5BORA

Structure of acetobacter aceti pure-s57c, sulfonate form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of the conserved serine in two PurE classes
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 53
structure length 159
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5borA00
2FWIA 2FW1A 5C5DA 2YWXA 2FW8A 5BORA 4AY4A 4ZMBA 4Z7JA 2NSLA 2NSJA 1O4VA 2NSHA 1D7AA 4YCJA 4ZK2A 5CLJA 5CVTA 5BOSB 2FWBA 4ZC8A 3RG8A 4B4KA 2FW9A 3TRHA 1QCZA 5CLHA 3ORSA 4YCBA 2FWPA 1U11A 3OPQA 3KUUA 5CLFA 2FWAA 2FW6A 5BOSA 3RGGA 3OOWA 2H31A 4YCDA 4ZJYA 4JA0A 5CTJA 5CLGA 4GRDA 2ATEA 4YCCA 2FW7A 5CLIA 4AY3A 1XMPA 2FWJA 3LP6A
chains in the Genus database with same CATH superfamily
2BM0A 1PFUA 3PVSA 4KZKA 5DLYA 1IK6A 1GZ3A 1I01A 2A2ZA 3S5JA 5ED0A 1VC2A 1ZBQA 1E2GA 1U0TA 2B7CA 2GJ8A 3A2NA 4GVLA 4NF2A 4ZI5A 1TB4A 4AY4A 3WV5A 4BNMA 1EJBA 4NJOA 1WCV1 2I33A 1MIHA 5AM4A 5HCIA 3QFRA 4GBED 1U9YA 4GPEA 4YI3A 5MF6A 1A2OA 2WQZA 3G2HA 3II6X 1X8LA 2ZR9A 3FTFA 4GSYA 1YQWA 4IHKA 2FUKA 4BFLA 1CYDA 1CUZA 4I08A 2OG2A 1VL1A 2P79A 1ZS9A 3ESRA 3PCRB 5CP8A 1BQ4A 3BB1A 2ZSDA 3WWDA 4OI0A 1FBTA 2ZB7A 4ARIA 1SCBA 2ZYVX 3K1ZA 4LTNA 3CXRA 1MA3A 1QGYA 1GCUA 1XTSA 2ZVDA 4YMTA 1ECLA 4II3A 5EP1A 4BWFB 2W42A 2B1GA 2C0PA 2GCGA 2IYNA 1XTQA 1UF9A 1O9HA 1V5FA 2AN4A 1IE3A 1NN3A 3BWXA 3Q7RA 3ZBPA 1NQUA 1MXFA 4R7GA 2JDID 2GEUA 3IXLA 4WKPA 1YTLA 1B15A 1F6BA 1K4MA 3B9BA 2BFMA 2J3HA 3FCOA 3KV3O 2GO1A 1H6BA 3EXFA 1KZHA 1EXDA 4OGLA 4QVKA 2WE7A 3TLEA 1ZWKA 3MJHA 1SQ5A 1VOTA 2BEUB 3MCTA 2CDBA 4Q4CA 3EZGA 1ZQ1A 3G7SA 1ZLXA 2E4VA 3FCXA 3U44A 3TOZA 5FOXA 1TAQA 2PV7A 2I3GA 4GM1A 4H17A 1STOA 1RJDA 2H0QA 3AR9A 3A4TA 3L49A 4QYSA 3T7SA 2O0KA 2P4SA 1ISSA 1H65A 3F74A 3GMTA 1H2XA 3A4LA 2A14A 2EFYA 3HU2A 1LGYA 3IP7A 3H11A 2HSWA 4FKBA 5K0LA 1GTVA 1YOBA 2LV8A 4JD5A 4D4MA 1AK1A 2JZCA 3PFCA 2LW7A 4G1BA 4P1ZA 5IAEA 4D9KA 3AQIA 3K0FB 1LV7A 3RRXA 3A4VA 4B8YA 3DEYX 2QW8A 3I8OA 1EA5A 1WNTA 1M2WA 2JLRA 2OQVA 3HV0A 1T4DA 2X0FA 1OY1A 4TRRA 2JJMA 2OUIA 3KT8A 5D3QA 1FMFA 2ZBUA 3IAM1 2OY0A 2GPJA 4BAUA 1T15A 2WFZA 4IDDA 2HEGA 2O05A 3O38A 2FP3A 2JAUA 4LTDA 4E5KA 3HM9A 2Q6KA 3I4CA 3JAKB 2O3JA 4LJRA 1T8UA 2C2GA 3EE6A 1KMHA 4OO3A 1OYYA 2CE2X 4RVOA 1RWOA 3HABA 4PS1A 4WVFA 3UHOA 4B82A 1B8NA 2JVJA 5ITZA 3EZ2A 1JHOA 2R1VB 1E96A 1H2HA 2IPXA 1XTBA 3EZFA 4UCQA 1DBIA 3ZE1B 3WR5A 1CDOA 1UBJS 4IUBS 4QJ3A 4RQTA 4V0QA 4CMCA 5DDIP 2JH8A 3OCXA 1G8KA 5FTLA 3OI7A 3ABSB 4PU0A 3ETHA 5AJTA 4YVFA 3U4AA 3AX6A 4B2LA 3N2NA 1PJ4A 2X19A 5GP1A 3W9YA 5C5CA 5T57A 3HU5A 3A05A 4RQUA 5DHQA 3INTA 3KEFA 1WULS 2ZU0C 4H0FA 4C30A 3SHQA 1D07A 4BFCA 5HM6A 1X92A 4V3BA 2WT9A 3G8CA 4HAOA 2HMAA 2PK3A 1Z74A 1U5BA 2QDKA 4HYQA 4KQ2A 4FJ1A 1JYFA 1M6HA 1L7DA 4XX0B 4QXMA 4EG7A 2GZSA 4XUGB 4IGAA 4P83A 1VA5A 4IDQA 4PLPA 1C7FA 3DTVB 1PGJA 5CDHA 2GFIA 1SCDA 1GRQA 2AZ4A 4KRXA 1LY1A 4YMLA 2PX3A 2IF2A 4O3MA 4P7KA 4LDQA 3LF1A 3RR2A 3QH4A 4ZN6A 2NTVA 1O6CA 4X60A 4EPRA 3GFOA 3V97A 2AR7A 2V5VA 4NCXA 5FWNA 2D1QA 4YECA 1U2DC 5E1DA 2WKQA 2NZUG 3QK7A 3HVJA 4ZVVA 2PYZA 5FWAA 2QUAA 1Z5WA 4N5NA 1GFSA 1N0HA 2ERYA 1T5SA 1NW5A 1SVKA 1WCWA 3F4BA 3LYAA 2VTVA 1BMQA 3NC0C 3TR6A 2GHIA 1H2FA 4CU2A 3IDQA 3NHYA 4QOHA 4KXFB 4PFJA 1O6ZA 1Q0RA 2IYPA 2ZXEA 4IIJF 4U7PB 5FNZA 3PFWO 1E4EB 1JWLA 3QX3A 1FLNA 3HCAA 2CL6X 3ZE6A 