5BOHA

Crystal structure of oxa-58 with the substrate-binding cleft in a closed state
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
236
Chain Sequence
VQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of OXA-58 with the Substrate-Binding Cleft in a Closed State: Insights into the Mobility and Stability of the OXA-58 Structure
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 73
structure length 236
sequence length 237
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5bohA00
3PBOA 2A3UA 1LL9A 4IBRA 3WRZA 2V20A 4XUXA 5EVLA 3PBRA 4E6XA 3BFGA 4E3NA 3CZDA 1LI0A 1GHIA 3GVBA 3MFDA 3G35A 1IKGA 5M1AA 5KSCA 4IVKA 4Z9QA 3NY4A 1BUEA 4BD0A 1C3BA 5GHXA 3IF6A 3IXBA 1Y54A 2Z2MB 2ZC4B 4OPRA 1GCEA 5GLCA 1SCWA 5EE8A 1PI5A 3SS5A 5DTKA 4R3JA 2J9OA 4RA7A 3DW0A 1YLJA 4PM9A 1I2WA 1O7EA 4GOGA 2WZZA 1H8ZA 1NXYA 2UWXA 3N7WA 2OSUA 3PAGA 3WS4A 2ZD8A 5IHVA 1GA9A 4P87A 1K25A 4QHCA 3VSKA 5EVIB 1CI9A 4S2IA 4KQRA 4EBLA 5U47A 2Y2JA 3C7VA 1NYMA 2Y2HA 4X56A 1XPBA 1YLWA 2WAFA 4JXSA 1MY8A 4LV3A 3VFHA 1BLCA 3UN7A 3RXWA 1K57C 1RGZA 3ZG5A 1PZOA 1PI4A 1Q2QA 2EFUA 2Y2KA 4N1XA 1PWDA 3ZGAB 4R0QA 2OV5A 2IWCA 4B4ZA 3UE3A 1HZOA 1PYYA 1XXMA 4N9LA 3MXRA 1HD8A 3UPPA 3VP0A 5CTMA 5CHJA 3QHYA 3GTCA 3BECA 3W4QA 4ZJ3A 4JXWA 4BQMA 1TDLA 4BL2A 5KZHA 3VP1A 1IYSA 4FH2A 4S2NC 5GLAA 1ES4A 4KZ9A 4OPQA 2RL3A 4LV0A 4R23A 4GD8A 4BLMA 4EBNA 4KG2A 3MKEA 4PM7A 1BULA 2WK0A 4DDSA 1LLBA 4OLDA 4N9KA 1NYYA 2X71A 3G32A 5M18A 1MWRA 2EXAA 2XQZA 3MXSA 3S22A 3GMWA 5HX9A 3LEZA 2RCXA 4GDBA 3MKFA 1ES2A 4GD6A 2ZQ8A 3ISGA 1FCOA 1W5DA 1E3UA 3NIAA 5A90A 1XP4A 3ITBA 5CRFA 4OOMA 1YMSA 1NRFA 1IYPA 1CEFA 1JWPA 5A91A 3BEBA 5AQAA 4C3QA 3IXHA 1ERQA 2XH9A 2B5RA 2X02A 3IF6B 1L0FA 2XF3A 2XEPA 1K6SA 1SKFA 4HBTA 4LV1A 4UA9A 3GQZA 1ESIA 3MBZA 4KG6A 2R9WA 1YMXA 4RVAA 5F1GA 4BJPA 1CK3A 3DTMA 3QNCA 3HLGA 2XR0A 2Y2NA 3M2KA 2P9VA 4K0XA 4Q8IA 2WGVA 1FCNA 4WMCA 3WS2A 4QB8A 2EX6A 3HLFA 4KG5A 2XD1A 3M2JA 5CEBA 2DCFA 3AGDA 4OPYA 2WADA 3AGEA 5D3OA 3Q1FA 1NY0A 3PBQA 2QPNA 2JE5A 4X55A 2HDQA 3O3VA 4QJGA 4DXCA 2A49A 3FKVA 3PAEA 1Z6FA 5FQJA 1ZG4A 3HLEA 1I5QA 3D4FA 2H0YA 3NDEA 5TFQA 2QZ6A 3A3JA 5AQBA 1BLSA 4DKIA 3S4XA 3ZNYA 1FSYA 2EX9A 3HLDA 1L0GA 4DE3A 1PW1A 1BLHA 4GDNA 4OPZA 5FQ9A 3OPPA 5EOOA 1KDSA 1E25A 1JWVA 1L0DA 4KQOA 5F82A 4WZ4A 3V50A 2Y4AA 5HW3A 2Z2LB 1N9BA 4B88A 4P85A 3OCLA 1YLPA 5CEDA 4ZJ1A 2J9PA 2ZQCA 4S2LA 3SH9A 2EX2A 3BLSA 4BD1A 3A3IA 3OCNA 3FWLA 2Y2OA 1M6KA 3AGFA 3G4PA 4KENB 4LV2A 3LO7A 4MBKA 1YQSA 2BG1A 1XX2A 3WS1A 2CC1A 4ZAMA 3ZFZA 1ES3A 4X6TA 5M19A 3MZEA 3ZCZA 1W79A 4KZ6A 3I7JA 1LHYA 3HVFA 4N1HA 5DF9A 3GV9A 5HAIA 3VP3A 5JYPA 2J7VA 1GHMA 1KVLA 4S2NA 3FYZA 3IHBA 4WZ5C 4DDYA 3OC2A 2PBYA 4U0XA 1AXBA 2XDMA 5FQKA 1HVBA 1W7FA 5CECA 1TVFA 4JF4A 3PBSA 5FQQA 4LCMA 3JYIA 5FI6A 1ZKJA 5CGSA 4GB7A 1KE0A 1J9MA 3BM6A 3SS4A 3OPLA 3NC8A 4Y0OA 4JXGA 4XUZA 4MLLA 1XKZA 2ZQDA 5CERA 5FSRA 5E43A 3FZCA 4DE2A 1S0WA 2H0TA 2P9VB 2ZC3B 1BSGA 3PBTA 3A3FA 4HEFA 1ONHA 1K4EA 3HLCA 3UO9A 3V3RA 4C75A 1K56D 2Y2MA 3W4OA 3LCEA 2WYXA 5CXWA 2ZQ9A 3O86A 1ERMA 3IWIA 4RYEA 1FQGA 1MWSA 5G18A 1NZUA 4NETA 4WBGA 3LY3A 1GA0A 5FASA 3FV7A 2HP9A 3O88A 4CJNA 3IXGA 3WS5A 2E8IA 3C5AA 4DXBA 2OLUA 2XLNA 2ZM2A 3PBNA 3HUOA 3RJUA 5KSHA 4KZ3A 4QY6A 5E2EA 1BLPA 3G30A 4HBUA 5CHUA 2ZC5B 2Q9NA 3EQUA 3GRJA 1OMEA 5TR7A 4YFMA 4K91A 2DNSA 3VOZA 3ZHHA 4OP8A 3HL9A 1XA7A 1QMFA 4OQ0A 5EVID 4C6YA 4UHUA 4S2JA 2H10A 4EQIA 2HDSA 3OPRA 2FFFB 4FSFA 4JPMA 3HBRA 4R1GA 5TGFA 1YLZA 1MWUA 2WKIA 4S2KA 5CGXA 4DE1A 4E3KA 5FDHA 1RGYA 1GHPA 4UA7A 2EXBA 5CHMA 1KGFA 4NK3A 3UE1A 3W4PA 1KGGA 4DE0A 4Y7PA 2J8YA 3N6IA 3PTEA 4OQGA 3A3EA 4WEKA 4OLGA 4UA6A 3TSGA 3SH7A 2VGKA 3BFFA 3DWZA 3UPOA 1MXOA 3HUNA 5HAQA 3Q7VA 3UPNA 2PU2A 5FA7A 1LI9A 2H5SA 3C4OA 4Y0UA 4FH4A 4F94A 4KQQA 5A93A 2EX8A 4BL3A 4PPRA 5GHZA 1M40A 2ZQ7A 3V39A 5EECA 3W8KA 3QNBA 5DVAA 4FD8A 4QY5A 4IBXA 4X68A 4KZAA 2Y2GA 5AQ7A 1W8QA 4H8RA 5CGWA 5DF7A 1FSWA 4ID4A 1ALQA 1KE3A 4MEZA 4PM5A 1BZAA 2IWDA 3IHAA 1U60A 3GSGA 4MBHA 3VMAA 3ZVWA 4EV4A 4OP5A 3VFFA 4WZ5A 3VP4A 2Y2LA 2V1ZA 3E2KA 3WS0A 1JWZA 3Q07A 4U0TA 1NJ4A 4MBFA 1MBLA 3HUMA 4E3OA 4E3MA 1FOFA 1FR1A 1IEMA 4ZBEA 4GZBA 5JYOA 5L2FA 3LY4A 4DF6A 3BFEA 3ZVTA 2WGIA 4U3TA 1DJCA 1PZPA 2ZM8A 1K57A 3UDIA 1ESUA 1RP5A 5EVIC 1W8YA 2Y2QA 5FAOA 4JLFA 2Q9MA 1K54C 3ZG9B 1IYQA 3A3DA 2WKEA 2ZJ9A 1WE4A 1JVJA 4IEDA 5FATA 4JXVA 3V3SA 3E2LA 2V2FF 1ZC2A 4P6BA 4X69A 4GNUA 4JF5A 3RXXA 3G34A 5DTTA 3OPHA 4CPKA 3IWOA 1FR6A 1G68A 4KZ8A 1QMEA 2HPBA 1RCJA 5HARA 3VSLA 4E3JA 4M3KA 2G2UA 2JBFA 1K4FA 1DY6A 4XXRA 2XK1A 3M6BA 2ZC7A 4EUZA 3OZHA 4OKPA 1KVMA 1YT4A 3UNWA 1XGJA 2HDUA 1XA1A 1ONGA 2Y59A 3G2ZA 4S2PA 3GR2A 3C4PA 4L0LA 2FFYA 2WGWA 3N4IA 1O07A 2C6WB 1XGIA 3ZG0A 3UY6A 4K0WA 2XD5A 3CG5A 3SS3A 2Y55A 4OVDA 1SHVA 4WELA 3IH9A 3ZG7B 4E3LA 1YLTA 4E6WA 5FI7A 3Q7VB 3VOYA 4WEJA 1ES5A 1TDGA 3BYDA 5EOEA 2C5WB 3IT9A 1BT5A 5GLBA 2ZLYA 4E3IA 2P74A 1K55C 1EROA 2HP6A 1VQQA 1IKIA 5FAQA 1S6RA 1PWCA 1KDWA 1N4OA 2XFTA 1DJAA 3TOIA 3UE0A 3VP2A 5J8XA 3ZNTA 1HTZA 4QU3A 1CEGA 4KZ5A 4B4XA 4OQHA 1EWZA 4Y0TA 1JTDA 5A92A 1FCMA 3P09A 4YINA 1EI5A 2WUQA 2ZC6B 3UDXA 4RX2A 3HREA 1MWTA 2Y2IA 3Q82A 3ZDJA 1E3UD 1NZOA 1K38A 3M6HA 1YLYA 3HLWA 3IF6C 3DWKA 3IH8A 4WYYA 5FI2A 5GLDA 5HAPA 5FAPA 3CJMA 4GKUA 4OONA 5DF8A 1WYCA 3Q81A 1YM1A 1CI8A 2JC7A 4JF6A 1K6RA 5F1FA 5HFOA 2WKHA 5F83A 2Y2PA 3IXDA 5CTNA 3S1YA 1BTLA 1G6AA 1IELA 3EQVA 3N8RA 2BLSA 4KZBA 1E4DA 4X53A 1WYBA 4PM6A 4HESA 4OOYA 2R9XA 2EFXA 1K56A 4O7DA 1ZG6A 4S2MA 1H8YA 4A5RA 5E2FA 1KE4A 5KMWA 2I72A 3WWXA 4WMCD 3MZDA 2JCHA 4D2OA 1I2SA 1L2SA 3C7UA 4EBPA 3IWQA 4RX3A 2ZQAA 4PMAA 2ZMAA 2IWBA 3G2YA 5E2HA 1SDNA 3ITAA 4KZ4A 3BRMA 3HLBA 3V5MA 2QMIA 1LL5A 3G31A 1Q2PA 2XFSA 3N8SA 4OOLA 3BFDA 2DRWA 5EVIA 5FQMA 4ZTKA 3NI9A 4LENA 5AQ9A 2OLVA 1PWGA 4BENA 3IQAA 5EUAA 5I94A 1PW8A 1K54A 3N8LA 1SDEA 3ZG8B 2WGWB 3BFCA 4QD4A 4KZ7A 3TG9A 4GN2A 1H5XA 1JTGA 2XGNA 1TEMA 2X01A 2WAEA 4MNRA 5DTSA 5EPHA 1MPLA 2WZXA 3FKWA 3NBLA 3O87A 4DRTA 4ZJ2A 1MKIA 4FCFA 4LCLA 2HP5A 5GL9A 4S2OA 1IYOA 1DJBA 1L0EA 1KGEA 3IF5A 3NCKA 4R4RA 2VGJA 1PIOA 2GDNA 4OH0A 4WM9A 2G2WA 4PM8A 4EWFA 1VM1A 3Q7ZA 5HL1A 2HDRA 3CMZA 3SH8A 3NDGA 4JKTA 4OQIA 5E2GA 4IVIA 4R4SA 3P98A 4UAAA 5GHYA 5BOHA 2Y91A 2PU4A 3B3XA 4ZDXA 5FQIA 4JBFA 3UDFA 4N92A 2ZM0A 3BLMA 4R3BA 1K55A 3SOIA 4P0MA 3MZFA 3WRTA
chains in the Genus database with same CATH superfamily
