AZG B;  3AN2 B;  3V9R A;  1U35 A;  5B2J C;  4UUZ A;  3C1C B;  2J8P A;  5GXQ D;  5B0Y A;  1N1J B;  4X23 D;  3WAA B;  5DNN B;  3AZH C;  4KUD C;  2YFW B;  5BNV B;  5CPI D;  3REL A;  1P3G A;  5B1L D;  5E5A A;  2NZD C;  5AY8 C;  5AV8 C;  4NE3 A;  2HIO B;  4H9R B;  3MGS B;  4EO5 C;  3O62 A;  5CPK D;  5F99 A;  3X1S B;  1EQZ D;  5B31 A;  2Y2J A;  5B32 A;  1P3O A;  2CV5 C;  5AVB D;  5DNM D;  4LD9 C;  5AV6 A;  3MGQ B;  2JCH A;  3EPL A;  3W96 B;  2ARO C;  1HQ3 D;  1M19 C;  3AZI A;  1P3M D;  1W2E A;  2XD1 A;  4J8W C;  5GT3 D;  3WKJ B;  3A1K A;  3AZL C;  3WTP C;  1KX4 B;  3AZN C;  3KWQ A;  5JRG A;  4AWL C;  4XZQ C;  3AZE A;  3AZK C;  2ZY2 A;  5B0Z C;  3X1T A;  3KSY A;  2Y2N A;  4Z5T D;  3MGR C;  1P3P C;  5GXQ B;  3REJ C;  4G92 B;  4X23 B;  5B2J D;  1P3I A;  2RIQ A;  4DRA A;  5CPI B;  1M18 A;  2BYK B;  5B1L B;  4H9O A;  3AZH D;  2BG1 A;  1KX3 A;  5CPK B;  4WJ3 C;  3AZG A;  2NZD D;  5BO0 B;  1EQZ B;  1H3O B;  5AY8 D;  5AV8 D;  3C1C A;  4WU9 C;  1N1J A;  3AV2 C;  5AVB B;  5DNM B;  4NE5 A;  3VH6 T;  5E5A D;  5DNN A;  2YFW A;  5BNV A;  2CV5 D;  3O62 D;  4LD9 D;  1HQ3 B;  2VQR A;  2HIO A;  4H9P B;  4H9R A;  4QLC C;  3MGS A;  1P3M B;  1P3F D;  2FJ7 A;  2LY8 A;  5GT3 B;  2ARO D;  3X1S A;  5AV9 C;  3B6F C;  2F8N G;  1P3L A;  1P3A C;  3AFA A;  3AZN D;  4Z5T B;  4YM6 C;  5B24 D;  3MGQ A;  3AZK D;  3W96 A;  4ZBJ C;  5B2J B;  4WZS B;  3REI C;  2PYO D;  4G91 C;  3REJ D;  3B0D C;  2BYM B;  1KX4 A;  3AZH B;  4KUD B;  4KGC C;  1M1A C;  2NZD B;  5AY8 B;  5AV8 B;  1P3I D;  5GXQ A;  4EO5 B;  1P34 C;  4X23 A;  3X1U C;  1M18 D;  2W8S A;  5CPI A;  3AV2 D;  2CV5 B;  3O62 B;  5B1L A;  1KX3 D;  4LD9 B;  1BH8 B;  1P3F B;  2Y2Q A;  5CPK A;  3WTP E;  2ARO B;  5BO0 A;  1EQZ A;  3AYW C;  2FFF B;  3LZ0 C;  3AL0 C;  5AVC C;  5AVB A;  5DNM A;  5AV9 D;  3A6N C;  3LJA C;  3AZN B;  3B6F D;  4AWL B;  4XZQ B;  5BT1 D;  5B24 B;  3LZ1 C;  3AZK B;  2FJ7 D;  4J8V D;  3AZF D;  2JE5 A;  1TZY C;  1Z2C B;  3MNN C;  2ZY4 A;  1P3A D;  3W97 C;  1P3P B;  1HQ3 A;  4YM6 D;  1AOI C;  4H9P A;  3VH5 T;  1P3M A;  2PYO B;  1P3L D;  5B1M C;  3REJ B;  5B32 G;  5GT3 A;  3C1B C;  2L5A A;  3AFA D;  3KUY C;  4Z2M G;  5GT0 C;  3H0M C;  4XUJ C;  4Z5T A;  1P3I B;  5GSU C;  4HGA C;  1M18 B;  5B2J A;  3B0B A;  3AV2 B;  1P34 D;  3X1U D;  1KX3 B;  3AZH A;  4KUD A;  3TU4 C;  5B2I C;  4YS3 C;  1B6W A;  2NZD A;  4Z66 C;  5AY8 A;  5AV8 A;  3UTB C;  3VH6 W;  2JSS A;  4R8P C;  4CAY A;  5AV5 C;  5AV9 B;  3B6F B;  3AYW D;  2FJ7 B;  4J8V B;  5CHL B;  3AZF B;  2CV5 A;  1P3A B;  5CPJ C;  4LD9 A;  3A6N D;  3LJA D;  4YM6 B;  1BH8 A;  1P3F A;  3KXB C;  1P3L B;  5C3I B;  3MNN D;  2ARO A;  3VH6 A;  3W97 D;  3AFA B;  1M19 A;  1F66 D;  4G91 B;  2G5H C;  5B1M D;  3C1B D;  4J8U D;  3AZL A;  3WTP A;  3AZN A;  4XZQ A;  5B24 A;  3MGP D;  3AZK A;  3AV1 D;  5GT0 D;  1U35 C;  2F8N H;  3AZM C;  4WU8 C;  1P3P A;  4XUJ D;  1Q9C A;  2PYO A;  5GSU D;  5BNX