3RC9A 1OTHA 3SSNA 3GUZA 1F8FA 3ZEAA 4A0SA 1RPZA 2Y6VA 3SNHA 1VJ5A 2CLEB 3DV2A 4RF5A 3GWGA 2FWNA 1JHMA 1NL3A 1TD1A 4HQKA 1L5OA 3WGNA 1QQTA 1XELA 3AFHA 1Y9AA 1NQAO 3DBRB 3LOQA 3OPNA 3TZCA 1TO2E 4FNOA 4EFMA 4DW8A 4JYBA 3TFWA 2IQIA 2E21A 1WM1A 1TM1E 2QLJA 1L5ZA 4ZREA 3QPVA 16PKA 2XMDA 2CL5A 4U02A 3ZWVA 4A73A 2A0FA 1W44A 4P4SA 4QBFA 2OXTA 2I9KA 2ZUSA 1AMNA 4YMUA 1MXHA 4JCOA 3A36A 3LDHA 4NU8X 4WOBA 3O03A 1R88A 2JK1A 4BNDB 2IHBA 2Z09A 3BPSA 5K4AA 1K4YA 4JODA 1ORRA 5FD8A 1OFHA 10MHA 3EZLA 4NFYA 3PKJA 2XGJA 2P2SA 5DNWA 1L9XA 1YVRA 1QH1B 4DS3A 5FUXA 3DZJA 3L8MA 2B4KA 2UZ0A 4LE2A 4U7TB 4DPMA 2X1HA 4IO1A 5GV8A 1DSSG 1NY6A 3I9V1 2FV8A 5F3RA 1B1AA 1GLNA 4BLTA 4MLPA 3RFFA 3RWBA 1A77A 4RM2A 4KU4A 5C32A 1BW9A 3DCYA 1DLIA 1GKYA 3EFBA 3D64A 1W2WB 3FPCA 1XNJA 1U1FA 2HSGA 3L1KA 1ISGA 4FXPA 1OXTA 3DTVA 4CL8A 5KTPA 4B83A 1XZNA 1AKWA 1RJWA 5ES3A 2P0EA 1P4GA 2NM0A 3BOSA 1OWNA 3CTPA 1BJRE 1MG0A 3LU1A 3R3SA 1DOHA 2G70A 3OPQA 1XRQA 3D54D 1LNSA 3T52A 3D0KA 5IANA 2O1SA 5JNVA 2C98A 2HJ9A 4MR7B 3RUPA 1WUIS 1PU2A 2AB0A 5K0NA 4DYHA 4RW0A 3AFIA 3T3GA 5BSWA 2FLKA 2LBPA 2RB5A 1NF9A 2OD2A 1LF5A 2C5GA 5JYDA 2J0UB 1E0DA 3GN1A 5CXSA 4B3XA 2I6UA 1E1NA 2C2XA 2ZJ5A 1WHSB 3QYAA 4HWGA 2QGZA 4WXEA 7AT1A 3P4XA 2IV3A 3MJSA 4GZMA 4YJ2A 1SIWA 3LUKA 1WWKA 2BFPA 2WM8A 1K92A 2C82A 2RI0A 4K81B 4NAHA 5JWHA 4DTCA 1R9GA 3FYUC 1SXJE 3GG2A 3DEIA 3QLUA 4E4TA 3D7LA 4HATA 4KR9A 4AP6A 3ZGVA 1V5IA 3KHTA 2ID9A 5ED4A 3MINA 2G25A 2EYQA 3SOZA 4TLDA 1T9KA 1FK8A 4OYRA 1MH1A 2PGDA 3CF2A 4DG8A 4E5NA 4TYWA 3L77A 4HDNA 2ISQA 1T9GS 2DY1A 3B85A 4H3HB 4X9XA 3NOVA 2CCJA 3TR0A 1AJEA 2FEOA 3PA6A 1G42A 3MJFA 1ZD8A 4EUKA 3I4FA 4AZSA 5C37A 4AUMA 1ZSNA 3SJ7A 5GZ6A 2OL4A 4KE9A 1ZH8A 4TMYA 1KZ6A 4YMIA 2X4DA 2MCFA 2FPWA 5CD1A 4NMLA 4KPGA 3G85A 4IIJB 4MV7A 3WAJA 3OBIA 3TSWA 4PSVA 1JDSA 2QRNA 4E2YA 3MHPA 2REQB 1N1DA 2VAPA 3KQMA 3EXHC 4IMJB 5JS2A 1B7GO 1JLHA 2E4XA 3MLBA 4IOMA 3HYCA 3OY2A 4YQYA 1KOFA 2RC6A 1EGMB 3P5SA 3RARA 1OZAA 4EQ6A 4Q9IA 4WBNA 3PT5A 3LRTA 4LHWA 5BSEA 1IOVA 2ZRJA 3IYLW 2F4NA 3MINB 3RBZA 3K70B 4FLEA 4PPNA 3DULA 5SY6A 1WCIB 4EHAA 3THYB 3N0VA 3JD4A 4BGDA 3C7CB 3P2MA 1Y7HA 3KRTA 3O2QB 2Y1KA 1ZX1A 1TI7A 2C2ZA 3PUYA 3DHVA 3N2EA 4LDRA 2JF0A 3RFCA 2GS9A 4M9CA 3EFOB 3KNZA 2AG5A 5CCXA 5GWXA 3O8LA 4RETA 2HQBA 3MRSA 1G60A 3I0MA 1U8XX 4IGIA 4UDOA 3PNPA 1CVIA 5FXMA 3L7BA 5JYCA 5K51A 4LZPA 5EKUA 3PNKA 2YYYA 4V0RA 4UDYX 2ODPA 3GPDG 4XTRA 3G5MA 1FMLA 2H51A 2C83A 3N2GB 1Z0JA 5K1ZA 3TSOA 1EI9A 4DHEA 3K71B 3TXYA 2H1WA 3TRIA 2IZOA 4BXOB 3R76A 3NT2A 2BEVA 1E3SA 5JSUA 5KX5A 4PAMA 1YHYA 1RS0A 3VM6A 1JR3D 2V8OA 1P0FA 1X1QA 3DBOB 1JEDA 4EG3A 3EPJA 2QM0A 4DDUA 1J06A 5IJAA 5C3MA 1ORDA 1Z7GA 3ZHYA 3I2KA 3N76A 4QFMA 1T4CA 4ALKA 1MX9A 4G63A 1GQYA 4PX9A 2YUIA 3EXG1 4F4FA 4O2AA 3EDCA 5DNAA 4UPVA 4MS1B 3WMFA 2VYVD 1V95A 3ZJVA 1QYCA 5U1PA 3TD6A 3UW3A 2QJRA 5EKSA 5B4TA 2POCA 2B20A 3OTHA 4ITUA 5G2OA 2DVMA 3IT3A 5GAJA 2GVDC 2BFAA 1U9JA 2IDJA 3F96A 3Q5GA 4L8WB 2C00A 3QVUA 4EYEA 1OH6A 1JTVA 3EWNA 3TR5A 2FZVA 5LKAA 1XEXB 2PRZA 3RK0A 3NTRA 1PJ2A 2OT3B 4ZYWA 4QDKA 3BRCA 2H92A 4OLAA 1C3EA 4GMKA 4N6GA 1GQFA 2B1QA 2EFCB 3F78A 3L6OO 3LT4A 3NOOA 3VJLA 2RH9B 1TFUA 5BYAA 4R8LA 2XKJE 4LVOA 4ZQEA 2RGRA 1UBEA 4S12A 1BVRA 1WW8A 3KU1A 4RA6B 4FILA 2ZJAA 3RT9A 3EMDA 2YZNA 2IGTA 4NCJA 