4Q0IA 3HJKA 2A3UA 3PBRA 4E6XA 2PBDP 3LI8A 5M1AA 2ZMVA 4Z9QA 1BUEA 1C3BA 2I9VA 1GCEA 2HV1A 4LRYC 1PI5A 2J9OA 4PM9A 2W3HA 1H8ZA 2GX5A 4XT2B 3PAGA 3WS4A 4KQRA 4EBLA 5U47A 2Y2JA 4I39A 2K7SA 3O5YA 2W0NA 3UN7A 3RXWA 4HP9A 2OWHA 4LRXC 2QWSA 4IHQA 2OV5A 4P6ZM 1MC0A 3UE3A 1G6OA 4N9LA 4LFUA 5CTMA 3GTCA 3H9WA 4BQMA 5KZHA 1NWZA 3H82A 3FC7A 4KZ9A 2RL3A 4LV0A 2WKRA 2WK0A 1XFQA 2AVXA 5M18A 1MWRA 5AVFA 5I5LA 5L8MA 5HX9A 4ARZB 5F69A 2RCXA 1FCOA 2EWWA 5F68A 3MF0A 3ITBA 1YMSA 4C3QA 2J3WA 2W3EA 2QJ5A 4JGPA 2XH9A 3R7WB 2B5RA 4FOFA 1L0FA 2XEPA 4LV1A 4UA9A 4HBTA 2EA9A 5EFWA 3TE8A 2R9WA 4D60A 2L4RA 3DTMA 4PKYG 4JGQA 1FCNA 3T12B 4EERA 3ICYA 3LIFA 4R3AA 3CPTA 4OPYA 2WADA 5EM0A 1NY0A 4X55A 3O3VA 4QJGA 3FKVA 3HLEA 1I5QA 2M7UA 3NDEA 3E98A 4PHTA 4WLAA 3VE3A 3A3JA 5J4EA 4GS9A 2P08A 3ZNYA 1FSYA 2EX9A 4DE3A 4GDNA 4O8GA 2PR6A 4WZ4A 4EQ1A 3OCLA 4BD1A 3FWLA 2Y2OA 3G4PA 2CC1A 1ES3A 1MKMA 1LT0A 5M19A 4EU0A 4KZ6A 3HVFA 4M4XA 5JYPA 1LSWA 3GV9A 3VP3A 2J7VA 2L1MA 1GHMA 4AFIA 1T1CA 4WZ5C 3NOPC 3OC2A 3D72A 1AXBA 2XDMA 4U0XA 5FQKA 4JF4A 5AVEA 1HLUP 1ZKJA 3OPLA 3NC8A 5CERA 5FSRA 1DP6A 3FZCA 2P9VB 3PBTA 2ZOIA 3HLCA 1K56D 3W4OA 2M7VA 4O0PA 3KYEA 1OJGA 1IOUA 4H6JB 3CWFA 3LY3A 3MSHA 4HHDA 3FV7A 4Y3IA 2HP9A 3O88A 3F1OB 4CJNA 3WS5A 2XLNA 2ZM2A 3PBNA 2KOIA 2JKTI 4MN7A 4HH3A 3LR4A 1LSVA 2ZC5B 2DNSA 4OQ0A 4UHUA 3LIDA 4EQIA 2FFFB 4PAUA 2E8JA 5TGFA 1KGFA 2VV6A 3W4PA 1KGGA 3QP4A 2W1TB 2VJWA 4WEKA 5HAQA 3UPNA 1LI9A 4F94A 3C30A 3IX3A 4BL3A 4EETB 3W8KA 3QNBA 4I5SA 2V0WA 4IBXA 4X68A 3U4LP 4KZAA 4H8RA 4MEZA 4PM5A 3IHAA 3ZVWA 1U60A 1JNUA 3FPWA 3VMAA 2VLGA 4EESA 4WL9A 3VFFA 2P04A 3C8CA 2V1ZA 3E2KA 3WS0A 4QPRA 4MDZA 3GECA 1PZPA 1K57A 1T19A 1RP5A 3KSIA 5EVIC 2Y2QA 5FAOA 3T1RA 1K54C 3ZG9B 5F6AA 4R70A 2V2FF 4P6BA 4X69A 4Y5FA 4JF5A 3DBAA 2JKFA 1YSPA 2VKSA 4MCWA 4PKYA 4KZ8A 4M3KA 2XK1A 4EUZA 1KVMA 1YT4A 2HDUA 3CUEC 3C4PA 4L0LA 4JGRA 3E0YA 2WGWA 2C6WB 1D1JA 3T50A 2PT7A 3UB8A 5EOEA 3IT9A 4E3IA 2ZLYA 3G6OA 5IU1A 2XFTA 3VP2A 1ACFA 3DTEA 1T1BA 1CEGA 3RH8B 4OQHA 5AJGA 1EWZA 1FCMA 3P09A 1VETB 2ZC6B 5G4ZA 1UGUA 1MWTA 1XFNA 3GDIA 3ZDJA 3IH8A 3IF6C 2W3FA 5FAPA 2O9BA 5DF8A 1CI8A 1K6RA 3EEAA 4Y17A 1NRJA 3MS6A 5CTNA 3S1YA 1G6AA 3EQVA 3N8RA 1TF1A 2XROA 4Y15A 4O7DA 1H8YA 1FILA 5E2FA 1KE4A 3NJAA 1I2SA 3C7UA 4EBPA 1OTDA 4Q0HA 2GNXA 3G2YA 4XT2A 3BRMA 1LL5A 3G31A 4DJ3A 2XFSA 4OOLA 3BFDA 5DKLA 5FQMA 3NI9A 4HJ3A 2OLVA 3T4OA 3ZG8B 5FDSA 4KZ7A 3TG9A 2XGNA 1TEMA 5DTSA 4I3IA 4RQ9A 1D7EA 1MPLA 3NBLA 4DRTA 4ZJ2A 4FCFA 3MQOA 5CX7A 4YWZA 1G28A 4K08A 1KGEA 3NCKA 2HZ5A 2GDNA 4Z1WA 3VV4A 2G2WA 1VM1A 3NDGA 4JKTA 3UMEA 2INWA 5BOHA 5HD5A 3UDFA 2O9AA 4N92A 1K55A 4P0MA 4ARZA 4IBRA 2V20A 4E3NA 1GHIA 1FIKA 5KSCA 4IVKA 3NY4A 5DKKA 3R7WA 5GHXA 2ZC4B 2Z2MB 4NXEA 5GLCA 1SCWA 2HF6A 5DTKA 1OPXA 1YLJA 2V1AA 1OTAA 4GOGA 4HH2A 4CLCC 1TD5A 2WZZA 1TS8A 2UWXA 2OSUA 1Z09A 3VSKA 1YKDA 3FPVA 1XPBA 2WAFA 3NOTC 1BLCA 1K57C 1PZOA 1VEUB 1PI4A 3ZGAB 2V1BA 2IWCA 3ZQ5A 4ZRRA 3UPPA 4ZJ3A 4JXWA 4BL2A 2VV8A 1IYSA 3T1SA 4FH2A 3TJZC 4UEYA 4OPQA 3TRCA 4BLMA 4EBNA 3MKEA 4WUJA 4PM7A 1BULA 3LFVA 4X1MA 1LLBA 4G3VA 1NYYA 2EXAA 3S22A 2PYPA 3NIAA 1XP4A 5CRFA 3T1QB 1IYPA 5A91A 3BW6A 2X02A 5A8BA 1SKFA 3GQZA 1ESIA 4RVAA 5F1GA 1GSVA 3QNCA 2Y2NA 1NLYA 2P9VA 4WMCA 3WS2A 4QB8A 2EX6A 2XD1A 3KYQA 1TS7A 5HWWA 1SKOB 4H6JA 1T1AA 3BWLA 1ZHHB 2P7JA 2A49A 3F1OA 1ZG4A 2BTFP 2H0YA 1A0KA 2QZ6A 4DKIA 4OPZA 5FQ9A 4F3LB 1E25A 4KQOA 5F82A 5HW3A 4B88A 4P85A 1YLPA 2J9PA 3SH9A 2GZAA 4MBKA 3AGFA 4LV2A 5TJJA 2BG1A 2W1TA 4ZAMA 3ZFZA 4X6TA 3WRTA 3ZCZA 1W79A 3MJQA 5HAIA 2A2LA 1KVLA 4S2NA 2PBYA 2Y8HA 3IBRA 1TVFA 3MMHA 4GB7A 4L9EA 4XUZA 2ZMFA 3LR5A 1ONHA 4BBTA 3UO9A 2Z6CA 3V3RA 4C75A 2Y2MA 1K0KA 5G18A 5IT5A 3F1NA 4WBGA 5LBRA 2HJ9C 3RJUA 3HUOA 5KSHA 1S4RA 4BMWA 3ZHHA 3GRJA 3LIBA 4YFMA 4K91A 1V9YA 4DJ2A 4C6YA 2HJEA 3H7WA 2QKPA 1N9LA 3HBRA 2MJ6A 2VA0A 4GW9A 4DE1A 2PR5A 1RGYA 4UA7A 5CHMA 3UE1A 4NK3A 3N6IA 3A3EA 1S4SA 1XJ4A 4OLGA 3BFFA 3UPOA 4Y0UA 5KIZA 2J3TD 3DAVA 5GHZA 1XJ3A 5MC7A 1M40A 3T1XA 1TS0A 4FD8A 1VETA 5AQ7A 2Y2GA 1ALQA 4ESPA 4ETZA 3GSGA 4MBHA 3VP4A 3QP8A 3ZYTA 1JWZA 3Q07A 4U0TA 1NJ4A 4MBFA 5FEFA 2GJ3A 1IEMA 3LY4A 2JKRM 4U3TA 3MXQA 2ZM8A 4GLQA 3UDIA 3R4KA 1VHMA 3QP6A 2JKGA 2W1RA 2Y79A 3A3DA 1UWPX 5FATA 4IUHA 4R38A 2V8CA 5HDDA 4CPKA 5HARA 1DY6A 3M6BA 3SW1A 4OKPA 3UNWA 1XGJA 1XA1A 1ONGA 4S2PA 4GCZA 3GR2A 2FFYA 2H28A 1O07A 3UY6A 1P0ZA 1SHVA 1YLTA 3Q7VB 3VOYA 3MFXA 1BT5A 2HP6A 1IKIA 1PWCA 1HTZA 2PHYA 4KZ5A 4B4XA 4HI4A 5A92A 5HWTA 3NECA 3HLWA 2KX6A 1OT6A 5HAPA 3CJMA 3BQAA 3KX0X 1UWNX 2WKHA 5F83A 3HCYA 1BTLA 1WYBA 4PM6A 2R9XA 3T4KA 4A5RA 3BJNA 4S2MA 5C5KA 1Y4OA 1GSWA 5KMWA 2I72A 3WWXA 4WMCD 3MZDA 2PD7A 3IWQA 2VK3A 3L9KA 4PMAA 3MQ0A 5E2HA 4KZ4A 3ITAA 4NEED 2OWJA 1F9IA 4LENA 1H8MA 3IQAA 5I94A 1PW8A 1ZTUA 4GN2A 1CJFA 1F98A 2X01A 1VEUA 4HOIA 2WAEA 4MNRA 2WZXA 3FKWA 5GL9A 1DJBA 3IF5A 4LLOB 1PIOA 3F1NB 4OH0A 4WM9A 4PM8A 4EW7A 4HQAA 4B93A 3Q7ZA 2HDRA 2WKPA 2FH5A 4OQIA 5E2GA 4IVIA 4R4SA 3P98A 4UAAA 5GHYA 2Y91A 2PU4A 5FQIA 4JBFA 2ZM0A 2PDRA 3PBOA 4XUXA 3BQ8A 2LB9A 3H7WB 3BFGA 1LI0A 4I38A 3UE6A 3GVBA 1IKGA 4WF0A 4BD0A 3EGXC 5L10A 1Y54A 4LRZE 3EGDC 1L3LA 3N7WA 2WKQA 3VE4A 4ETXA 2ZD8A 5IHVA 1GA9A 4P87A 1K25A 5EVIB 1SKOA 1NYMA 1XJ2A 1MY8A 3VFHA 1RGZA 3ZG5A 4N1XA 3PR6A 1PWDA 4R0QA 2VX8A 4B4ZA 1HZOA 1PYYA 1XXMA 3MXRA 5CHJA 2OAP1 3BECA 4F3LA 3V67A 2O0YA 5GLAA 1ES4A 2FZ0A 4DDSA 4OLDA 4N9KA 3LI9A 5HZHA 3MXSA 1KOUA 1DP8A 1ES2A 4GD6A 3FG8A 4EEPA 1W5DA 1E3UA 2IA2A 4OOMA 5FEGA 4O01A 4HP4A 4EUVA 3IF6B 2XF3A 4NXBA 1F2KA 4KG6A 2EWVA 4BJPA 5HSQA 2VV7A 5J7EA 3HLGA 3M2KA 4K0XA 4Q8IA 4BBUA 1H0MA 3HLFA 5CEBA 2DCFA 3AGDA 4EEUA 3PBQA 3E4QA 2QPNA 3PAEA 5TFQA 1N9NA 4NXGA 5AQBA 1BLSA 3S4XA 2V8FA 1PRQA 1PW1A 1BLHA 3LGOA 1CQAA 1S1YA 3OPPA 3T4LA 5EOOA 4NKPA 1JWVA 2KLIA 4HJ6A 1G5UA 2XRNA 5EV0A 1N9BA 2Q0OA 5CEDA 4ZJ1A 4S2LA 3BLSA 1SZVA 3OCNA 1P97A 1OJ5A 3LO7A 1YQSA 2A24B 5HD3A 3EWKA 1LHYA 1EW0A 4MN5A 3OBFA 1STZA 1HVBA 1W7FA 5CECA 3PBSA 4UQIS 4LCMA 1KE0A 1J9MA 4R6LA 4KUKA 4MLLA 1XKZA 2ZQDA 3DTIA 5E43A 1S0WA 1XJ6A 2H0TA 1BSGA 1K4EA 2OAQ1 3CHWP 2R78A 3LCEA 5CXWA 3O86A 4RYEA 1FQGA 1MWSA 3BY9A 4NETA 5HPFA 2O9CA 1GA0A 5FASA 3IXGA 2E8IA 4CLCB 4KZ3A 4HBUA 5CHUA 3E4PA 1OMEA 3VOZA 1XA7A 1QMFA 3ULFA 2KDKA 2M1CA 2H10A 1LSXA 5DFYA 4JPMA 4R1GA 1H3QA 3LIAA 1YLZA 2WKIA 4S2KA 5CGXA 5FL3A 4DE0A 4Y7PA 2J8YA 4UA6A 3TSGA 1ODVA 3DWZA 3IS2B 5HL6A 1MXOA 3Q7VA 3C4OA 4FH4A 3E4OA 2V0UA 5F5YA 3IX4A 5L09A 5EECA 4EXOA 1S66L 3MQQA 4HIAA 4MN6A 3DTKA 5CGWA 1BYWA 5DF7A 4ID4A 1KE3A 4EV4A 4OP5A 5L07A 4WZ5A 4FUWA 1MBLA 4E3OA 4E3MA 4HNBA 1WA9A 4ZBEA 4GZBA 3QP2A 3UMDA 4DF6A 2WGIA 1DJCA 1ESUA 1W8YA 4JLFA 3MR0A 1IYQA 2ZJ9A 1JVJA 4IEDA 3V3SA 4JXVA 1ZC2A 4GNUA 3JVUA 1FR6A 1G68A 2D02A 1K4FA 3A0SA 4QWOA 2XA7M 2Y59A 3RTYA 3OLOA 4HY8A 4GJ4A 3ZG0A 4K0WA 2NUPC 3CG5A 3SS3A 2J3TC 2Y55A 4WELA 3IH9A 4GHIB 4E3LA 4E6WA 3BY8A 1ES5A 3BYDA 3C38A 5GLBA 1K55C 1EROA 3T4TA 3U2AA 3TOIA 3UE0A 4QU3A 3VOLA 1JTDA 4YINA 3A0RA 3LIEA 1EI5A 4Y2FA 4RX2A 3HREA 4G3KA 3Q82A 1E3UD 1K38A 5GLDA 5FI2A 3DWKA 3IX8A 4GKUA 3Q81A 4JF6A 4I3JA 5HFOA 3IXDA 1W63M 4KZBA 2PRFA 1ZG6A 4IJGA 5DFXA 4KQDA 2JCHA 3W2ZA 3KSGA 5HPIA 2ZQAA 2ZMAA 2IWBA 3EEHA 3IBJA 3V5MA 2V9AA 4ME4A 3S7OA 5EVIA 4ZTKA 3UB7A 5AQ9A 1PWGA 5EUAA 4B9OA 1K54A 3A0VA 4LPZA 4DN0A 1OTEA 1JTGA 2ZBBA 2BASA 1MKIA 2HP5A 4S2OA 1IYOA 3NULA 1L0EA 3LR0A 3CAXA 2PD8A 3CUEA 