B;  3REJ A;  1P34 B;  1S32 D;  3X1U B;  3B0C T;  3REH C;  2IO5 C;  3UT9 D;  3B6G D;  4E45 A;  1T3U A;  3TU4 D;  4ZUX C;  3W98 C;  3MVD C;  4H9S A;  3AYW B;  5B32 C;  3UTA C;  3UTB D;  3LEL C;  4KUD D;  3AV2 A;  5AV5 D;  4R8P D;  3A6N B;  3LJA B;  4H9N B;  3MNN B;  3W97 B;  5G49 B;  3AZI C;  4JJN C;  1F66 B;  4QLC A;  3KXB D;  5B1M B;  3C1B B;  4J8U B;  3R45 B;  5AV9 A;  2ZY3 A;  1P3B C;  3B6F A;  3MGP B;  3AV1 B;  4J8V A;  5GT0 B;  3AZF A;  1P3A A;  3VH5 W;  4XUJ B;  5BS7 A;  4YM6 A;  2RVQ C;  5GSU B;  1M19 D;  3WA9 C;  3F6T A;  1S32 B;  4HGA B;  3AZM D;  4J8W D;  4WU8 D;  1ID3 C;  3AZL D;  4NFT A;  3WTP D;  3REI A;  3UT9 B;  4XZQ D;  2NQB C;  1WWS A;  3B6G B;  3REH D;  5B0Z D;  3VH5 A;  1P3P D;  3MGR D;  2DF4 C;  5JA4 B;  3TU4 B;  1HTA A;  3AZG C;  3AN2 C;  1M1A A;  4Z2M H;  3UTB B;  2Y2I A;  4CSR B;  5BNX A;  1P34 A;  3WAA C;  5AV5 B;  3X1U A;  4R8P B;  3MVD D;  5DNN C;  1BFM A;  4DQY B;  3UTA D;  5B40 C;  2HUE C;  4CAY B;  2HIO C;  3KXB B;  4WU9 D;  3X1S C;  3W99 C;  3AYW A;  4NE6 A;  3LZ0 A;  1ZLA C;  2Y2K A;  3EPK A;  3A6N A;  3LJA A;  1P3B D;  3LZ1 A;  1M19 B;  5B33 C;  4QLC D;  2CWE A;  1TZY A;  4H9N A;  4WU8 B;  3MNN A;  3W97 A;  4J8W B;  2G5I C;  3AZM B;  5G49 A;  3AZL B;  3WTP B;  4J8X C;  4WV4 B;  1AOI A;  2RVQ D;  1F66 A;  5B1M A;  3WKJ C;  3WA9 D;  3C1B A;  4WNN B;  1KX4 C;  4J8U A;  3R45 A;  3REH B;  1ID3 D;  2IO5 B;  5CP6 C;  5B0Z B;  5B31 G;  1B67 A;  3MGP A;  3MGR B;  3A1I A;  3AV1 A;  2NQB D;  5GT0 A;  4XUJ A;  5GXQ C;  5GSU A;  3REI D;  3B0C W;  1S32 A;  3MVD B;  2Y2G A;  2ZM5 A;  3UTA B;  3LEL B;  3UT9 A;  5B1L C;  2F8N A;  3B6G A;  4KGC D;  1M1A D;  1KX5 C;  3TU4 A;  5JA4 A;  4WU9 B;  1EQZ C;  3EG5 B;  5B40 D;  4Z66 A;  2XD5 A;  3UTB A;  4CSR A;  3W99 D;  5AV5 A;  4R8P A;  1P3B B;  3IP4 C;  4QLC B;  1ZLA D;  1JFI B;  3AZJ C;  3KXB A;  3FDD A;  5GT3 C;  5B33 D;  3LZ0 D;  3WA9 B;  1ID3 B;  5AVC D;  3LZ1 D;  2NQB B;  1TZY D;  4ZBJ B;  5CP6 D;  1ULY A;  3REI B;  1AOI D;  2ZY5 A;  1P3K C;  4WU8 A;  4J8W A;  3AZM A;  3B0D B;  3REK C;  1BH9 B;  3X1V C;  3KUY D;  3EPJ A;  4WNN A;  3REH A;  1M1A B;  4KGC B;  5B0Z A;  3MGR A;  5B0Y C;  2UWX A;  4KHA A;  5B40 B;  2HUE B;  1KX5 D;  2Y2M A;  3EPH A;  4ZUX A;  3W98 A;  3REL C;  3W99 B;  1P3G C;  5E5A C;  3MVD A;  2F8N D;  3UTA A;  3LEL A;  1F1E A;  3O62 C;  1ZLA B;  5B2I D;  4YS3 D;  5F99 C;  5B31 C;  4Z66 D;  1R4V A;  1P3F C;  5B33 B;  3LZ0 B;  4WU9 A;  1P3O C;  5AVC B;  3H0L C;  4JJN A;  4J8X B;  5AV6 C;  1TAF B;  3AZJ D;  2DQN C;  2Y2L A;  3LZ1 B;  1P3B A;  1TZY B;  4E44 A;  5CPJ D;  5CP6 B;  5B24 C;  4H9Q B;  1AOI B;  1JFI A;  5KDM B;  2PYO C;  3KWQ C;  5JRG C;  3KUY B;  2Y2P A;  3AZE C;  3WA9 A;  1P3K D;  3NQU B;  1ID3 A;  3X1T C;  3REK D;  3X1V D;  2NQB A;  1PZR A;  1U35 D;  1P3I C;  1KX5 B;  5B0Y D;  3AN2 A;  1M18 C;  4H9S C;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...