2EG5A 4NCIA 4B45A 1WVGA 2YW2A 3PC6A 4N0PA 1P0CA 4QU9A 4KXLA 1NUUA 2PL5A 1IZ0A 4QULA 1V5WA 5DXFA 4EMSA 1E2KA 4I1PA 3IRUA 1SK8A 2ZIVB 3DEAA 1USKA 4WZAA 5I9LA 2FSUA 2LDXA 4FDLA 3X2FA 3W7BA 1PR5A 2ZT6A 1RVDA 3VKGA 4ZP1A 3D4LA 4Y98A 3ESQA 5I9TA 4ZRNA 4CCYB 1U9ZA 4HBGA 5KYXA 2PN1A 2WYVA 3PNQA 2V5UA 4PO9A 5C34B 4UHCA 4XE5A 2V65A 3V8MA 2QG9A 2XZTA 4JENA 2AMFA 4XX0A 3OOEA 3ZTYA 3G8BA 3D4OA 2HJSA 1NJ5A 3LW8A 4NABA 3PGXA 4PG7A 3D4BA 1BGWA 5CVJA 1BQEA 1XNRB 4BDSA 2BJHA 1T24A 4CL0A 4MGZR 2J4CA 4AJLA 4CL3A 3QU4A 3ZLBA 2CNDA 3ZDFA 1IDOA 2Q46A 4J0EA 1M9NA 2B9VA 1Y4UA 3FGNA 4QZVA 2H2GA 2DXIA 1Y7IA 2WJ4A 4CDMA 3V5NA 1K7EB 3RS8A 1G8HA 3RV3A 4AN4A 2Q3BA 3QFFA 4DDTA 2UXCB 3D6FA 3P2IA 2DU8A 1QH8A 4NSNA 4ZT2A 1PI3A 1RACA 4TSFA 4B7UA 2A1UA 1TIBA 4HWPA 3GNQA 1DQRA 3H8VA 3CRMA 3HCEA 3ZHUA 2F1JA 3T1QA 3VDMA 4DWWA 4ND4A 2KM1A 2Z1MA 3UGQA 1YJAA 4I9GA 3ECCA 1J5XA 2VWGA 3M89A 3BRWD 4PG4A 2JRLA 2FDRA 1G38A 5DBGA 2QTAA 5CJ2A 1W85A 3PNLA 3GT7A 4YUZA 4LRYA 4OD0A 4CKZA 3RYHB 1I5EA 1MPXA 4O4LB 5AKZA 2PUJA 1PL0A 1OXSC 2RGYA 3T7IA 2HH9A 2BT4A 5J2UF 4EUHA 5DM0A 4D6YA 3AB7A 2FN8A 2H2IA 2BTQA 3RVKA 3ZU5A 1SOWA 1RWNA 3M34A 4J91A 1ILWA 3BB3A 5TNXA 3TJZA 2Q27A 3KQUA 3PEYA 4WBXC 3FOAA 5JJIA 2NNLD 1J0DA 2VPYA 5FLYA 1Z08A 4GO1A 5I4IA 1MHPA 1JFVA 1PFWA 3A3KA 1SBHA 2PYIA 4X93A 2P4QA 3SFTA 4GL2A 3NHWA 4YTEA 3CV3A 1I7NA 5DNUA 4M8LA 4DNXA 4ZO7A 1IL0A 1T2CA 3CO0S 1AKUA 1JEEA 3NASA 5EQFA 4XVUA 2CLIB 2QGFA 4PQGA 1JKFA 1R5BA 1R6DA 2CMHA 1UBTS 3TLAA 3WGZA 4LOHA 2ZCUA 5FL7A 4A8JA 1RE0A 2YWRA 2GZRA 3K8YA 2FG5A 1LDBA 3GAMA 1H2WA 1IJEA 2ZTUA 1K8QA 4CR6A 1KTIA 5DEOA 5JISA 3DQPA 4EYGA 5F1PA 5J2TA 4RIFA 2HIHA 4DCSA 3ETGA 5BQ3A 4BP8A 2H1RA 4CUJA 1TTPB 2VH1A 2EQBA 4DXDA 2LD4A 2DPMA 2GA8A 1LF0A 4UZEA 2PLWA 3GDWA 1KOJA 1QVAA 5BYKA 1OBFO 1TJ3A 4JI5B 1GXSA 2PRJA 4KVGA 1QHHA 2NYVA 3AIMA 5EZQA 5KNBD 3ZZTA 3GGGA 3OLXA 4PFQA 3ICCA 5B3AA 3U7JA 3WS7A 2CFTA 3NTQA 3OIVA 3P8ZA 4I6GA 2IU4A 4PIPA 5JNUA 2O1EA 3OP4A 1C7EA 2CKMA 2W11A 1CVRA 5M7EA 1G3UA 1O6GA 1Y9EA 3RYCB 1QQ6A 2Q3JA 2YHIB 4NDZA 1I3OA 4ZVLA 3RT1A 3B70A 1LJLA 5FL7D 1PJAA 4F5ZA 3DT8A 2BRUA 1YJXA 1M72A 2EBWA 3E82A 4XLLA 3I39X 3O1JC 4QQKA 2A9QA 2R8YA 4OXRA 2RGNC 4HGOA 3K8ZA 3REQB 4R2JA 3CJQA 6Q21A 1XYGA 2AC7A 2RGBA 3FIJA 4MRNA 4MP3A 2OV6A 2VYCA 4AMUA 5KREA 4DDVA 4KLZA 3EDOA 4GL4A 5JXGA 1Q7TA 3HUDA 3SWWA 4CNBA 5FT9A 1GDHA 1L7BA 2JFXA 2NVWA 3P94A 5ILQA 3F9CA 2AZMA 2QMOA 4D9BA 1MVLA 1T25A 1VGVA 1N57A 3CW8X 3DTVD 4NG5A 2OCIA 1ECGA 3R20A 5MFPA 4PGHA 2B1RA 3CR8A 3TK1A 4FYYA 2W6IA 3MT9A 3DONA 2KJQA 1FB5A 2B4RO 2BSXA 1N33B 3FNFA 4UZFA 2XGGA 3X1MA 4E32A 4LK2A 2GETA 2R66A 3L5KA 4HTFA 3NBUA 5EXSA 3L6EA 2WU3A 1M34E 3M70A 5DB4A 5CCDA 3WB9A 1EX7A 4AW9A 4B85A 2YWGA 4G8BA 4AKHA 4LHVA 5DGDA 4A2PA 3F73A 3JAWB 1D4ZA 2QUKA 3FYTA 2ZDHA 3VUEA 1DEXA 3DZDA 3JRNA 1HDXA 3K32A 3VR4D 4FS3A 1CUXA 3UV7A 2O8FB 3HJBA 2W8BB 1JLRA 5HHTA 4HFJA 5BSFA 3JRWA 5FJIA 3F3MA 5BXQC 1DJMA 3DOEA 3TQIA 2XSZD 1E9BA 3INRA 1XTZA 1YAJA 1HLGA 1XZPA 1C9YA 1EGHA 1U2RA 2Q7XA 4LBZA 4YUWA 1FNNA 1PTJA 4QHTA 4ZEOA 5ITZB 2VT6A 1XUOA 2DFLA 3KSDO 2P67A 4MV1A 2NACA 1Z8HA 2H7CA 3D1JA 3KR1A 4OL9A 4Q3OA 5HDBB 3RM3A 4CG3A 1OXVA 2V4MA 2CJXA 3LLMA 4W63A 1IIBA 2Y1EA 4H3VA 3GLHE 4AZVA 5JS6A 3LWBA 2C61A 5EJEA 1QRSA 5D1HA 2I6GA 2R1TA 3I5UA 2AI3A 