2VGJA 2O99A 4CQHA 3KO6A 3SH8A 3B3XA 1OTIA 4ZDXA 4WN5A 2L0WA 4R3BA 3BLMA 4LGWA 1LL9A 3WRZA 5EVLA 2YKFA 4YNRA 3CZDA 2W3DA 3MFDA 3G35A 2JKTM 4Q0JA 3IF6A 3IXBA 4OPRA 5EE8A 3SS5A 4R3JA 4RA7A 3DW0A 3KSFA 1I2WA 1O7EA 2XA7S 4KUOA 1NXYA 2W3GA 4Y13A 3QP5A 2PAVP 4QHCA 4X25A 1CI9A 4S2IA 3F1PB 3C7VA 2Y2HA 2NUTC 4X56A 1YLWA 4JXSA 4LV3A 1J3WA 2JKRI 5IS1A 1Q2QA 2EFUA 2Y2KA 3CLOA 1HD8A 3VP0A 3QHYA 3W4QA 1TDLA 2ACGA 5EVEA 4P6ZS 3VP1A 4S2NC 2ZL1B 1S67L 3UB5P 3HJIA 1AWIA 4GD8A 4R23A 3L7HA 3LEQA 4KG2A 2QJ7A 2X71A 3G32A 2XQZA 4MMNA 3GMWA 3LEZA 5TBMB 2A24A 2D01A 4GDBA 3MKFA 2ZQ8A 3ISGA 3LUQA 5A90A 2PYRA 1NRFA 1CEFA 1JWPA 3BEBA 5AQAA 3IXHA 1ERQA 5DTTA 1K6SA 3P01A 3MBZA 4II7A 1YMXA 1YSQA 1OT9A 1CK3A 2XR0A 1VB6A 2WGVA 1P9WA 4KG5A 5J3WA 3M2JA 3AGEA 1P9RA 5D3OA 3Q1FA 2CMNA 2JE5A 2HDQA 3S7NA 4DXCA 3SZTA 3KSHA 1Z6FA 3K3CA 5EM1A 5FQJA 4CLCA 3D4FA 3T4JA 3PYPA 1T18A 4FTXA 3HLDA 1L0GA 1CF0A 4DMZA 1KDSA 1L0DA 2QYBA 3V50A 3H82B 2Y4AA 3JVVA 3CI6A 2Z2LB 2B18A 3LYXA 2ZQCA 2EX2A 3A3IA 1M6KA 4KENB 3WS1A 1XX2A 5DJUA 3LICA 3IS2A 3KYZA 3MZEA 3I7JA 4UQIM 5DF9A 4N1HA 3FYZA 4E04A 3IHBA 4DDYA 5FQQA 3NHQA 2VEAA 3JYIA 5FI6A 5CGSA 3SS4A 3BM6A 3RFBA 4Y0OA 4JXGA 4DE2A 3OOVA 2ZC3B 3A3FA 3JPUA 4HEFA 1MZUA 2HGVA 3UB9A 3P7NA 2WYXA 2ZQ9A 3CPTB 1ERMA 3IWIA 3D3OA 1NZUA 3S7PA 4DXBA 3C5AA 2OLUA 5G4YA 4QY6A 5E2EA 1BLPA 2G7UA 3G30A 1IFQA 4GS9B 2Q9NA 3EQUA 2ZOHA 5TR7A 4OP8A 3HL9A 5EVID 4S2JA 2HDSA 3OPRA 4FSFA 1S1ZA 4CLCE 1MWUA 2LB5A 4E3KA 5FDHA 1GHPA 3B33A 2EXBA 4HJ4A 3PTEA 4OQGA 2J80A 1DP9A 1Y28A 4X1LA 3SH7A 2VGKA 1GSXA 4GHIA 3HUNA 5HDCA 2PU2A 5FA7A 3UB6A 2H5SA 2JHEA 4KQQA 1YAXA 5A93A 2K2NA 4BBVA 2EX8A 2VGLM 3LR3A 4PPRA 4G3WA 3PHYA 2ZQ7A 3V39A 4NXFA 5DVAA 4QY5A 1F5MA 1W8QA 1D06A 1FSWA 3T4QA 1TS6A 1BZAA 2IWDA 2Y2LA 3QP1A 2YKHA 3HUMA 1X0OA 1FOFA 3CITA 1FR1A 5L2FA 5JYOA 3BFEA 3ZVTA 2QHKA 3K2NA 3EOIA 3S7QA 2Q9MA 1NLZA 2WKEA 1WE4A 2B02A 3T4SA 3E2LA 5K5BA 2VZWA 1LL8A 3G34A 3RXXA 3OPHA 1PNEA 3IWOA 1QMEA 2HPBA 1RCJA 4NG2A 3VSLA 4E3JA 2G2UA 2JBFA 4XXRA 2ZC7A 3OZHA 3C2WA 3G2ZA 3PXPA 5HDSA 3N4IA 1XGIA 2XD5A 4OVDA 2UV0E 3ZG7B 5FI7A 4WEJA 1TDGA 2C5WB 2P74A 1VQQA 4L9FA 5FAQA 1S6RA 5J8XA 1KDWA 1N4OA 1DJAA 4I3AA 5HWVA 3ZNTA 4Y0TA 1OTBA 4BWIA 3UDXA 2WUQA 3B42A 2Y2IA 1NZOA 3M6HA 1YLYA 4WYYA 4OONA 1WYCA 1YM1A 2JC7A 5DJTA 5F1FA 2Y2PA 2OOLA 1IELA 2BLSA 1E4DA 4X53A 2Z6DA 4HESA 4OOYA 3TW8A 2EFXA 1K56A 2B95A 4YOFA 4D2OA 1L2SA 2JN7A 4RX3A 4IUKA 1SDNA 3HLBA 2QMIA 1Q2PA 3N8SA 1W63Q 2DRWA 4CLCD 4JGOA 1YPRA 2XSSA 1DRMA 4BENA 3F1PA 3D9YA 3N8LA 1SDEA 2WGWB 3BFCA 4QD4A 2K31A 1H5XA 2W27A 2VGLS 5EPHA 3K3DA 1V9ZA 3O87A 4LCLA 3B47A 4R4RA 4L9GA 4EWFA 5HL1A 2ZL1A 3CMZA 3NOUC 1PFLA 2DMWA 1N9OA 3SOIA 3MZFA 5TBMA
chains in the Genus database with same CATH topology
3PBOA 2A3UA 1LL9A 4IBRA 3WRZA 2V20A 4XUXA 5EVLA 3PBRA 4E6XA 3BFGA 4E3NA 3CZDA 1LI0A 1GHIA 3GVBA 3MFDA 3G35A 1IKGA 5M1AA 5KSCA 4IVKA 4Z9QA 3NY4A 1BUEA 4BD0A 1C3BA 5GHXA 3IF6A 3IXBA 1Y54A 2Z2MB 2ZC4B 4OPRA 1GCEA 5GLCA 1SCWA 5EE8A 1PI5A 3SS5A 5DTKA 4R3JA 2J9OA 4RA7A 3DW0A 1YLJA 4PM9A 1I2WA 1O7EA 4GOGA 2WZZA 1H8ZA 1NXYA 2UWXA 3N7WA 2OSUA 3PAGA 3WS4A 2ZD8A 5IHVA 1GA9A 4P87A 1K25A 4QHCA 3VSKA 5EVIB 1CI9A 4S2IA 4KQRA 4EBLA 5U47A 2Y2JA 3C7VA 1NYMA 2Y2HA 4X56A 1XPBA 1YLWA 2WAFA 4JXSA 1MY8A 4LV3A 3VFHA 1BLCA 3UN7A 3RXWA 1K57C 1RGZA 3ZG5A 1PZOA 1PI4A 1Q2QA 2EFUA 2Y2KA 4N1XA 1PWDA 3ZGAB 4R0QA 2OV5A 2IWCA 4B4ZA 3UE3A 1HZOA 1PYYA 1XXMA 4N9LA 3MXRA 1HD8A 3UPPA 3VP0A 5CTMA 5CHJA 3QHYA 3GTCA 3BECA 3W4QA 4ZJ3A 4JXWA 4BQMA 1TDLA 4BL2A 5KZHA 3VP1A 1IYSA 4FH2A 4S2NC 5GLAA 1ES4A 4KZ9A 4OPQA 2RL3A 4LV0A 4R23A 4GD8A 4BLMA 4EBNA 4KG2A 3MKEA 4PM7A 1BULA 2WK0A 4DDSA 1LLBA 4OLDA 4N9KA 1NYYA 2X71A 3G32A 5M18A 1MWRA 2EXAA 2XQZA 3MXSA 3S22A 3GMWA 5HX9A 3LEZA 2RCXA 4GDBA 3MKFA 1ES2A 4GD6A 2ZQ8A 3ISGA 1FCOA 1W5DA 1E3UA 3NIAA 5A90A 1XP4A 3ITBA 5CRFA 4OOMA 1YMSA 1NRFA 1IYPA 1CEFA 1JWPA 5A91A 3BEBA 5AQAA 4C3QA 3IXHA 1ERQA 2XH9A 2B5RA 2X02A 3IF6B 1L0FA 2XF3A 2XEPA 1K6SA 1SKFA 4HBTA 4LV1A 4UA9A 3GQZA 1ESIA 3MBZA 4KG6A 2R9WA 1YMXA 4RVAA 5F1GA 4BJPA 1CK3A 3DTMA 3QNCA 3HLGA 2XR0A 2Y2NA 3M2KA 2P9VA 4K0XA 4Q8IA 2WGVA 1FCNA 4WMCA 3WS2A 4QB8A 2EX6A 3HLFA 4KG5A 2XD1A 3M2JA 5CEBA 2DCFA 3AGDA 4OPYA 2WADA 3AGEA 5D3OA 3Q1FA 1NY0A 3PBQA 2QPNA 2JE5A 4X55A 2HDQA 3O3VA 4QJGA 4DXCA 2A49A 3FKVA 3PAEA 1Z6FA 5FQJA 1ZG4A 3HLEA 1I5QA 3D4FA 2H0YA 3NDEA 5TFQA 2QZ6A 3A3JA 5AQBA 1BLSA 4DKIA 3S4XA 3ZNYA 1FSYA 2EX9A 3HLDA 1L0GA 4DE3A 1PW1A 1BLHA 4GDNA 4OPZA 5FQ9A 3OPPA 5EOOA 1KDSA 1E25A 1JWVA 1L0DA 4KQOA 5F82A 4WZ4A 3V50A 2Y4AA 5HW3A 2Z2LB 1N9BA 4B88A 4P85A 3OCLA 1YLPA 5CEDA 4ZJ1A 2J9PA 2ZQCA 4S2LA 3SH9A 2EX2A 3BLSA 4BD1A 3A3IA 3OCNA 3FWLA 2Y2OA 1M6KA 3AGFA 3G4PA 4KENB 4LV2A 3LO7A 4MBKA 1YQSA 2BG1A 1XX2A 3WS1A 2CC1A 4ZAMA 3ZFZA 1ES3A 4X6TA 5M19A 3MZEA 3ZCZA 1W79A 4KZ6A 3I7JA 1LHYA 3HVFA 4N1HA 5DF9A 3GV9A 5HAIA 3VP3A 5JYPA 2J7VA 1GHMA 1KVLA 4S2NA 3FYZA 3IHBA 4WZ5C 4DDYA 3OC2A 2PBYA 4U0XA 1AXBA 2XDMA 5FQKA 1HVBA 1W7FA 5CECA 1TVFA 4JF4A 3PBSA 5FQQA 4LCMA 3JYIA 5FI6A 1ZKJA 5CGSA 4GB7A 1KE0A 1J9MA 3BM6A 3SS4A 3OPLA 3NC8A 4Y0OA 4JXGA 4XUZA 4MLLA 1XKZA 2ZQDA 5CERA 5FSRA 5E43A 3FZCA 4DE2A 1S0WA 2H0TA 2P9VB 2ZC3B 1BSGA 3PBTA 3A3FA 4HEFA 1ONHA 1K4EA 3HLCA 3UO9A 3V3RA 4C75A 1K56D 2Y2MA 3W4OA 3LCEA 2WYXA 5CXWA 2ZQ9A 3O86A 1ERMA 3IWIA 4RYEA 1FQGA 1MWSA 5G18A 1NZUA 4NETA 4WBGA 3LY3A 1GA0A 5FASA 3FV7A 2HP9A 3O88A 4CJNA 3IXGA 3WS5A 2E8IA 3C5AA 4DXBA 2OLUA 2XLNA 2ZM2A 3PBNA 3HUOA 3RJUA 5KSHA 4KZ3A 4QY6A 5E2EA 1BLPA 3G30A 4HBUA 5CHUA 2ZC5B 2Q9NA 3EQUA 3GRJA 1OMEA 5TR7A 4YFMA 4K91A 2DNSA 3VOZA 3ZHHA 4OP8A 3HL9A 1XA7A 1QMFA 4OQ0A 5EVID 4C6YA 4UHUA 4S2JA 2H10A 4EQIA 2HDSA 3OPRA 2FFFB 4FSFA 4JPMA 3HBRA 4R1GA 5TGFA 1YLZA 1MWUA 2WKIA 4S2KA 5CGXA 4DE1A 4E3KA 5FDHA 1RGYA 1GHPA 4UA7A 2EXBA 5CHMA 1KGFA 4NK3A 3UE1A 3W4PA 1KGGA 4DE0A 4Y7PA 2J8YA 3N6IA 3PTEA 4OQGA 3A3EA 4WEKA 4OLGA 4UA6A 3TSGA 3SH7A 2VGKA 3BFFA 3DWZA 3UPOA 1MXOA 3HUNA 5HAQA 3Q7VA 3UPNA 2PU2A 5FA7A 1LI9A 2H5SA 3C4OA 4Y0UA 4FH4A 4F94A 4KQQA 5A93A 2EX8A 4BL3A 4PPRA 5GHZA 1M40A 2ZQ7A 3V39A 5EECA 3W8KA 3QNBA 5DVAA 4FD8A 4QY5A 4IBXA 4X68A 4KZAA 2Y2GA 5AQ7A 1W8QA 4H8RA 5CGWA 5DF7A 1FSWA 4ID4A 1ALQA 1KE3A 4MEZA 4PM5A 1BZAA 2IWDA 3IHAA 1U60A 3GSGA 4MBHA 3VMAA 3ZVWA 4EV4A 4OP5A 3VFFA 4WZ5A 3VP4A 2Y2LA 2V1ZA 3E2KA 3WS0A 1JWZA 3Q07A 4U0TA 1NJ4A 4MBFA 1MBLA 3HUMA 4E3OA 4E3MA 1FOFA 1FR1A 1IEMA 4ZBEA 4GZBA 5JYOA 5L2FA 3LY4A 4DF6A 3BFEA 3ZVTA 2WGIA 4U3TA 1DJCA 1PZPA 2ZM8A 1K57A 3UDIA 1ESUA 1RP5A 5EVIC 1W8YA 2Y2QA 5FAOA 4JLFA 2Q9MA 1K54C 3ZG9B 1IYQA 3A3DA 2WKEA 2ZJ9A 1WE4A 1JVJA 4IEDA 5FATA 4JXVA 3V3SA 3E2LA 2V2FF 1ZC2A 4P6BA 4X69A 4GNUA 4JF5A 3RXXA 3G34A 5DTTA 3OPHA 4CPKA 3IWOA 1FR6A 1G68A 4KZ8A 1QMEA 2HPBA 1RCJA 5HARA 3VSLA 4E3JA 4M3KA 2G2UA 2JBFA 1K4FA 1DY6A 4XXRA 2XK1A 3M6BA 2ZC7A 4EUZA 3OZHA 4OKPA 1KVMA 1YT4A 3UNWA 1XGJA 2HDUA 1XA1A 1ONGA 2Y59A 3G2ZA 4S2PA 3GR2A 3C4PA 4L0LA 2FFYA 2WGWA 3N4IA 1O07A 2C6WB 1XGIA 3ZG0A 3UY6A 4K0WA 2XD5A 3CG5A 3SS3A 2Y55A 4OVDA 1SHVA 4WELA 3IH9A 3ZG7B 4E3LA 1YLTA 4E6WA 5FI7A 3Q7VB 3VOYA 4WEJA 1ES5A 1TDGA 3BYDA 5EOEA 2C5WB 3IT9A 1BT5A 5GLBA 2ZLYA 4E3IA 2P74A 1K55C 1EROA 2HP6A 1VQQA 1IKIA 5FAQA 1S6RA 1PWCA 1KDWA 1N4OA 2XFTA 1DJAA 3TOIA 3UE0A 3VP2A 5J8XA 3ZNTA 1HTZA 4QU3A 1CEGA 4KZ5A 4B4XA 4OQHA 1EWZA 4Y0TA 1JTDA 5A92A 1FCMA 3P09A 4YINA 1EI5A 2WUQA 2ZC6B 3UDXA 4RX2A 3HREA 1MWTA 2Y2IA 3Q82A 3ZDJA 1E3UD 1NZOA 1K38A 3M6HA 1YLYA 3HLWA 3IF6C 3DWKA 3IH8A 4WYYA 5FI2A 5GLDA 5HAPA 5FAPA 3CJMA 4GKUA 4OONA 5DF8A 1WYCA 3Q81A 1YM1A 1CI8A 2JC7A 4JF6A 1K6RA 5F1FA 5HFOA 2WKHA 5F83A 2Y2PA 3IXDA 5CTNA 3S1YA 1BTLA 1G6AA 1IELA 3EQVA 3N8RA 2BLSA 4KZBA 1E4DA 4X53A 1WYBA 4PM6A 4HESA 4OOYA 2R9XA 2EFXA 1K56A 4O7DA 1ZG6A 4S2MA 1H8YA 4A5RA 5E2FA 1KE4A 5KMWA 2I72A 3WWXA 4WMCD 3MZDA 2JCHA 4D2OA 1I2SA 1L2SA 3C7UA 4EBPA 3IWQA 4RX3A 2ZQAA 4PMAA 2ZMAA 2IWBA 3G2YA 5E2HA 1SDNA 3ITAA 4KZ4A 3BRMA 3HLBA 3V5MA 2QMIA 1LL5A 3G31A 1Q2PA 2XFSA 3N8SA 4OOLA 3BFDA 2DRWA 5EVIA 5FQMA 4ZTKA 3NI9A 4LENA 5AQ9A 2OLVA 1PWGA 4BENA 3IQAA 5EUAA 5I94A 1PW8A 1K54A 3N8LA 1SDEA 3ZG8B 2WGWB 3BFCA 4QD4A 4KZ7A 3TG9A 4GN2A 1H5XA 1JTGA 2XGNA 1TEMA 2X01A 2WAEA 4MNRA 5DTSA 5EPHA 1MPLA 2WZXA 3FKWA 3NBLA 3O87A 4DRTA 4ZJ2A 1MKIA 4FCFA 4LCLA 2HP5A 5GL9A 4S2OA 1IYOA 1DJBA 1L0EA 1KGEA 3IF5A 3NCKA 4R4RA 2VGJA 1PIOA 2GDNA 4OH0A 4WM9A 2G2WA 4PM8A 4EWFA 1VM1A 3Q7ZA 5HL1A 2HDRA 3CMZA 3SH8A 3NDGA 4JKTA 4OQIA 5E2GA 4IVIA 4R4SA 3P98A 4UAAA 5GHYA 5BOHA 2Y91A 2PU4A 3B3XA 4ZDXA 5FQIA 4JBFA 3UDFA 4N92A 2ZM0A 3BLMA 4R3BA 1K55A 3SOIA 4P0MA 3MZFA 3WRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBO A;  2A3U A;  1LL9 A;  4IBR A;  3WRZ A;  2V20 A;  4XUX A;  5EVL A;  3PBR A;  4E6X A;  3BFG A;  4E3N A;  3CZD A;  1LI0 A;  1GHI A;  3GVB A;  3MFD A;  3G35 A;  1IKG A;  5M1A A;  5KSC A;  4IVK A;  4Z9Q A;  3NY4 A;  1BUE A;  4BD0 A;  1C3B A;  5GHX A;  3IF6 A;  3IXB A;  1Y54 A;  2Z2M B;  2ZC4 B;  4OPR A;  1GCE A;  5GLC A;  1SCW A;  5EE8 A;  1PI5 A;  3SS5 A;  5DTK A;  4R3J A;  2J9O A;  4RA7 A;  3DW0 A;  1YLJ A;  4PM9 A;  1I2W A;  1O7E A;  4GOG A;  2WZZ A;  1H8Z A;  1NXY A;  2UWX A;  3N7W A;  2OSU A;  3PAG A;  3WS4 A;  2ZD8 A;  5IHV A;  1GA9 A;  4P87 A;  1K25 A;  4QHC A;  3VSK A;  5EVI B;  1CI9 A;  4S2I A;  4KQR A;  4EBL A;  5U47 A;  2Y2J A;  3C7V A;  1NYM A;  2Y2H A;  4X56 A;  1XPB A;  1YLW A;  2WAF A;  4JXS A;  1MY8 A;  4LV3 A;  3VFH A;  1BLC A;  3UN7 A;  3RXW A;  1K57 C;  1RGZ A;  3ZG5 A;  1PZO A;  1PI4 A;  1Q2Q A;  2EFU A;  2Y2K A;  4N1X A;  1PWD A;  3ZGA B;  4R0Q A;  2OV5 A;  2IWC A;  4B4Z A;  3UE3 A;  1HZO A;  1PYY A;  1XXM A;  4N9L A;  3MXR A;  1HD8 A;  3UPP A;  3VP0 A;  5CTM A;  5CHJ A;  3QHY A;  3GTC A;  3BEC A;  3W4Q A;  4ZJ3 A;  4JXW A;  4BQM A;  1TDL A;  4BL2 A;  5KZH A;  3VP1 A;  1IYS A;  4FH2 A;  4S2N C;  5GLA A;  1ES4 A;  4KZ9 A;  4OPQ A;  2RL3 A;  4LV0 A;  4R23 A;  4GD8 A;  4BLM A;  4EBN A;  4KG2 A;  3MKE A;  4PM7 A;  1BUL A;  2WK0 A;  4DDS A;  1LLB A;  4OLD A;  4N9K A;  1NYY A;  2X71 A;  3G32 A;  5M18 A;  1MWR A;  2EXA A;  2XQZ A;  3MXS A;  3S22 A;  3GMW A;  5HX9 A;  3LEZ A;  2RCX A;  4GDB A;  3MKF A;  1ES2 A;  4GD6 A;  2ZQ8 A;  3ISG A;  1FCO A;  1W5D A;  1E3U A;  3NIA A;  5A90 A;  1XP4 A;  3ITB A;  5CRF A;  4OOM A;  1YMS A;  1NRF A;  1IYP A;  1CEF A;  1JWP A;  5A91 A;  3BEB A;  5AQA A;  4C3Q A;  3IXH A;  1ERQ A;  2XH9 A;  2B5R A;  2X02 A;  3IF6 B;  1L0F A;  2XF3 A;  2XEP A;  1K6S A;  1SKF A;  4HBT A;  4LV1 A;  4UA9 A;  3GQZ A;  1ESI A;  3MBZ A;  4KG6 A;  2R9W A;  1YMX A;  4RVA A;  5F1G A;  4BJP A;  1CK3 A;  3DTM A;  3QNC A;  3HLG A;  2XR0 A;  2Y2N A;  3M2K A;  2P9V A;  4K0X A;  4Q8I A;  2WGV A;  1FCN A;  4WMC A;  3WS2 A;  4QB8 A;  2EX6 A;  3HLF A;  4KG5 A;  2XD1 A;  3M2J A;  5CEB A;  2DCF A;  3AGD A;  4OPY A;  2WAD A;  3AGE A;  5D3O A;  3Q1F A;  1NY0 A;  3PBQ A;  2QPN A;  2JE5 A;  4X55 A;  2HDQ A;  3O3V A;  4QJG A;  4DXC A;  2A49 A;  3FKV A;  3PAE A;  1Z6F A;  5FQJ A;  1ZG4 A;  3HLE A;  1I5Q A;  3D4F A;  2H0Y A;  3NDE A;  5TFQ A;  2QZ6 A;  3A3J A;  5AQB A;  1BLS A;  4DKI A;  3S4X A;  3ZNY A;  1FSY A;  2EX9 A;  3HLD A;  1L0G A;  4DE3 A;  1PW1 A;  1BLH A;  4GDN A;  4OPZ A;  5FQ9 A;  3OPP A;  5EOO A;  1KDS A;  1E25 A;  1JWV A;  1L0D A;  4KQO A;  5F82 A;  4WZ4 A;  3V50 A;  2Y4A A;  5HW3 A;  2Z2L B;  1N9B A;  4B88 A;  4P85 A;  3OCL A;  1YLP A;  5CED A;  4ZJ1 A;  2J9P A;  2ZQC A;  4S2L A;  3SH9 A;  2EX2 A;  3BLS A;  4BD1 A;  3A3I A;  3OCN A;  3FWL A;  2Y2O A;  1M6K A;  3AGF A;  3G4P A;  4KEN B;  4LV2 A;  3LO7 A;  4MBK A;  1YQS A;  2BG1 A;  1XX2 A;  3WS1 A;  2CC1 A;  4ZAM A;  3ZFZ A;  1ES3 A;  4X6T A;  5M19 A;  3MZE A;  3ZCZ A;  1W79 A;  4KZ6 A;  3I7J A;  1LHY A;  3HVF A;  4N1H A;  5DF9 A;  3GV9 A;  5HAI A;  3VP3 A;  5JYP A;  2J7V A;  1GHM A;  1KVL A;  4S2N A;  3FYZ A;  3IHB A;  4WZ5 C;  4DDY A;  3OC2 A;  2PBY A;  4U0X A;  1AXB A;  2XDM A;  5FQK A;  1HVB A;  1W7F A;  5CEC A;  1TVF A;  4JF4 A;  3PBS A;  5FQQ A;  4LCM A;  3JYI A;  5FI6 A;  1ZKJ A;  5CGS A;  4GB7 A;  1KE0 A;  1J9M A;  3BM6 A;  3SS4 A;  3OPL A;  3NC8 A;  4Y0O A;  4JXG A;  4XUZ A;  4MLL A;  1XKZ A;  2ZQD A;  5CER A;  5FSR A;  5E43 A;  3FZC A;  4DE2 A;  1S0W A;  2H0T A;  2P9V B;  2ZC3 B;  1BSG A;  3PBT A;  3A3F A;  4HEF A;  1ONH A;  1K4E A;  3HLC A;  3UO9 A;  3V3R A;  4C75 A;  1K56 D;  2Y2M A;  3W4O A;  3LCE A;  2WYX A;  5CXW A;  2ZQ9 A;  3O86 A;  1ERM A;  3IWI A;  4RYE A;  1FQG A;  1MWS A;  5G18 A;  1NZU A;  4NET A;  4WBG A;  3LY3 A;  1GA0 A;  5FAS A;  3FV7 A;  2HP9 A;  3O88 A;  4CJN A;  3IXG A;  3WS5 A;  2E8I A;  3C5A A;  4DXB A;  2OLU A;  2XLN A;  2ZM2 A;  3PBN A;  3HUO A;  3RJU A;  5KSH A;  4KZ3 A;  4QY6 A;  5E2E A;  1BLP A;  3G30 A;  4HBU A;  5CHU A;  2ZC5 B;  2Q9N A;  3EQU A;  3GRJ A;  1OME A;  5TR7 A;  4YFM A;  4K91 A;  2DNS A;  3VOZ A;  3ZHH A;  4OP8 A;  3HL9 A;  1XA7 A;  1QMF A;  4OQ0 A;  5EVI D;  4C6Y A;  4UHU A;  4S2J A;  2H10 A;  4EQI A;  2HDS A;  3OPR A;  2FFF B;  4FSF A;  4JPM A;  3HBR A;  4R1G A;  5TGF A;  1YLZ A;  1MWU A;  2WKI A;  4S2K A;  5CGX A;  4DE1 A;  4E3K A;  5FDH A;  1RGY A;  1GHP A;  4UA7 A;  2EXB A;  5CHM A;  1KGF A;  4NK3 A;  3UE1 A;  3W4P A;  1KGG A;  4DE0 A;  4Y7P A;  2J8Y A;  3N6I A;  3PTE A;  4OQG A;  3A3E A;  4WEK A;  4OLG A;  4UA6 A;  3TSG A;  3SH7 A;  2VGK A;  3BFF A;  3DWZ A;  3UPO A;  1MXO A;  3HUN A;  5HAQ A;  3Q7V A;  3UPN A;  2PU2 A;  5FA7 A;  1LI9 A;  2H5S A;  3C4O A;  4Y0U A;  4FH4 A;  4F94 A;  4KQQ A;  5A93 A;  2EX8 A;  4BL3 A;  4PPR A;  5GHZ A;  1M40 A;  2ZQ7 A;  3V39 A;  5EEC A;  3W8K A;  3QNB A;  5DVA A;  4FD8 A;  4QY5 A;  4IBX A;  4X68 A;  4KZA A;  2Y2G A;  5AQ7 A;  1W8Q A;  4H8R A;  5CGW A;  5DF7 A;  1FSW A;  4ID4 A;  1ALQ A;  1KE3 A;  4MEZ A;  4PM5 