3UWMA 3Q3CA 1NV8A 3AJ8A 3HZZA 2CMKA 3STUA 1I6WA 4ZAZA 4BMNA 3RRFA 3RU2A 2DUNA 1WXIA 2WMOB 4E13A 4K0RA 1QHEA 3HN2A 1OB2A 1SOAA 1ZI6A 4IEEA 4BVHA 1LBEA 1Q57A 4GZ6A 3M5DA 3C24A 3BSWA 1TK9A 4XQ0A 3SJCA 3VO8A 1NFQA 4V38A 4GXRA 1OE0A 3SS8A 5I51A 3S29A 1O0BA 4OQEA 4ZZ2A 1RBYA 4XDZA 1TUBB 2PUGA 2QDXA 3H1EA 4IDAA 5IYZF 2JCSA 1JR3E 3LY7A 4AI6A 3EPPA 4M8SA 4HG2A 3W05A 4X64B 5K8IA 1T0UA 4AP5A 4H08A 4GC9A 3LO5A 3E7XA 5CH8A 1IN1A 1NU8A 3AYZB 4RIIA 3S3TA 4F6LA 3CF4G 1O94D 3HY3A 2IDKA 3W34A 2ODNA 2VJNA 1W8DA 4HZGA 1UKAA 5LD2C 1MF7A 2I76A 1LRJA 4KXWA 3KETA 2GQ0A 2R1TB 4KDFA 3V9AA 2XT9A 5JVDA 2FTKE 4HNVA 5F7OA 3T3HA 1N2CB 1GA4A 2P9ZA 3HCPA 3OBBA 1Z25A 1MB3A 5HDQA 3M33A 1MQSA 3EUWA 4RFLA 2CYCA 1J1ZA 3LWNA 5FBZA 3JYLA 3R0ZA 3TLMA 3W1VA 5IRCD 4UHFA 1LWNA 1Z0SA 1IBKB 1XMJA 2YQZA 1EZ4A 1GQ2A 1XHEA 2CLHB 1RQGA 3AQ4A 2VLIA 3G0DA 1YZYA 4YRKA 4YT5A 3T3MB 4QQNA 3WMGA 3WGTA 1MPTA 5E2BA 5KCMA 1P1HA 4KIFA 5AKEA 1O5IA 5BR8B 4HMOA 1HGXA 2Q8NA 2ZRIA 2C59A 3JV7A 4X6LA 1ZA1A 5LQAA 1PJQA 2E2WA 4G9BA 2NXNA 1UKBA 3IAFA 1O94A 4HGRA 3WO0A 2FUNB 1MR3F 5KJ6A 3BXPA 1LK0A 2C5SA 5CW1A 5LQUA 1KYWA 5HF8A 1AXRA 1N3BA 2G5TA 4LHXA 5AKIA 3IS3A 1XCLA 3ZY4A 4L15A 2A9PA 1T36B 3K6SA 1RWKA 3KTFA 1PWXA 1RJ9B 1T4BA 3JQ9A 4MUBA 4P22A 5ICSA 2PBFA 5G4KA 1UBOS 4QPCA 1RYBA 2VTEA 5ALDA 2XUIA 3L8FA 1Q3KA 2QD5A 4OAQA 1Q91A 1TQDA 4IH9A 4TTAA 5TE9A 3R7FA 1WB9A 1W88B 3C6ZA 4BB5A 3JXEA 4K86A 4EB6B 5I7UA 5B6JA 2GZ1A 1QGUB 2VFAA 3P9XA 1VYHA 1BYUA 1KPHA 1QVRA 2A4KA 4ZV7A 4L7QA 1ZIOA 1QZZA 5MN6A 3BQNB 4HQRA 4NPAA 3GO4A 1U0BB 3RFUA 1ZI8A 3A37A 3ADPA 1M1YE 1IULA 5GONA 3CMCO 1BS2A 1YQTA 1AOXA 1KFKB 4QT0A 2ODQA 5IW8A 2QW1A 3GJ8A 1Z68A 4FFBB 4HQLA 4LVNA 3DE3X 4K9NA 2I99A 4DJEC 3IEMA 2V98A 2QT0A 4LXYA 1SWWA 2WR8A 1KVUA 2FSVC 2IJGX 2Q1UA 2Z0MA 5DHSA 4M7WA 4ABTA 1W9MA 2D00A 3ZVRA 5JY1A 5ELXA 3PGKA 4BKUA 1K75A 4MNTA 2DHDA 3N58A 1FL9A 1XG5A 4LXTA 1DKUA 4BGIA 4X84A 3MBKA 1FDRA 2Y0BA 1PZGA 3TPFA 4YY3B 1UAAA 1XHLA 4JUBA 1CHNA 1Y42X 4KAFA 3KCQA 3SEQA 3N7UA 4HB3A 1CUEA 2GXQA 2WIAA 3A06A 3FZGA 4HZIA 1AUQA 2VEOA 2HWKA 2WICA 3HBFA 3UAWA 3QFCA 2BTQB 4M0DA 3FYCA 4AECA 2OZPA 3QEBZ 3N59A 3OLYA 2P62A 3BRSA 4B6RA 1KP2A 1ANKA 1UJCA 1YJ5A 2JBWA 2DE0X 5D7BA 1KI4A 3IELA 1IOZA 4IJQA 4QPZA 3S2FA 1JR3A 3SYNA 3P9YA 4Q9AA 3OTWA 2QR2A 3SI7A 4YX9A 4FZVA 3ABQB 1UDRA 421PA 2BKXA 3RVLA 1BDHA 3UBMA 1ZK0A 3QVKA 5DHUA 1A2KC 4LHZA 2V0GA 1G5IA 4HNRA 3RUDA 2IEAA 2CNKA 4JEMA 2EV9A 2VR1A 3UC9A 1OI7A 2VDRB 2JJ1D 3AI1A 3LBNA 3RSOA 4ZOLF 5KYTA 4UQPA 2QVXX 2IW1A 2X86A 3GCXA 3QM1A 4OMDA 1U1GA 3UWPA 5AJZA 2NIPA 5JALA 3QEAZ 4DQUA 2ZTVA 1P0PA 5B2ZA 2GSWA 3OMXA 4UUAA 2NP6A 5G0VA 4MA4A 3A9SA 1Y6GA 2EGHA 3HZRA 4WASA 3L4JA 2QZPA 1ZAKA 4G24A 2YZ7A 4WA7A 4TTJA 4HAXA 3MF4A 4D57A 5JATA 4QEDA 1AUXA 4OU4A 2QTBA 1U4SA 4KAXA 4MA0A 3FGZA 3EWAA 1A7JA 1FF9A 1P6XA 2DPXA 2F67A 3HYTA 4KN5A 4BRWA 1EVIA 4J0JA 3LVQE 4JOBA 1PKXA 1UKYA 1FX0A 1HE2A 2HF9A 3ZQ6A 1XD9A 2O2EA 4LECA 1E1RA 2PRKA 5ALSA 1Q3TA 1VJTA 3EBLA 3JWPA 3ZU2A 3GLUA 2BFCA 3KTOA 3NWJA 1KDYA 1OC2A 4I1YA 1LTHR 2XDAA 4W6QA 1HA3A 4K03A 1TJPB 2P0AA 2XNDD 3H1GA 5FPTA 4DV6B 1X3SA 3VAAA 3FF1A 1L5RA 4FZ5A 1FVHA 3IESA 2ZIWB 1G9SA 4GXNA 4HDKA 1A0OA 2GBLA 5HA5A 4GZLA 2B1IA 1QO0D 4FC7A 2OCAA 2WSSA 2X2OA 3N8GA 3DEZA 3HCOA 3L84A 2XKAA 1H6CA 3K2IA 2WJ6A 