A;  1BZA A;  2IWD A;  3IHA A;  1U60 A;  3GSG A;  4MBH A;  3VMA A;  3ZVW A;  4EV4 A;  4OP5 A;  3VFF A;  4WZ5 A;  3VP4 A;  2Y2L A;  2V1Z A;  3E2K A;  3WS0 A;  1JWZ A;  3Q07 A;  4U0T A;  1NJ4 A;  4MBF A;  1MBL A;  3HUM A;  4E3O A;  4E3M A;  1FOF A;  1FR1 A;  1IEM A;  4ZBE A;  4GZB A;  5JYO A;  5L2F A;  3LY4 A;  4DF6 A;  3BFE A;  3ZVT A;  2WGI A;  4U3T A;  1DJC A;  1PZP A;  2ZM8 A;  1K57 A;  3UDI A;  1ESU A;  1RP5 A;  5EVI C;  1W8Y A;  2Y2Q A;  5FAO A;  4JLF A;  2Q9M A;  1K54 C;  3ZG9 B;  1IYQ A;  3A3D A;  2WKE A;  2ZJ9 A;  1WE4 A;  1JVJ A;  4IED A;  5FAT A;  4JXV A;  3V3S A;  3E2L A;  2V2F F;  1ZC2 A;  4P6B A;  4X69 A;  4GNU A;  4JF5 A;  3RXX A;  3G34 A;  5DTT A;  3OPH A;  4CPK A;  3IWO A;  1FR6 A;  1G68 A;  4KZ8 A;  1QME A;  2HPB A;  1RCJ A;  5HAR A;  3VSL A;  4E3J A;  4M3K A;  2G2U A;  2JBF A;  1K4F A;  1DY6 A;  4XXR A;  2XK1 A;  3M6B A;  2ZC7 A;  4EUZ A;  3OZH A;  4OKP A;  1KVM A;  1YT4 A;  3UNW A;  1XGJ A;  2HDU A;  1XA1 A;  1ONG A;  2Y59 A;  3G2Z A;  4S2P A;  3GR2 A;  3C4P A;  4L0L A;  2FFY A;  2WGW A;  3N4I A;  1O07 A;  2C6W B;  1XGI A;  3ZG0 A;  3UY6 A;  4K0W A;  2XD5 A;  3CG5 A;  3SS3 A;  2Y55 A;  4OVD A;  1SHV A;  4WEL A;  3IH9 A;  3ZG7 B;  4E3L A;  1YLT A;  4E6W A;  5FI7 A;  3Q7V B;  3VOY A;  4WEJ A;  1ES5 A;  1TDG A;  3BYD A;  5EOE A;  2C5W B;  3IT9 A;  1BT5 A;  5GLB A;  2ZLY A;  4E3I A;  2P74 A;  1K55 C;  1ERO A;  2HP6 A;  1VQQ A;  1IKI A;  5FAQ A;  1S6R A;  1PWC A;  1KDW A;  1N4O A;  2XFT A;  1DJA A;  3TOI A;  3UE0 A;  3VP2 A;  5J8X A;  3ZNT A;  1HTZ A;  4QU3 A;  1CEG A;  4KZ5 A;  4B4X A;  4OQH A;  1EWZ A;  4Y0T A;  1JTD A;  5A92 A;  1FCM A;  3P09 A;  4YIN A;  1EI5 A;  2WUQ A;  2ZC6 B;  3UDX A;  4RX2 A;  3HRE A;  1MWT A;  2Y2I A;  3Q82 A;  3ZDJ A;  1E3U D;  1NZO A;  1K38 A;  3M6H A;  1YLY A;  3HLW A;  3IF6 C;  3DWK A;  3IH8 A;  4WYY A;  5FI2 A;  5GLD A;  5HAP A;  5FAP A;  3CJM A;  4GKU A;  4OON A;  5DF8 A;  1WYC A;  3Q81 A;  1YM1 A;  1CI8 A;  2JC7 A;  4JF6 A;  1K6R A;  5F1F A;  5HFO A;  2WKH A;  5F83 A;  2Y2P A;  3IXD A;  5CTN A;  3S1Y A;  1BTL A;  1G6A A;  1IEL A;  3EQV A;  3N8R A;  2BLS A;  4KZB A;  1E4D A;  4X53 A;  1WYB A;  4PM6 A;  4HES A;  4OOY A;  2R9X A;  2EFX A;  1K56 A;  4O7D A;  1ZG6 A;  4S2M A;  1H8Y A;  4A5R A;  5E2F A;  1KE4 A;  5KMW A;  2I72 A;  3WWX A;  4WMC D;  3MZD A;  2JCH A;  4D2O A;  1I2S A;  1L2S A;  3C7U A;  4EBP A;  3IWQ A;  4RX3 A;  2ZQA A;  4PMA A;  2ZMA A;  2IWB A;  3G2Y A;  5E2H A;  1SDN A;  3ITA A;  4KZ4 A;  3BRM A;  3HLB A;  3V5M A;  2QMI A;  1LL5 A;  3G31 A;  1Q2P A;  2XFS A;  3N8S A;  4OOL A;  3BFD A;  2DRW A;  5EVI A;  5FQM A;  4ZTK A;  3NI9 A;  4LEN A;  5AQ9 A;  2OLV A;  1PWG A;  4BEN A;  3IQA A;  5EUA A;  5I94 A;  1PW8 A;  1K54 A;  3N8L A;  1SDE A;  3ZG8 B;  2WGW B;  3BFC A;  4QD4 A;  4KZ7 A;  3TG9 A;  4GN2 A;  1H5X A;  1JTG A;  2XGN A;  1TEM A;  2X01 A;  2WAE A;  4MNR A;  5DTS A;  5EPH A;  1MPL A;  2WZX A;  3FKW A;  3NBL A;  3O87 A;  4DRT A;  4ZJ2 A;  1MKI A;  4FCF A;  4LCL A;  2HP5 A;  5GL9 A;  4S2O A;  1IYO A;  1DJB A;  1L0E A;  1KGE A;  3IF5 A;  3NCK A;  4R4R A;  2VGJ A;  1PIO A;  2GDN A;  4OH0 A;  4WM9 A;  2G2W A;  4PM8 A;  4EWF A;  1VM1 A;  3Q7Z A;  5HL1 A;  2HDR A;  3CMZ A;  3SH8 A;  3NDG A;  4JKT A;  4OQI A;  5E2G A;  4IVI A;  4R4S A;  3P98 A;  4UAA A;  5GHY A;  5BOH A;  2Y91 A;  2PU4 A;  3B3X A;  4ZDX A;  5FQI A;  4JBF A;  3UDF A;  4N92 A;  2ZM0 A;  3BLM A;  4R3B A;  1K55 A;  3SOI A;  4P0M A;  3MZF A;  3WRT A; 
#chains in the Genus database with same CATH topology
 4Q0I A;  3HJK A;  2A3U A;  3PBR A;  4E6X A;  2PBD P;  3LI8 A;  5M1A A;  2ZMV A;  4Z9Q A;  1BUE A;  1C3B A;  2I9V A;  1GCE A;  2HV1 A;  4LRY C;  1PI5 A;  2J9O A;  4PM9 A;  2W3H A;  1H8Z A;  2GX5 A;  4XT2 B;  3PAG A;  3WS4 A;  4KQR A;  4EBL A;  5U47 A;  2Y2J A;  4I39 A;  2K7S A;  3O5Y A;  2W0N A;  3UN7 A;  3RXW A;  4HP9 A;  2OWH A;  4LRX C;  2QWS A;  4IHQ A;  2OV5 A;  4P6Z M;  1MC0 A;  3UE3 A;  1G6O A;  4N9L A;  4LFU A;  5CTM A;  3GTC A;  3H9W A;  4BQM A;  5KZH A;  1NWZ A;  3H82 A;  3FC7 A;  4KZ9 A;  2RL3 A;  4LV0 A;  2WKR A;  2WK0 A;  1XFQ A;  2AVX A;  5M18 A;  1MWR A;  5AVF A;  5I5L A;  5L8M A;  5HX9 A;  4ARZ B;  5F69 A;  2RCX A;  1FCO A;  2EWW A;  5F68 A;  3MF0 A;  3ITB A;  1YMS A;  4C3Q A;  2J3W A;  2W3E A;  2QJ5 A;  4JGP A;  2XH9 A;  3R7W B;  2B5R A;  4FOF A;  1L0F A;  2XEP A;  4LV1 A;  4UA9 A;  4HBT A;  2EA9 A;  5EFW A;  3TE8 A;  2R9W A;  4D60 A;  2L4R A;  3DTM A;  4PKY G;  4JGQ A;  1FCN A;  3T12 B;  4EER A;  3ICY A;  3LIF A;  4R3A A;  3CPT A;  4OPY A;  2WAD A;  5EM0 A;  1NY0 A;  4X55 A;  3O3V A;  4QJG A;  3FKV A;  3HLE A;  1I5Q A;  2M7U A;  3NDE A;  3E98 A;  4PHT A;  4WLA A;  3VE3 A;  3A3J A;  5J4E A;  4GS9 A;  2P08 A;  3ZNY A;  1FSY A;  2EX9 A;  4DE3 A;  4GDN A;  4O8G A;  2PR6 A;  4WZ4 A;  4EQ1 A;  3OCL A;  4BD1 A;  3FWL A;  2Y2O A;  3G4P A;  2CC1 A;  1ES3 A;  1MKM A;  1LT0 A;  5M19 A;  4EU0 A;  4KZ6 A;  3HVF A;  4M4X A;  5JYP A;  1LSW A;  3GV9 A;  3VP3 A;  2J7V A;  2L1M A;  1GHM A;  4AFI A;  1T1C A;  4WZ5 C;  3NOP C;  3OC2 A;  3D72 A;  1AXB A;  2XDM A;  4U0X A;  5FQK A;  4JF4 A;  5AVE A;  1HLU P;  1ZKJ A;  3OPL A;  3NC8 A;  5CER A;  5FSR A;  1DP6 A;  3FZC A;  2P9V B;  3PBT A;  2ZOI A;  3HLC A;  1K56 D;  3W4O A;  2M7V A;  4O0P A;  3KYE A;  1OJG A;  1IOU A;  4H6J B;  3CWF A;  3LY3 A;  3MSH A;  4HHD A;  3FV7 A;  4Y3I A;  2HP9 A;  3O88 A;  3F1O B;  4CJN A;  3WS5 A;  2XLN A;  2ZM2 A;  3PBN A;  2KOI A;  2JKT I;  4MN7 A;  4HH3 A;  3LR4 A;  1LSV A;  2ZC5 B;  2DNS A;  4OQ0 A;  4UHU A;  3LID A;  4EQI A;  2FFF B;  4PAU A;  2E8J A;  5TGF A;  1KGF A;  2VV6 A;  3W4P A;  1KGG A;  3QP4 A;  2W1T B;  2VJW A;  4WEK A;  5HAQ A;  3UPN A;  1LI9 A;  4F94 A;  3C30 A;  3IX3 A;  4BL3 A;  4EET B;  3W8K A;  3QNB A;  4I5S A;  2V0W A;  4IBX A;  4X68 A;  3U4L P;  4KZA A;  4H8R A;  4MEZ A;  4PM5 A;  3IHA A;  3ZVW A;  1U60 A;  1JNU A;  3FPW A;  3VMA A;  2VLG A;  4EES A;  4WL9 A;  3VFF A;  2P04 A;  3C8C A;  2V1Z A;  3E2K A;  3WS0 A;  4QPR A;  4MDZ A;  3GEC A;  1PZP A;  1K57 A;  1T19 A;  1RP5 A;  3KSI A;  5EVI C;  2Y2Q A;  5FAO A;  3T1R A;  1K54 C;  3ZG9 B;  5F6A A;  4R70 A;  2V2F F;  4P6B A;  4X69 A;  4Y5F A;  4JF5 A;  3DBA A;  2JKF A;  1YSP A;  2VKS A;  4MCW A;  4PKY A;  4KZ8 A;  4M3K A;  2XK1 A;  4EUZ A;  1KVM A;  1YT4 A;  2HDU A;  3CUE C;  3C4P A;  4L0L A;  4JGR A;  3E0Y A;  2WGW A;  2C6W B;  1D1J A;  3T50 A;  2PT7 A;  3UB8 A;  5EOE A;  3IT9 A;  4E3I A;  2ZLY A;  3G6O A;  5IU1 A;  2XFT A;  3VP2 A;  1ACF A;  3DTE A;  1T1B A;  1CEG A;  3RH8 B;  4OQH A;  5AJG A;  1EWZ A;  1FCM A;  3P09 A;  1VET B;  2ZC6 B;  5G4Z A;  1UGU A;  1MWT A;  1XFN A;  3GDI A;  3ZDJ A;  3IH8 A;  3IF6 C;  2W3F A;  5FAP A;  2O9B A;  5DF8 A;  1CI8 A;  1K6R A;  3EEA A;  4Y17 A;  1NRJ A;  3MS6 A;  5CTN A;  3S1Y A;  1G6A A;  3EQV A;  3N8R A;  1TF1 A;  2XRO A;  4Y15 A;  4O7D A;  1H8Y A;  1FIL A;  5E2F A;  1KE4 A;  3NJA A;  1I2S A;  3C7U A;  4EBP A;  1OTD A;  4Q0H A;  2GNX A;  3G2Y A;  4XT2 A;  3BRM A;  1LL5 A;  3G31 A;  4DJ3 A;  2XFS A;  4OOL A;  3BFD A;  5DKL A;  5FQM A;  3NI9 A;  4HJ3 A;  2OLV A;  3T4O A;  3ZG8 B;  5FDS A;  4KZ7 A;  3TG9 A;  2XGN A;  1TEM A;  5DTS A;  4I3I A;  4RQ9 A;  1D7E A;  1MPL A;  3NBL A;  4DRT A;  4ZJ2 A;  4FCF A;  3MQO A;  5CX7 A;  4YWZ A;  1G28 A;  4K08 A;  1KGE A;  3NCK A;  2HZ5 A;  2GDN A;  4Z1W A;  3VV4 A;  2G2W A;  1VM1 A;  3NDG A;  4JKT A;  3UME A;  2INW A;  5BOH A;  5HD5 A;  3UDF A;  2O9A A;  4N92 A;  1K55 A;  4P0M A;  4ARZ A;  4IBR A;  2V20 A;  4E3N A;  1GHI A;  1FIK A;  5KSC A;  4IVK A;  3NY4 A;  5DKK A;  3R7W A;  5GHX A;  2ZC4 B;  2Z2M B;  4NXE A;  5GLC A;  1SCW A;  2HF6 A;  5DTK A;  1OPX A;  1YLJ A;  2V1A A;  1OTA A;  4GOG A;  4HH2 A;  4CLC C;  1TD5 A;  2WZZ A;  1TS8 A;  2UWX A;  2OSU A;  1Z09 A;  3VSK A;  1YKD A;  3FPV A;  1XPB A;  2WAF A;  3NOT C;  1BLC A;  1K57 C;  1PZO A;  1VEU B;  1PI4 A;  3ZGA B;  2V1B A;  2IWC A;  3ZQ5 A;  4ZRR A;  3UPP A;  4ZJ3 A;  4JXW A;  4BL2 A;  2VV8 A;  1IYS A;  3T1S A;  4FH2 A;  3TJZ C;  4UEY A;  4OPQ A;  3TRC A;  4BLM A;  4EBN A;  3MKE A;  4WUJ A;  4PM7 A;  1BUL A;  3LFV A;  4X1M A;  1LLB A;  4G3V A;  1NYY A;  2EXA A;  3S22 A;  2PYP A;  3NIA A;  1XP4 A;  5CRF A;  3T1Q B;  1IYP A;  5A91 A;  3BW6 A;  2X02 A;  5A8B A;  1SKF A;  3GQZ A;  1ESI A;  4RVA A;  5F1G A;  1GSV A;  3QNC A;  2Y2N A;  1NLY A;  2P9V A;  4WMC A;  3WS2 A;  4QB8 A;  2EX6 A;  2XD1 A;  3KYQ A;  1TS7 A;  5HWW A;  1SKO B;  4H6J A;  1T1A A;  3BWL A;  1ZHH B;  2P7J A;  2A49 A;  3F1O A;  1ZG4 A;  2BTF P;  2H0Y A;  1A0K A;  2QZ6 A;  4DKI A;  4OPZ A;  5FQ9 A;  4F3L B;  1E25 A;  4KQO A;  5F82 A;  5HW3 A;  4B88 A;  4P85 A;  1YLP A;  2J9P A;  3SH9 A;  2GZA A;  4MBK A;  3AGF A;  4LV2 A;  5TJJ A;  2BG1 A;  2W1T A;  4ZAM A;  3ZFZ A;  4X6T A;  3WRT A;  3ZCZ A;  1W79 A;  3MJQ A;  5HAI A;  2A2L A;  1KVL A;  4S2N A;  2PBY A;  2Y8H A;  3IBR A;  1TVF A;  3MMH A;  4GB7 A;  4L9E A;  4XUZ A;  2ZMF A;  3LR5 A;  1ONH A;  4BBT A;  3UO9 A;  2Z6C A;  3V3R A;  4C75 A;  2Y2M A;  1K0K A;  5G18 A;  5IT5 A;  3F1N A;  4WBG A;  5LBR A;  2HJ9 C;  3RJU A;  3HUO A;  5KSH A;  1S4R A;  4BMW A;  3ZHH A;  3GRJ A;  3LIB A;  4YFM A;  4K91 A;  1V9Y A;  4DJ2 A;  4C6Y A;  2HJE A;  3H7W A;  2QKP A;  1N9L A;  3HBR A;  2MJ6 A;  2VA0 A;  4GW9 A;  4DE1 A;  2PR5 A;  1RGY A;  4UA7 A;  5CHM A;  3UE1 A;  4NK3 A;  3N6I A;  3A3E A;  1S4S A;  1XJ4 A;  4OLG A;  3BFF A;  3UPO A;  4Y0U A;  5KIZ A;  2J3T D;  3DAV A;  5GHZ A;  1XJ3 A;  5MC7 A;  1M40 A;  3T1X A;  1TS0 A;  4FD8 A;  1VET A;  5AQ7 A;  2Y2G A;  1ALQ A;  4ESP A;  4ETZ A;  3GSG A;  4MBH A;  3VP4 A;  3QP8 A;  3ZYT A;  1JWZ A;  3Q07 A;  4U0T A;  1NJ4 A;  4MBF A;  5FEF A;  2GJ3 A;  1IEM A;  3LY4 A;  2JKR M;  4U3T A;  3MXQ A;  2ZM8 A;  4GLQ A;  3UDI A;  3R4K A;  1VHM A;  3QP6 A;  2JKG A;  2W1R A;  2Y79 A;  3A3D A;  1UWP X;  5FAT A;  4IUH A;  4R38 A;  2V8C A;  5HDD A;  4CPK A;  5HAR A;  1DY6 A;  3M6B A;  3SW1 A;  4OKP A;  3UNW A;  1XGJ A;  1XA1 A;  1ONG A;  4S2P A;  4GCZ A;  3GR2 A;  2FFY A;  2H28 A;  1O07 A;  3UY6 A;  1P0Z A;  1SHV A;  1YLT A;  3Q7V B;  3VOY A;  3MFX A;  1BT5 A;  2HP6 A;  1IKI A;  1PWC A;  1HTZ A;  2PHY A;  4KZ5 A;  4B4X A;  4HI4 A;  5A92 A;  5HWT A;  3NEC A;  3HLW A;  2KX6 A;  1OT6 A;  5HAP A;  3CJM A;  3BQA A;  3KX0 X;  1UWN X;  2WKH A;  5F83 A;  3HCY A;  1BTL A;  1WYB A;  4PM6 A;  2R9X A;  3T4K A;  4A5R A;  3BJN A;  4S2M A;  5C5K A;  1Y4O A;  1GSW A;  5KMW A;  2I72 A;  3WWX A;  4WMC D;  3MZD A;  2PD7 A;  3IWQ A;  2VK3 A;  3L9K A;  4PMA A;  3MQ0 A;  5E2H A;  4KZ4 A;  3ITA A;  4NEE D;  2OWJ A;  1F9I A;  4LEN A;  1H8M A;  3IQA A;  5I94 A;  1PW8 A;  1ZTU A;  4GN2 A;  1CJF A;  1F98 A;  2X01 A;  1VEU A;  4HOI A;  2WAE A;  4MNR A;  2WZX A;  3FKW A;  5GL9 A;  1DJB A;  3IF5 A;  4LLO B;  1PIO A;  3F1N B;  4OH0 A;  4WM9 A;  4PM8 A;  4EW7 A;  4HQA A;  4B93 A;  3Q7Z A;  2HDR A;  2WKP A;  2FH5 A;  4OQI A;  5E2G A;  4IVI A;  4R4S A;  3P98 A;  4UAA A;  5GHY A;  2Y91 A;  2PU4 A;  5FQI A;  4JBF A;  2ZM0 A;  2PDR A;  3PBO A;  4XUX A;  3BQ8 A;  2LB9 A;  3H7W B;  3BFG A;  1LI0 A;  4I38 A;  3UE6 A;  3GVB A;  1IKG A;  4WF0 A;  4BD0 A;  3EGX C;  5L10 A;  1Y54 A;  4LRZ E;  3EGD C;  1L3L A;  3N7W A;  2WKQ A;  3VE4 A;  4ETX A;  2ZD8 A;  5IHV A;  1GA9 A;  4P87 A;  1K25 A;  5EVI B;  1SKO A;  1NYM A;  1XJ2 A;  1MY8 A;  3VFH A;  1RGZ A;  3ZG5 A;  4N1X A;  3PR6 A;  1PWD A;  4R0Q A;  2VX8 A;  4B4Z A;  1HZO A;  1PYY A;  1XXM A;  3MXR A;  5CHJ A;  2OAP 1;  3BEC A;  4F3L A;  3V67 A;  2O0Y A;  5GLA A;  1ES4 A;  2FZ0 A;  4DDS A;  4OLD A;  4N9K A;  3LI9 A;  5HZH A;  3MXS A;  1KOU A;  1DP8 A;  1ES2 A;  4GD6 A;  3FG8 A;  4EEP A;  1W5D A;  1E3U A;  2IA2 A;  4OOM A;  5FEG A;  4O01 A;  4HP4 A;  4EUV A;  3IF6 B;  2XF3 A;  4NXB A;  1F2K A;  4KG6 A;  2EWV A;  4BJP A;  5HSQ A;  2VV7 A;  5J7E A;  3HLG A;  3M2K A;  4K0X A;  4Q8I A;  4BBU A;  1H0M A;  3HLF A;  5CEB A;  2DCF A;  3AGD A;  4EEU A;  3PBQ A;  3E4Q A;  2QPN A;  3PAE A;  5TFQ A;  1N9N A;  4NXG A;  5AQB A;  1BLS A;  3S4X A;  2V8F A;  1PRQ A;  1PW1 A;  1BLH A;  3LGO A;  1CQA A;  1S1Y A;  3OPP A;  3T4L A;  5EOO A;  4NKP A;  1JWV A;  2KLI A;  4HJ6 A;  1G5U A;  2XRN A;  5EV0 A;  1N9B A;  2Q0O A;  5CED A;  4ZJ1 A;  4S2L A;  3BLS A;  1SZV A;  3OCN A;  1P97 A;  1OJ5 A;  3LO7 A;  1YQS A;  2A24 B;  5HD3 A;  3EWK A;  1LHY A;  1EW0 A;  4MN5 A;  3OBF A;  1STZ A;  1HVB A;  1W7F A;  5CEC A;  3PBS A;  4UQI S;  4LCM A;  1KE0 A;  1J9M A;  4R6L A;  4KUK A;  4MLL A;  1XKZ A;  2ZQD A;  3DTI A;  5E43 A;  1S0W A;  1XJ6 A;  2H0T A;  1BSG A;  1K4E A;  2OAQ 1;  3CHW P;  2R78 A;  3LCE A;  5CXW A;  3O86 A;  4RYE A;  1FQG A;  1MWS A;  3BY9 A;  4NET A;  5HPF A;  2O9C A;  1GA0 A;  5FAS A;  3IXG A;  2E8I A;  4CLC B;  4KZ3 A;  4HBU A;  5CHU A;  3E4P A;  1OME A;  3VOZ A;  1XA7 A;  1QMF A;  3ULF A;  2KDK A;  2M1C A;  2H10 A;  1LSX A;  5DFY A;  4JPM A;  4R1G A;  1H3Q A;  3LIA A;  1YLZ A;  2WKI A;  4S2K A;  5CGX A;  5FL3 A;  4DE0 A;  4Y7P A;  2J8Y A;  4UA6 A;  3TSG A;  1ODV A;  3DWZ A;  3IS2 B;  5HL6 A;  1MXO A;  3Q7V A;  3C4O A;  4FH4 A;  3E4O A;  2V0U A;  5F5Y A;  3IX4 A;  5L09 A;  5EEC A;  4EXO A;  1S66 L;  3MQQ A;  4HIA A;  4MN6 A;  3DTK A;  5CGW A;  1BYW A;  5DF7 A;  4ID4 A;  1KE3 A;  4EV4 A;  4OP5 A;  5L07 A;  4WZ5 A;  4FUW A;  1MBL A;  4E3O A;  4E3M A;  4HNB A;  1WA9 A;  4ZBE A;  4GZB A;  3QP2 A;  3UMD A;  4DF6 A;  2WGI A;  1DJC A;  1ESU A;  1W8Y A;  4JLF A;  3MR0 A;  1IYQ A;  2ZJ9 A;  1JVJ A;  4IED A;  3V3S A;  4JXV A;  1ZC2 A;  4GNU A;  3JVU A;  1FR6 A;  1G68 A;  2D02 A;  1K4F A;  3A0S A;  4QWO A;  2XA7 M;  2Y59 A;  3RTY A;  3OLO A;  