1NLUA 2GM5A 2VATA 3R3ZA 4K9OA 3ZOZA 2WPDA 1HDZA 2A88A 3ZJUA 4L3OA 3VO1A 4GP9A 2ZCJA 2GYYA 2XRFA 1T8PA 4TZTA 5SZJA 1PS0A 1PFYA 1PW5A 1FU8A 1MRZA 1RYDA 3DO6A 2VPQA 5ELLA 3C8MA 5HBGA 3DS8A 3MFQA 4ZEXA 2RE8A 1ZU5A 2QV0A 1XKQA 1GO2A 4UNQA 1QK3A 5DYYA 3LUBA 3PQ6A 5JD3A 1QG4A 4BO0A 5LIRA 4DCGA 1P6UA 2YJ6A 5C8YA 1Y6JA 3QXSA 4KMOA 3AVWA 1H0RA 1ZJYA 1WTAA 1C9DB 4H7PA 5ESRA 3V42A 3J81A 4DR1B 2HMYB 2VH5R 2J3IA 2XNDA 2QIOA 2ZJ1A 5DM1A 4BJ5A 3NBYC 3EGDB 4KG7A 4MR8B 4PNPA 2QXYA 1KARA 3A10A 2H1CA 4B48A 1I9GA 1ICEA 3OM8A 2OKCA 1CR4A 1KDPA 5DTRA 1DV2A 1LI4A 1Z5OA 2CBZA 2C3UA 2C4WA 2IYYA 2WSBA 1FW6A 1WXQA 1ZZEA 4FOOA 1N25A 1V7QA 3T38A 2ASEA 5AOAA 3EEOA 1N4AA 2UAGA 3KJFA 1JHZA 5FYDA 1DOAA 1C14A 1I1NA 3KQVA 3X1KA 1CJUC 2R8ZA 2OHGA 3VNVA 3E0QA 4FFVA 3T99A 5J4YA 1TVCA 2R7AA 1A82A 1EINA 3EUFA 3KJXA 4OAPA 4CMJA 3UFBA 3JYQA 3CNOA 1E0AA 2RBEA 2WJAA 5DGIA 1EFAA 2AJLI 4DMGA 2HPAA 5F5XA 3WP0A 2DKOA 2CC2A 2W48A 4NBWA 4EB8A 3MWLA 1MIOB 4R0MA 4YRNA 4JYCA 2GPAA 2FSPA 5A5DA 2PEYA 3R5FA 3SQNA 4JLOA 1IBLB 5KMGB 4JB8A 4Q3NA 5FO1A 5CNKA 1AN9A 2OKGA 1N5LA 5FIUA 5C4MA 1CUBA 2VWPA 4LWPA 4RJIA 4DRXA 3IRVA 2A9RA 2NT4A 1YKSA 1KKMA 3S68A 1EUYA 1EIWA 2QRHA 1SR8A 4R40A 3WNZA 1JAZA 1YZGA 3HJRA 4F1WA 4KNYA 3HCBA 3C39A 4HPJB 1EQUA 2RKWA 1ISJA 1Z2EA 3AFNA 1CT9A 3FTCA 2BFFA 3NEPX 3Q3EA 3L6RA 1E2LA 1OYOA 4KMRA 4MRMA 5EESA 1ORHA 3HO6A 2L2QA 5A4KA 1DT5A 2GUWA 3UAYA 2VA8A 2ZT7A 5JS7A 1YWGO 2L0XA 1JQJC 1CQJA 1OXMA 2BI4A 3Q9NA 2YWJA 2ZE7A 4X41A 2K7FA 4FYWA 2A92A 3PWTA 4HRVA 4KXQA 5I7FA 1LTQA 4L0CA 1Z8NA 4HWKA 4GX1A 5EZYF 1C0PA 1E60A 1YFZA 3WBBA 2C7PA 4G65A 4RZUA 1C7QA 3BBPA 3H9UA 1OVGA 3Q11A 5EKXA 4RV5A 3RPEA 1KWGA 4FOLA 1X19A 3DWGA 4RPHA 1QFMA 3UJAA 4YV2A 1GUBA 3B1WA 4YK7A 1GUYA 3WNQA 4K40A 1SU8A 4Z8XA 3LT1A 2LWIA 4FW8A 4JMLA 5LA6B 2PUDA 2XMRA 4JJIA 4JROA 2ETXA 2PT6A 2CYBA 3E35A 3AZQA 3CCCA 5F77A 5THKA 2QTGA 2WA2A 3UMCA 1E58A 4MGHA 5CK4A 1V8PA 1QS0A 2HJVA 4J16A 4QTUB 1RFGE 3L0CA 5E95A 4C04A 5AUPB 1SGWA 1LQ2A 1J0XO 2QYTA 4G5SA 4Z2AA 1I4OA 4G0MA 1E2BA 3T7CA 5HKKA 2C94A 4IEIA 4XB6B 5I5GA 2G1PA 2GBLC 5LM3A 4OQLA 2YHAA 3TB4A 3TLKA 1P5HA 3UKDA 4LXXA 3TM4A 3KQNA 3KYIB 4WY8A 4LSZA 1K66A 5IM4F 5K03A 1EUQA 5TS2A 2CWDA 3EDQA 1VI5A 3PCTA 3V1NA 2WUWE 3UOAB 1ZCJA 3A4MA 1U99A 4IF6A 1SXJB 5C3UA 2XE7A 4CEJA 2FX5A 4CTMA 1B8PA 3U3OA 4ARSA 5JHHB 1J2EA 3C98A 3JYOA 1HRKA 1VCMA 1UQTA 4NV3A 4Q0MA 1TPYA 2B2XA 3I1IA 3MLAA 3NYQA 1BQ3A 3AKYA 4MMZB 2WWVD 4B31A 4F3NA 2XB2A 3C3XA 3TRKA 2G80A 1LDEA 1UIRA 3ASZA 4WGGA 2R6AA 5HILA 4ZQHA 1Z4MA 1WZNA 1H2AS 1E3DA 5K3AA 2AHRA 2HIMA 4NY1A 4LCBA 4R1UA 2C03A 2OAEA 1ZNQO 3A4NA 5DKFA 2GCOB 1G6OA 3ESAA 1LLUA 2ZI5A 1FPQA 1GSOA 1J5EB 4IUCS 4O2BA 4LC9A 3A4YA 3R7WB 3SSMA 4A6XA 4EYKA 4RJLA 2ZR8A 5B7GA 2ZYIA 4OXQA 5AJYA 1VKJA 3MNFA 3NDJA 3OOSA 1GPYA 2HFJA 2QN1A 5JCJA 1O8CA 1X13A 5DGXA 4B3FX 3NIWA 4DQKA 1Y63A 4XM2A 1N5MA 2Z3VA 2H6EA 3CEAA 2P41A 3N2ZB 1KJZA 3NO4A 5T67A 3CLTD 4XQGA 2VJLA 1C5KA 4TVSA 4B79A 2CFRA 5K0EA 2FG6C 5FOUA 3H13A 2J4DA 2NLOA 3GAFA 5AD1A 8ADHA 1R8JA 1TUGA 3NP7A 1KYQA 5SV2A 1QBGA 4IV8A 1NONA 4EEXA 3FI9A 2TRSB 4LS3A 4M9ZA 4PCLA 4UNSA 4O3FA 4P7JA 4R1TA 3EXG2 5EP4A 1TOAA 3ZCXA 3QTBA 3VYWA 1PUIA 2O07A 4C4RA 2GCPA 2FY8A 1S5PA 3ZZ0A 4B47A 3SEZA 1GUZA 2CHGA 3K2EA 5AK3A 3EGOA 2IYUA 5FFFA 5AYVA 3RSHA 2BOVA 