4HY8 A;  4GJ4 A;  3ZG0 A;  4K0W A;  2NUP C;  3CG5 A;  3SS3 A;  2J3T C;  2Y55 A;  4WEL A;  3IH9 A;  4GHI B;  4E3L A;  4E6W A;  3BY8 A;  1ES5 A;  3BYD A;  3C38 A;  5GLB A;  1K55 C;  1ERO A;  3T4T A;  3U2A A;  3TOI A;  3UE0 A;  4QU3 A;  3VOL A;  1JTD A;  4YIN A;  3A0R A;  3LIE A;  1EI5 A;  4Y2F A;  4RX2 A;  3HRE A;  4G3K A;  3Q82 A;  1E3U D;  1K38 A;  5GLD A;  5FI2 A;  3DWK A;  3IX8 A;  4GKU A;  3Q81 A;  4JF6 A;  4I3J A;  5HFO A;  3IXD A;  1W63 M;  4KZB A;  2PRF A;  1ZG6 A;  4IJG A;  5DFX A;  4KQD A;  2JCH A;  3W2Z A;  3KSG A;  5HPI A;  2ZQA A;  2ZMA A;  2IWB A;  3EEH A;  3IBJ A;  3V5M A;  2V9A A;  4ME4 A;  3S7O A;  5EVI A;  4ZTK A;  3UB7 A;  5AQ9 A;  1PWG A;  5EUA A;  4B9O A;  1K54 A;  3A0V A;  4LPZ A;  4DN0 A;  1OTE A;  1JTG A;  2ZBB A;  2BAS A;  1MKI A;  2HP5 A;  4S2O A;  1IYO A;  3NUL A;  1L0E A;  3LR0 A;  3CAX A;  2PD8 A;  3CUE A;  2VGJ A;  2O99 A;  4CQH A;  3KO6 A;  3SH8 A;  3B3X A;  1OTI A;  4ZDX A;  4WN5 A;  2L0W A;  4R3B A;  3BLM A;  4LGW A;  1LL9 A;  3WRZ A;  5EVL A;  2YKF A;  4YNR A;  3CZD A;  2W3D A;  3MFD A;  3G35 A;  2JKT M;  4Q0J A;  3IF6 A;  3IXB A;  4OPR A;  5EE8 A;  3SS5 A;  4R3J A;  4RA7 A;  3DW0 A;  3KSF A;  1I2W A;  1O7E A;  2XA7 S;  4KUO A;  1NXY A;  2W3G A;  4Y13 A;  3QP5 A;  2PAV P;  4QHC A;  4X25 A;  1CI9 A;  4S2I A;  3F1P B;  3C7V A;  2Y2H A;  2NUT C;  4X56 A;  1YLW A;  4JXS A;  4LV3 A;  1J3W A;  2JKR I;  5IS1 A;  1Q2Q A;  2EFU A;  2Y2K A;  3CLO A;  1HD8 A;  3VP0 A;  3QHY A;  3W4Q A;  1TDL A;  2ACG A;  5EVE A;  4P6Z S;  3VP1 A;  4S2N C;  2ZL1 B;  1S67 L;  3UB5 P;  3HJI A;  1AWI A;  4GD8 A;  4R23 A;  3L7H A;  3LEQ A;  4KG2 A;  2QJ7 A;  2X71 A;  3G32 A;  2XQZ A;  4MMN A;  3GMW A;  3LEZ A;  5TBM B;  2A24 A;  2D01 A;  4GDB A;  3MKF A;  2ZQ8 A;  3ISG A;  3LUQ A;  5A90 A;  2PYR A;  1NRF A;  1CEF A;  1JWP A;  3BEB A;  5AQA A;  3IXH A;  1ERQ A;  5DTT A;  1K6S A;  3P01 A;  3MBZ A;  4II7 A;  1YMX A;  1YSQ A;  1OT9 A;  1CK3 A;  2XR0 A;  1VB6 A;  2WGV A;  1P9W A;  4KG5 A;  5J3W A;  3M2J A;  3AGE A;  1P9R A;  5D3O A;  3Q1F A;  2CMN A;  2JE5 A;  2HDQ A;  3S7N A;  4DXC A;  3SZT A;  3KSH A;  1Z6F A;  3K3C A;  5EM1 A;  5FQJ A;  4CLC A;  3D4F A;  3T4J A;  3PYP A;  1T18 A;  4FTX A;  3HLD A;  1L0G A;  1CF0 A;  4DMZ A;  1KDS A;  1L0D A;  2QYB A;  3V50 A;  3H82 B;  2Y4A A;  3JVV A;  3CI6 A;  2Z2L B;  2B18 A;  3LYX A;  2ZQC A;  2EX2 A;  3A3I A;  1M6K A;  4KEN B;  3WS1 A;  1XX2 A;  5DJU A;  3LIC A;  3IS2 A;  3KYZ A;  3MZE A;  3I7J A;  4UQI M;  5DF9 A;  4N1H A;  3FYZ A;  4E04 A;  3IHB A;  4DDY A;  5FQQ A;  3NHQ A;  2VEA A;  3JYI A;  5FI6 A;  5CGS A;  3SS4 A;  3BM6 A;  3RFB A;  4Y0O A;  4JXG A;  4DE2 A;  3OOV A;  2ZC3 B;  3A3F A;  3JPU A;  4HEF A;  1MZU A;  2HGV A;  3UB9 A;  3P7N A;  2WYX A;  2ZQ9 A;  3CPT B;  1ERM A;  3IWI A;  3D3O A;  1NZU A;  3S7P A;  4DXB A;  3C5A A;  2OLU A;  5G4Y A;  4QY6 A;  5E2E A;  1BLP A;  2G7U A;  3G30 A;  1IFQ A;  4GS9 B;  2Q9N A;  3EQU A;  2ZOH A;  5TR7 A;  4OP8 A;  3HL9 A;  5EVI D;  4S2J A;  2HDS A;  3OPR A;  4FSF A;  1S1Z A;  4CLC E;  1MWU A;  2LB5 A;  4E3K A;  5FDH A;  1GHP A;  3B33 A;  2EXB A;  4HJ4 A;  3PTE A;  4OQG A;  2J80 A;  1DP9 A;  1Y28 A;  4X1L A;  3SH7 A;  2VGK A;  1GSX A;  4GHI A;  3HUN A;  5HDC A;  2PU2 A;  5FA7 A;  3UB6 A;  2H5S A;  2JHE A;  4KQQ A;  1YAX A;  5A93 A;  2K2N A;  4BBV A;  2EX8 A;  2VGL M;  3LR3 A;  4PPR A;  4G3W A;  3PHY A;  2ZQ7 A;  3V39 A;  4NXF A;  5DVA A;  4QY5 A;  1F5M A;  1W8Q A;  1D06 A;  1FSW A;  3T4Q A;  1TS6 A;  1BZA A;  2IWD A;  2Y2L A;  3QP1 A;  2YKH A;  3HUM A;  1X0O A;  1FOF A;  3CIT A;  1FR1 A;  5L2F A;  5JYO A;  3BFE A;  3ZVT A;  2QHK A;  3K2N A;  3EOI A;  3S7Q A;  2Q9M A;  1NLZ A;  2WKE A;  1WE4 A;  2B02 A;  3T4S A;  3E2L A;  5K5B A;  2VZW A;  1LL8 A;  3G34 A;  3RXX A;  3OPH A;  1PNE A;  3IWO A;  1QME A;  2HPB A;  1RCJ A;  4NG2 A;  3VSL A;  4E3J A;  2G2U A;  2JBF A;  4XXR A;  2ZC7 A;  3OZH A;  3C2W A;  3G2Z A;  3PXP A;  5HDS A;  3N4I A;  1XGI A;  2XD5 A;  4OVD A;  2UV0 E;  3ZG7 B;  5FI7 A;  4WEJ A;  1TDG A;  2C5W B;  2P74 A;  1VQQ A;  4L9F A;  5FAQ A;  1S6R A;  5J8X A;  1KDW A;  1N4O A;  1DJA A;  4I3A A;  5HWV A;  3ZNT A;  4Y0T A;  1OTB A;  4BWI A;  3UDX A;  2WUQ A;  3B42 A;  2Y2I A;  1NZO A;  3M6H A;  1YLY A;  4WYY A;  4OON A;  1WYC A;  1YM1 A;  2JC7 A;  5DJT A;  5F1F A;  2Y2P A;  2OOL A;  1IEL A;  2BLS A;  1E4D A;  4X53 A;  2Z6D A;  4HES A;  4OOY A;  3TW8 A;  2EFX A;  1K56 A;  2B95 A;  4YOF A;  4D2O A;  1L2S A;  2JN7 A;  4RX3 A;  4IUK A;  1SDN A;  3HLB A;  2QMI A;  1Q2P A;  3N8S A;  1W63 Q;  2DRW A;  4CLC D;  4JGO A;  1YPR A;  2XSS A;  1DRM A;  4BEN A;  3F1P A;  3D9Y A;  3N8L A;  1SDE A;  2WGW B;  3BFC A;  4QD4 A;  2K31 A;  1H5X A;  2W27 A;  2VGL S;  5EPH A;  3K3D A;  1V9Z A;  3O87 A;  4LCL A;  3B47 A;  4R4R A;  4L9G A;  4EWF A;  5HL1 A;  2ZL1 A;  3CMZ A;  3NOU C;  1PFL A;  2DMW A;  1N9O A;  3SOI A;  3MZF A;  5TBM A; 
#chains in the Genus database with same CATH homology
 3PBO A;  2A3U A;  1LL9 A;  4IBR A;  3WRZ A;  2V20 A;  4XUX A;  5EVL A;  3PBR A;  4E6X A;  3BFG A;  4E3N A;  3CZD A;  1LI0 A;  1GHI A;  3GVB A;  3MFD A;  3G35 A;  1IKG A;  5M1A A;  5KSC A;  4IVK A;  4Z9Q A;  3NY4 A;  1BUE A;  4BD0 A;  1C3B A;  5GHX A;  3IF6 A;  3IXB A;  1Y54 A;  2Z2M B;  2ZC4 B;  4OPR A;  1GCE A;  5GLC A;  1SCW A;  5EE8 A;  1PI5 A;  3SS5 A;  5DTK A;  4R3J A;  2J9O A;  4RA7 A;  3DW0 A;  1YLJ A;  4PM9 A;  1I2W A;  1O7E A;  4GOG A;  2WZZ A;  1H8Z A;  1NXY A;  2UWX A;  3N7W A;  2OSU A;  3PAG A;  3WS4 A;  2ZD8 A;  5IHV A;  1GA9 A;  4P87 A;  1K25 A;  4QHC A;  3VSK A;  5EVI B;  1CI9 A;  4S2I A;  4KQR A;  4EBL A;  5U47 A;  2Y2J A;  3C7V A;  1NYM A;  2Y2H A;  4X56 A;  1XPB A;  1YLW A;  2WAF A;  4JXS A;  1MY8 A;  4LV3 A;  3VFH A;  1BLC A;  3UN7 A;  3RXW A;  1K57 C;  1RGZ A;  3ZG5 A;  1PZO A;  1PI4 A;  1Q2Q A;  2EFU A;  2Y2K A;  4N1X A;  1PWD A;  3ZGA B;  4R0Q A;  2OV5 A;  2IWC A;  4B4Z A;  3UE3 A;  1HZO A;  1PYY A;  1XXM A;  4N9L A;  3MXR A;  1HD8 A;  3UPP A;  3VP0 A;  5CTM A;  5CHJ A;  3QHY A;  3GTC A;  3BEC A;  3W4Q A;  4ZJ3 A;  4JXW A;  4BQM A;  1TDL A;  4BL2 A;  5KZH A;  3VP1 A;  1IYS A;  4FH2 A;  4S2N C;  5GLA A;  1ES4 A;  4KZ9 A;  4OPQ A;  2RL3 A;  4LV0 A;  4R23 A;  4GD8 A;  4BLM A;  4EBN A;  4KG2 A;  3MKE A;  4PM7 A;  1BUL A;  2WK0 A;  4DDS A;  1LLB A;  4OLD A;  4N9K A;  1NYY A;  2X71 A;  3G32 A;  5M18 A;  1MWR A;  2EXA A;  2XQZ A;  3MXS A;  3S22 A;  3GMW A;  5HX9 A;  3LEZ A;  2RCX A;  4GDB A;  3MKF A;  1ES2 A;  4GD6 A;  2ZQ8 A;  3ISG A;  1FCO A;  1W5D A;  1E3U A;  3NIA A;  5A90 A;  1XP4 A;  3ITB A;  5CRF A;  4OOM A;  1YMS A;  1NRF A;  1IYP A;  1CEF A;  1JWP A;  5A91 A;  3BEB A;  5AQA A;  4C3Q A;  3IXH A;  1ERQ A;  2XH9 A;  2B5R A;  2X02 A;  3IF6 B;  1L0F A;  2XF3 A;  2XEP A;  1K6S A;  1SKF A;  4HBT A;  