1CZLA 1E9SA 3LA6A 2X9NA 3FFXA 4JN6B 5B7NA 2VTBB 1QIKA 3CNLA 4IG9A 2XRZA 1ESCA 2W8ZA 2NU8B 5JCPA 2QE7A 3QOFA 2PS1A 2HRCA 3KKOA 3LF2A 1FX0B 1A8QA 1L7EA 2ORVA 1KSGA 3ZS8A 5JLJA 4CLOB 5E9AA 3FYHA 3K3PA 4RUKA 1V6CA 2PAAA 2QORA 3EAFA 2QVZX 1DHTA 3AV3A 3ICPA 4KGDA 2DHEA 1VPVA 2COEA 4I5GA 1K88A 1SXJA 4YP6A 4CEJB 4M0PA 1GZSA 2G5PA 2V3WA 4RHFA 2C4KA 4OJKA 5DIZA 3U7EB 2CLSA 4UNIA 5CYPA 1VI2A 2NX2A 4GR4A 5GZ1A 2ZUDA 3SVLA 3QXJA 2HQOA 2QRMA 3LZ6A 5D00A 4KQ9A 1SXPA 2ATXA 1I0ZA 1LWOA 3T12A 1WZ2A 4A2WA 1TA9A 2JIQA 3EGXB 4TMKA 4U7FA 1Z6ZA 2QTCA 3JWJA 3PFKA 1C8BA 4OFZA 4C6TA 1TMKA 3BE5A 4LNUA 3RROA 2IEZA 5KU1A 1MJGM 2NU6B 3WZLA 1E1DA 1L4EA 3WFJA 5ICCA 5BOSA 4KRFA 1SKYE 3KXLA 3CURA 3FHTA 4RMJA 4TMVA 1T2UA 1DWUA 1D2NA 4MHOA 3TN7A 5L7TA 2QTRA 2V58A 4BX0A 3ZV5A 1ECJA 1ZM7A 5LQCA 1S0UA 3C6XA 4QOEA 3F90A 1RSZA 4JELA 4W4TA 2LE0A 4LI0A 2WFLB 2ZWIA 3L0DA 3QOYA 2FMXA 4IV5A 1CJKC 1JA0A 4R2MA 3UT5A 4FDUA 1NM5A 3M9LA 4UM9D 2VHVA 3T3EA 1NW7A 2FR0A 3WNCA 4BVEA 4KR0A 5DHAA 4Y2TA 3VC7A 2FUEA 3G6KA 3UKJA 2OSBA 3FFBA 3OKFA 2QTMA 1MTOA 3NJ4A 2JJ1A 3B7GA 3LGAA 2VJYA 5AHWA 4D4KA 4J6FA 4HHEA 3OFSA 2QRLA 2QIPA 4S1OA 1FTWA 1GTZA 3IBFA 4A6PA 1IXKA 1WD7A 3ND5A 1FPMA 4M86A 2Y27A 1AQ6A 4ND3A 4U0JA 5U4QA 1VE5A 3OD1A 5EIAA 4BU0A 2BFFB 4MRMB 4E33A 1SHUX 2ZJ6A 4HLQB 3I3OA 2DQZA 4MQUA 2F9LA 5B5SA 1OFUA 4BB9A 2FWRA 2EAUA 3AGQA 3U4DA 3S2YA 2M98A 3R9XA 3LPLA 3UGKA 1B0PA 2LPMA 2X5NA 2Y92A 3P52A 1CBUA 3IP1A 3T7KA 1U0FA 4BMSA 4IO0A 3G0BA 4OEHA 1TF5A 1KXZA 4MZXA 2OQRA 3D1VA 2JHGA 5SY4A 2IUUA 3DEHA 1QF7A 2OE2A 3KB8A 3RSFA 4YCBA 3W4JA 3J7AC 1W52X 2BFEB 4L8VA 1EVQA 3ROGA 3OX3A 4BVJA 2PS9A 3WHLA 1E64A 2CVFA 1I32A 2XB8A 4YT8A 2V3VA 1MV5A 3PEUA 1FRVA 3B12A 4IGFA 3QLUC 1NTOA 3OJLA 3ZBUA 4YACA 4DDWA 5HFNA 5BMVF 5ALNA 2AFHA 1YS9A 1EXMA 1TRHA 3DZ8A 5LP6B 3DL7A 4JC5A 3C6MA 2ZI9A 4FGWA 4YA6A 1QO0A 4LSWA 1NQWA 1KJYA 2GAFA 5KQPA 2VJMA 1NMYA 3L4SO 1N2BA 4IYJA 2V74B 3KV1A 4KBGA 2QUJA 1W2GA 4MQEB 2QLNA 3DE5X 4GE3A 1YFLA 3K0CA 4EY5A 1AS2A 5D85A 4AL4A 5H3LA 4I1VA 1ABBA 2GUGA 1KH2A 2BEWA 1ZYUA 1BFDA 2J9ZB 2J9FA 3PQ5A 1H42A 1W9HA 3EA5A 3MG9A 3QVSA 4L8GA 3TI7A 3ZWMA 4BVLA 2F59A 4L95C 4MW0A 4GLJA 4ILEA 3IQGX 1ENPA 5KTOA 2X40A 2F9MA 4KZPA 3TLYA 1XQWA 3O95A 2YQ5A 1XTIA 4J3NA 4ZA2A 3EXIA 3I8SA 3JQFC 4ER7A 4L4YA 3OQ6A 4X1YA 1JALA 4R2IA 2J87A 2Q29A 3EHDA 2BHNA 4JR1A 1J20A 3BF8A 5TVKA 4KN6A 3BF7A 4EPYA 1UODA 1EAYA 2B7LA 4EARA 2GNOA 3I5YA 3LXXA 1TU0A 2J3MA 3OJOA 3COJA 1FQOA 1PL7A 1BHO1 2H1LA 1TK2A 2GN0A 4E2FA 1INLA 2WJJA 4MP8A 4ZV4A 4I0WB 2ZZNA 1KMMA 2R87A 1BG6A 1U11A 1UZMA 1Z0AA 2PSEA 3VPXA 2O19A 2C4VA 3D2LA 2IC5A 2QUIA 4BO4A 5MDHA 2Q5QA 1QYRA 4N9WA 2PR7A 4GX5A 3V2GA 4DMUB 3O8CA 4TV9F 3EVTA 4L5AA 3N0TA 2FQXA 1X77A 3VOBA 1PQWA 2DERA 1OIXA 2Q2NA 4NDNE 3O4HA 1FLVA 1GYQA 2QAGB 2WG2A 4B73A 2WZBA 3C97A 2C31A 3IHWA 2WJ3A 3ZWKA 4X91A 3FWPA 5IBQA 5A5FA 1E2EA 4PYLA 1UXHA 5J9FA 2OVFA 4AIRA 4RVGA 2L42A 2BJWA 3GA5A 2BW0A 3CCFA 2ATVA 4RIGA 1CDZA 4JLSA 4P3PA 4KACA 4ZOCA 1KS2A 2CL0X 2X3FA 1E4EA 4Y2YA 3TAUA 5C80A 4DBVO 1E8DA 4G4SO 1R6VA 3I9NA 4JJFA 3DR3A 4OH1A 4DSAA 2FMFA 1ZC3A 1MRSA 5JAQA 1GKLA 4AZWA 4D0SA 1PN3A 3OA2A 2H4FA 4NICA 2H2WA 2IE8A 3IMEA 2YXBA 4YGXB 5BSTA 4HI0E 3SYKA 1CB0A 4P9NA 4X7RA 4BNDA 3DVQX 4DIDA 5JEEA 2HA2A 1A4XA 1ACMA 2IPLA 1XRNA 1P19A 1Z18A 1UBKS 4KAAA 1B43A 1YVEI 4HWOA 5DU2A 1LLQA 5CEFA 1SRQA 5JDIC 1S4QA 3NNDA 5IVDA 3TW6A 2G71A 5FQOA 1ZM9A 3BN3A 3FE2A 4BGUA 4BLWA 1XVIA 4MVJG 1T2EA 3KKLA 1MQ8B 2J6HA 1UAGA 1EDEA 3I6BA 1I2MA 3KB6A 4KXVA 4Y7DA 1EP2B 2NU9B 3UCXA 5KJFA 4KLRA 1DUIA 3JQBC 4QQFA 5EXDA 1PW7A 1USVA 4EHDA 3QI7A 4RD2A 1T1IA 2XI4A 5JMWA 1CS0A 5I7EA 1KFJB 1Q84A 3S7TA 4FHCA 5G1PA 4DNQA 4F21A 2XD9A 1SIUA 1RYMA 2QLMA 1T35A 1OPRA 1NULA 2HA3A 2HLDD 2ZTSA 4ZKEA 1VSTA 1ADGA 5EE5B 1GTRA 2QSYA 1JXAA 3AR7A 4L0DA 1F2UB 1JU4A 2F1HA 3O1IC 2M9MA 3I9MA 2IHZA 4UU0A 1DLJA 4WDQA 1PNRA 4XWGA 1SVSA 4O8CA 1COWA 2H9AA 1HZZC 3BE8A 1ZPDA 1HLPA 2F7SA 3K30A 3UAGA 4MGIR 4B4KA 3CN7A 3HMQA 2QVCA 3O83A 1VRWA 1PHPA 4M2LA 4X1KB 4C0LA 4WY2A 2W2MA 4Q1BA 3TGPA 5TF4A 2VDLB 1AS0A 1WF3A 1LVUA 3GT0A 4QGBA 5ALRA 5FYQA 4QA9A 3KP1A 1SN7A 3MJRA 4ESOA 4UFNA 1X1TA 3MGGA 3D5QA 2DPLA 1L7RA 4O4HF 4B3RB 1FSSA 2ZRNA 4TT3A 2IWRA 1T5TA 2YNMD 5B6PA 3IJEB 3ROXA 3TDMA 4PN3A 1BKDR 4OHFA 1D04A 2AK2A 2DUWA 4OM8A 4R5HA 2FZWA 4OKNA 1A9RA 1S1CA 4BAZA 4D4LA 2I6SA 1EMDA 2ZRCA 2RCYA 4HKTA 4KPUA 1QF9A 2GWHA 4IIGA 3IUQA 4NOJA 4RFVA 2VAVA 4FFOA 5EE1A 1JFFA 2Y9MB 3EOZA 3WRVA 3DUFB 3TZHA 4G5RA 1JIVA 3KJZA 3A1FA 2XE4A 3ABZA 1PR1A 3FDJA 2ZSKA 3TMAA 1J6UA 3O4VA 3NP9A 1LC0A 2PZMA 3OFVA 1NXPA 4LYGA 4AQDA 1L5SA 1SUFA 1WCYA 2AD5A 3O3CA 4LVCA 1KGSA 3B1VA 2IYXA 1XLTC 1H9AA 4M99A 1E62A 1ZI9A 2VK1A 1B6TA 1MB2A 2Q1SA 3L7MA 4B7CA 3FN4A 4M49A 4CG0A 4LXIA 4X0EA 4D1YA 3LS2A 3UMVA 3IP6A 3KG2A 3AEQB 2KI5A 4LFBB 3FSGA 1RLMA 1NC1A 2QSJA 2W6ID 3F1KA 4EF4A 1WSDA 1X8XA 1LI7A 3WP1B 4BV2A 4BLVA 5IH3A 3B9PA 4ZQFA 1K5GA 3AJDA 3VHQA 2FW0A 4TKMA 3HBNA 4J07A 1IY1A 4BQRA 3H16A 5LB2A 2AFIE 3BZBA 4EI8A 1ZVMA 2P0YA 2WZQA 1GWNA 1QMPA 3KYCA 1QKIA 2Z4TA 3AI3A 3LVBA 4KDRA 4RGYA 3HS3A 5IAGA 2TYSB 4EEZA 5HKKD 3L0YA 1ZICA 4NENA 3WZ2A 3ZY3A 1SVUA 5ER6A 2V54A 2DFVA 2Y1LA 1X7WA 4W9MC 3AZOA 1Z8DA 5H81A 4B8WA 1BKYA 3DPUA 3GFBA 1VBMA 3TPZA 3RC2A 1K3TA 1TRKA 2X8WA 4C89A 5KVQA 1FMTA 1XRSB 2CJFA 4PCVA 5AXBA 1C7IA 1UFVA 3IEUA 5THQA 2G0AA 1U7ZA 2I8AA 3LNCA 3L7DA 5IFLA 2Q5HA 3ZHSA 1GNSA 1M2VB 1V6AA 3QEJA 2PUAA 1LZKA 2QN3A 4QHYA 5KWJA 4KFCA 4GWLA 4G0XA 4PLGA 3DV0A 5B58C 2R0QC 1A5SB 3JZFA 5A0TA 5FB3A 1C9KA 1NMSA 4BNJA 1FRFS 3P20A 3AHGA 1B3BA 5BQPA 4CCAA 2A5LA 2WHXA 3BQ9A 3GH1A 3OU7A 3QV2A 1XDWA 2C42A 4P3KA 1JDTA 3GEBA 1B6SA 4HXFB 3FOWA 4XGIA 5H5JA 3TTSA 4MHSA 4QSMA 3T9EA 4WLVA 3CB2A 2IWHA 1NQXA 4L5BA 2O14A 4G1CA 2V8BA 1R0LA 2BGKA 3BJRA 3AHHA 3GJQA 3L1UA 1W5TA 1WW2A 1YS6A 1XLUA 2OFWA 2V97A 4XYBA 2DR3A 1V5EA 4WGFA 5IT0A 5FJJA 5CR9A 1CUUA 2ATCA 1RD4A 3N2GA 2OD9A 2FEKA 4S0XA 4U9HS 2XOKA 5EGSA 3FUUA 3LFHA 3KSUA 1S7GA 1VE7A 6GPBA 2WEKA 1JIIA 4NE9A 5HZGA 4WK4B 4X1IB 1KA9H 3UK1A 3AM1A 3W6PA 3WWCA 3FPEA 3HH8A 4F4HA 1EJ0A 3K0AB 3MMNA 3EFOA 3QITA 5CVUA 4MUHA 1NPTO 3EG9A 3WGKA 1YZHA 5AKHA 1QC5B 1GUDA 3EUAA 3ACCA 3GJ0A 4FNAA 4QYTA 5DYGA 3QKRB 5FWXB 4BLUA 1NVVR 2CVHA 2J3QA 4GS5A 5HPYB 5B1DA 5BSHA 2NG1A 4H0NA 4UD2A 3HCRA 5BOSB 1VCNA 3JQCA 5DO9A 5HW0A 3MS7A 1JSXA 8LDHA 4D3ZA 2N1MA 5ICEA 3NDRA 1HOTA 4WVLA 4ZDWA 3L01A 4E7OA 4LWZA 2PRIA 3O82A 3T5TA 1AS3A 2R7LA 2JD1A 3DHEA 3NS7A 5A7HA 1JTFA 3VR2D 2VWQA 3W06A 3O1LA 3LZDA 1JZTA 3TS1A 3EB9A 4HXGA 1T13A 2PNFA 3GMDA 4IIJA 1XMQB 1DO8A 1T43A 3DMDA 3ZHQA 4KC0A 1PS9A 4XQ9A 3PTZA 