4LV1 A;  4UA9 A;  3GQZ A;  1ESI A;  3MBZ A;  4KG6 A;  2R9W A;  1YMX A;  4RVA A;  5F1G A;  4BJP A;  1CK3 A;  3DTM A;  3QNC A;  3HLG A;  2XR0 A;  2Y2N A;  3M2K A;  2P9V A;  4K0X A;  4Q8I A;  2WGV A;  1FCN A;  4WMC A;  3WS2 A;  4QB8 A;  2EX6 A;  3HLF A;  4KG5 A;  2XD1 A;  3M2J A;  5CEB A;  2DCF A;  3AGD A;  4OPY A;  2WAD A;  3AGE A;  5D3O A;  3Q1F A;  1NY0 A;  3PBQ A;  2QPN A;  2JE5 A;  4X55 A;  2HDQ A;  3O3V A;  4QJG A;  4DXC A;  2A49 A;  3FKV A;  3PAE A;  1Z6F A;  5FQJ A;  1ZG4 A;  3HLE A;  1I5Q A;  3D4F A;  2H0Y A;  3NDE A;  5TFQ A;  2QZ6 A;  3A3J A;  5AQB A;  1BLS A;  4DKI A;  3S4X A;  3ZNY A;  1FSY A;  2EX9 A;  3HLD A;  1L0G A;  4DE3 A;  1PW1 A;  1BLH A;  4GDN A;  4OPZ A;  5FQ9 A;  3OPP A;  5EOO A;  1KDS A;  1E25 A;  1JWV A;  1L0D A;  4KQO A;  5F82 A;  4WZ4 A;  3V50 A;  2Y4A A;  5HW3 A;  2Z2L B;  1N9B A;  4B88 A;  4P85 A;  3OCL A;  1YLP A;  5CED A;  4ZJ1 A;  2J9P A;  2ZQC A;  4S2L A;  3SH9 A;  2EX2 A;  3BLS A;  4BD1 A;  3A3I A;  3OCN A;  3FWL A;  2Y2O A;  1M6K A;  3AGF A;  3G4P A;  4KEN B;  4LV2 A;  3LO7 A;  4MBK A;  1YQS A;  2BG1 A;  1XX2 A;  3WS1 A;  2CC1 A;  4ZAM A;  3ZFZ A;  1ES3 A;  4X6T A;  5M19 A;  3MZE A;  3ZCZ A;  1W79 A;  4KZ6 A;  3I7J A;  1LHY A;  3HVF A;  4N1H A;  5DF9 A;  3GV9 A;  5HAI A;  3VP3 A;  5JYP A;  2J7V A;  1GHM A;  1KVL A;  4S2N A;  3FYZ A;  3IHB A;  4WZ5 C;  4DDY A;  3OC2 A;  2PBY A;  4U0X A;  1AXB A;  2XDM A;  5FQK A;  1HVB A;  1W7F A;  5CEC A;  1TVF A;  4JF4 A;  3PBS A;  5FQQ A;  4LCM A;  3JYI A;  5FI6 A;  1ZKJ A;  5CGS A;  4GB7 A;  1KE0 A;  1J9M A;  3BM6 A;  3SS4 A;  3OPL A;  3NC8 A;  4Y0O A;  4JXG A;  4XUZ A;  4MLL A;  1XKZ A;  2ZQD A;  5CER A;  5FSR A;  5E43 A;  3FZC A;  4DE2 A;  1S0W A;  2H0T A;  2P9V B;  2ZC3 B;  1BSG A;  3PBT A;  3A3F A;  4HEF A;  1ONH A;  1K4E A;  3HLC A;  3UO9 A;  3V3R A;  4C75 A;  1K56 D;  2Y2M A;  3W4O A;  3LCE A;  2WYX A;  5CXW A;  2ZQ9 A;  3O86 A;  1ERM A;  3IWI A;  4RYE A;  1FQG A;  1MWS A;  5G18 A;  1NZU A;  4NET A;  4WBG A;  3LY3 A;  1GA0 A;  5FAS A;  3FV7 A;  2HP9 A;  3O88 A;  4CJN A;  3IXG A;  3WS5 A;  2E8I A;  3C5A A;  4DXB A;  2OLU A;  2XLN A;  2ZM2 A;  3PBN A;  3HUO A;  3RJU A;  5KSH A;  4KZ3 A;  4QY6 A;  5E2E A;  1BLP A;  3G30 A;  4HBU A;  5CHU A;  2ZC5 B;  2Q9N A;  3EQU A;  3GRJ A;  1OME A;  5TR7 A;  4YFM A;  4K91 A;  2DNS A;  3VOZ A;  3ZHH A;  4OP8 A;  3HL9 A;  1XA7 A;  1QMF A;  4OQ0 A;  5EVI D;  4C6Y A;  4UHU A;  4S2J A;  2H10 A;  4EQI A;  2HDS A;  3OPR A;  2FFF B;  4FSF A;  4JPM A;  3HBR A;  4R1G A;  5TGF A;  1YLZ A;  1MWU A;  2WKI A;  4S2K A;  5CGX A;  4DE1 A;  4E3K A;  5FDH A;  1RGY A;  1GHP A;  4UA7 A;  2EXB A;  5CHM A;  1KGF A;  4NK3 A;  3UE1 A;  3W4P A;  1KGG A;  4DE0 A;  4Y7P A;  2J8Y A;  3N6I A;  3PTE A;  4OQG A;  3A3E A;  4WEK A;  4OLG A;  4UA6 A;  3TSG A;  3SH7 A;  2VGK A;  3BFF A;  3DWZ A;  3UPO A;  1MXO A;  3HUN A;  5HAQ A;  3Q7V A;  3UPN A;  2PU2 A;  5FA7 A;  1LI9 A;  2H5S A;  3C4O A;  4Y0U A;  4FH4 A;  4F94 A;  4KQQ A;  5A93 A;  2EX8 A;  4BL3 A;  4PPR A;  5GHZ A;  1M40 A;  2ZQ7 A;  3V39 A;  5EEC A;  3W8K A;  3QNB A;  5DVA A;  4FD8 A;  4QY5 A;  4IBX A;  4X68 A;  4KZA A;  2Y2G A;  5AQ7 A;  1W8Q A;  4H8R A;  5CGW A;  5DF7 A;  1FSW A;  4ID4 A;  1ALQ A;  1KE3 A;  4MEZ A;  4PM5 A;  1BZA A;  2IWD A;  3IHA A;  1U60 A;  3GSG A;  4MBH A;  3VMA A;  3ZVW A;  4EV4 A;  4OP5 A;  3VFF A;  4WZ5 A;  3VP4 A;  2Y2L A;  2V1Z A;  3E2K A;  3WS0 A;  1JWZ A;  3Q07 A;  4U0T A;  1NJ4 A;  4MBF A;  1MBL A;  3HUM A;  4E3O A;  4E3M A;  1FOF A;  1FR1 A;  1IEM A;  4ZBE A;  4GZB A;  5JYO A;  5L2F A;  3LY4 A;  4DF6 A;  3BFE A;  3ZVT A;  2WGI A;  4U3T A;  1DJC A;  1PZP A;  2ZM8 A;  1K57 A;  3UDI A;  1ESU A;  1RP5 A;  5EVI C;  1W8Y A;  2Y2Q A;  5FAO A;  4JLF A;  2Q9M A;  1K54 C;  3ZG9 B;  1IYQ A;  3A3D A;  2WKE A;  2ZJ9 A;  1WE4 A;  1JVJ A;  4IED A;  5FAT A;  4JXV A;  3V3S A;  3E2L A;  2V2F F;  1ZC2 A;  4P6B A;  4X69 A;  4GNU A;  4JF5 A;  3RXX A;  3G34 A;  5DTT A;  3OPH A;  4CPK A;  3IWO A;  1FR6 A;  1G68 A;  4KZ8 A;  1QME A;  2HPB A;  1RCJ A;  5HAR A;  3VSL A;  4E3J A;  4M3K A;  2G2U A;  2JBF A;  1K4F A;  1DY6 A;  4XXR A;  2XK1 A;  3M6B A;  2ZC7 A;  4EUZ A;  3OZH A;  4OKP A;  1KVM A;  1YT4 A;  3UNW A;  1XGJ A;  2HDU A;  1XA1 A;  1ONG A;  2Y59 A;  3G2Z A;  4S2P A;  3GR2 A;  3C4P A;  4L0L A;  2FFY A;  2WGW A;  3N4I A;  1O07 A;  2C6W B;  1XGI A;  3ZG0 A;  3UY6 A;  4K0W A;  2XD5 A;  3CG5 A;  3SS3 A;  2Y55 A;  4OVD A;  1SHV A;  4WEL A;  3IH9 A;  3ZG7 B;  4E3L A;  1YLT A;  4E6W A;  5FI7 A;  3Q7V B;  3VOY A;  4WEJ A;  1ES5 A;  1TDG A;  3BYD A;  5EOE A;  2C5W B;  3IT9 A;  1BT5 A;  5GLB A;  2ZLY A;  4E3I A;  2P74 A;  1K55 C;  1ERO A;  2HP6 A;  1VQQ A;  1IKI A;  5FAQ A;  1S6R A;  1PWC A;  1KDW A;  1N4O A;  2XFT A;  1DJA A;  3TOI A;  3UE0 A;  3VP2 A;  5J8X A;  3ZNT A;  1HTZ A;  4QU3 A;  1CEG A;  4KZ5 A;  4B4X A;  4OQH A;  1EWZ A;  4Y0T A;  1JTD A;  5A92 A;  1FCM A;  3P09 A;  4YIN A;  1EI5 A;  2WUQ A;  2ZC6 B;  3UDX A;  4RX2 A;  3HRE A;  1MWT A;  2Y2I A;  3Q82 A;  3ZDJ A;  1E3U D;  1NZO A;  1K38 A;  3M6H A;  1YLY A;  3HLW A;  3IF6 C;  3DWK A;  3IH8 A;  4WYY A;  5FI2 A;  5GLD A;  5HAP A;  5FAP A;  3CJM A;  4GKU A;  4OON A;  5DF8 A;  1WYC A;  3Q81 A;  1YM1 A;  1CI8 A;  2JC7 A;  4JF6 A;  1K6R A;  5F1F A;  5HFO A;  2WKH A;  5F83 A;  2Y2P A;  3IXD A;  5CTN A;  3S1Y A;  1BTL A;  1G6A A;  1IEL A;  3EQV A;  3N8R A;  2BLS A;  4KZB A;  1E4D A;  4X53 A;  1WYB A;  4PM6 A;  4HES A;  4OOY A;  2R9X A;  2EFX A;  1K56 A;  4O7D A;  1ZG6 A;  4S2M A;  1H8Y A;  4A5R A;  5E2F A;  1KE4 A;  5KMW A;  2I72 A;  3WWX A;  4WMC D;  3MZD A;  2JCH A;  4D2O A;  1I2S A;  1L2S A;  3C7U A;  4EBP A;  3IWQ A;  4RX3 A;  2ZQA A;  4PMA A;  2ZMA A;  2IWB A;  3G2Y A;  5E2H A;  1SDN A;  3ITA A;  4KZ4 A;  3BRM A;  3HLB A;  3V5M A;  2QMI A;  1LL5 A;  3G31 A;  1Q2P A;  2XFS A;  3N8S A;  4OOL A;  3BFD A;  2DRW A;  5EVI A;  5FQM A;  4ZTK A;  3NI9 A;  4LEN A;  5AQ9 A;  2OLV A;  1PWG A;  4BEN A;  3IQA A;  5EUA A;  5I94 A;  1PW8 A;  1K54 A;  3N8L A;  1SDE A;  3ZG8 B;  2WGW B;  3BFC A;  4QD4 A;  4KZ7 A;  3TG9 A;  4GN2 A;  1H5X A;  1JTG A;  2XGN A;  1TEM A;  2X01 A;  2WAE A;  4MNR A;  5DTS A;  5EPH A;  1MPL A;  2WZX A;  3FKW A;  3NBL A;  3O87 A;  4DRT A;  4ZJ2 A;  1MKI A;  4FCF A;  4LCL A;  2HP5 A;  5GL9 A;  4S2O A;  1IYO A;  1DJB A;  1L0E A;  1KGE A;  3IF5 A;  3NCK A;  4R4R A;  2VGJ A;  1PIO A;  2GDN A;  4OH0 A;  4WM9 A;  2G2W A;  4PM8 A;  4EWF A;  1VM1 A;  3Q7Z A;  5HL1 A;  2HDR A;  3CMZ A;  3SH8 A;  3NDG A;  4JKT A;  4OQI A;  5E2G A;  4IVI A;  4R4S A;  3P98 A;  4UAA A;  5GHY A;  5BOH A;  2Y91 A;  2PU4 A;  3B3X A;  4ZDX A;  5FQI A;  4JBF A;  3UDF A;  4N92 A;  2ZM0 A;  3BLM A;  4R3B A;  1K55 A;  3SOI A;  4P0M A;  3MZF A;  3WRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...