4YCLA 2WD7B 4YWHA 4JEHA 2IHKA 4RIEA 4QG7A 2RGCA 4QWWA 4D43A 2ZRHA 3EW7A 3HHEA 4KVZA 3SHWA 4E5DA 4JYAB 4WOCA 1T1SA 5EIHA 4CLOA 4P35A 4ZMSA 4M6WB 1QBKC 2VDWA 5LQKA 1U5CA 2W2VA 3AKEA 3GP8A 2FF7A 2OXCA 4DA7A 2J41A 3ME5A 4XD7A 1G5QA 2G72A 4I9NA 3GLIA 4DA4A 2NZ8A 5AXAA 1V1RA 4N5IX 3JD1A 1N3YA 4G0YA 1H6DA 4NBLA 4BN5A 1A1VA 3STHA 1GU7A 1LFDB 3QLJA 1M75A 1CUWA 2C29D 2JCGA 2OLJA 2ZWVA 3DAGA 2YWDA 4YJDA 1B1CA 5TR9A 3T5DA 1YJ8A 3C4VA 2HBQA 5ITWA 1S8FA 3DXFA 1RLJA 3QELB 3C3JA 3VDXA 4MDYA 5G0WA 5K20A 1UBGA 3ZJ5A 2A5DA 2JHFA 2D1RA 4R31A 1OAKA 4QODA 4D98A 2VQ6A 3ZWBA 2VHZA 4Y1EA 3MPUA 1YE5A 4Z2YA 5K3SA 1G41A 1LSUA 4Y0NA 3THOA 1E3WA 2G09A 4GPZA 4MI6A 3ZD8A 1XKLA 3M81A 1M33A 1A2QA 1UWCA 1VJ1A 1Z37A 3COSA 2W6QA 4DSTA 4RE6A 3USZA 5CAEA 2XKKA 3BHMA 3PXDA 5I7VA 2HRRA 2IYTA 2DBYA 3AB8A 3K70D 4JP8A 2W2QA 2GGSA 1Z2OX 1MOZA 1Z4OA 3N05A 3K1JA 4GPTA 4OP2A 2F1OA 1V11A 2HJGA 3ESCA 5CFOA 4K05A 4RY9A 5FLKA 5JE8A 1ZHHA 1D6JA 5COQA 1OA0A 3IIMA 2C7OA 3ZWPA 3M49A 4J9UE 4MLZA 4IH4A 2OBMA 1EJ2A 3LSYA 1PJRA 1YC2A 1P1IA 1D7OA 4FDVA 2QA5A 2VBCA 3RADC 4MB0A 5MN5A 3L7AA 4URFA 2IH2A 1AKQA 1SG6A 3C74A 5FFNA 3ROTA 1M0EA 1S4MA 2ECFA 3ILSA 2GI4A 5EJGA 4UFPA 4YHHB 4P34A 3ZDBA 2O3SA 3K4PA 1U0OC 4GKAA 5A5GA 2W00A 3LOPA 4DLZA 3EA4A 3P0RA 4K7JA 4R3UC 4X62B 5HJ2A 4OKSA 1C4WA 2OFOA 1F7UA 4FI3F 4XQCA 3HKBB 3LW7A 4C14A 9GPBA 4UXIA 4LE0A 4TYMA 5FI1B 1YOVA 2C1EA 5L3SB 4XWWA 1D2AA 1PX0A 1TTHA 1ZFNA 2ZTHA 4FZJA 4N5LA 5T6BA 3ZDDA 1N3IA 3C5WP 3IEKA 4TS9A 2K5UA 1K6JA 4WERA 1K5DA 1CB7A 4QD3A 2DQKA 2P5UA 3BGVA 5E2AA 1U3UA 5LYJB 3HB9A 1LA2A 5HRUA 2ZRDA 5F2NA 1QYDA 1BWPA 2ZPUA 4QOGA 1QORA 1RT9A 2IYSA 3BGOS 2E1RA 3OOJA 3P26A 3OO0A 3B1YA 1Y0BA 4EPTA 4ESEA 3OQPA 3KKEA 3O8NA 3ORSA 2SNIE 5F64A 3CEPB 1P39A 4D4IA 3B9QA 1JQ3A 1EDBA 1WKCA 2AH5A 2NO1A 5BQOA 3T1VA 4DKJA 2EKQA 4IXNA 3LQ2A 2NO6A 2G9VA 2X6RA 5G41A 1KF0A 2OORC 4AF8A 1W36C 3EJ6A 5HCNA 4XLZA 3OQIA 4KSYA 3WC4A 2BD0A 3EVBA 3L0PA 4HLNA 2GK7A 1H9CA 1Y5IA 3WLFA 4R51A 5KYYB 3OX2A 1G3RA 5DHRA 4HYEA 5EJFA 4AURA 2C57A 4HNAB 1CTQA 4LX0A 2YC4C 2E4AA 1Z3CA 3QSYA 5JSQA 2GO7A 4EO4A 2CD7A 4ZCRA 4E5MA 4QTTB 3UCEA 3FZYA 1R4MB 5F78A 3QVVA 3WI7A 3KR0A 4RYDA 3ZIDA 3AZPA 1W19A 3LTEA 2AOWA 2WUDA 3G9QA 4FFMA 1IM8A 4WSOA 4BIIA 1BEUB 1WB6A 2O2HA 3FFAA 3TQOA 4E2WA 4N7BA 2EDCA 2WAYA 1FS4A 4HFRA 4J7AA 4JFAA 3URMA 2LKCA 3OT4A 4WV3A 5EMNA 4PWYA 1SHLA 1U3DA 1NMQA 3H2IA 5ALWA 2EFHB 2A67A 2XV1A 3TO5A 3KVNA 4DILA 4WI1A 3KOOA 2F2TA 3LXRA 2JCXA 3RKSA 4X7MA 1Z2CA 1ISIA 1EM6A 3R9WA 3GLGE 3AU9A 1WDKA 2G0NA 1HNZB 5KOJA 4S1VA 1V8DA 4YRZA 2WRZA 3H3FA 3NHBA 1ULTA 2WAAA 4AB1A 1X3LA 5KWIA 1OVMA 5EPUA 5CLJA 3G89A 5FUBA 1DAFA 1O5OA 1RE1A 1KGDA 2JGDA 3JD0A 3IR7A 1QB7A 1RIFA 4UTOA 3QQPA 3EJWA 4YXWA 5REQA 5K6TA 4E14A 1CIPA 4FS8A 4C6SA 3ZGXA 2QRVA 4PHHA 5G0SA 1W5FA 1L5VA 4X3PA 2AJBA 5HSGA 3N53A 5GPBA 5K3DA 3GBVA 5CVCA 1Y34E 2A78A 2HQRA 3CISA 4AY3A 2HMSA 3T1NA 1GZUA 3PFFA 2BI7A 1X8JA 4BV8A 1E94E 4CLEA 3WVNA 2W6JA 1GQSA 3PNOA 3W04A 3E58A 3GJ7A 3PWZA 4G1FA 1X7ZB 2XIJA 3CNEA 3WK4A 4R16A 1XZEA 3WWZA 4L0QA 5EIBD 2HGZA 3I53A 1KH3A 3R5HA 1LBQA 1PF7E 4YJGB 2V96A 1VLLA 2O59A 4WXPA 3SQWA 1HFWA 4MDFA 3DT6A 2HDWA 3RASA 3UKOA 5MN4A 4UTNA 2W37A 2D5LA 1BD3A 1HLDA 4Y2HA 4FCVA 3L02A 1NJFA 1DI0A 3VHXA 3V7UA 3N2KB 2XQJA 3RKRA 1GT6A 4LRSB 5DH9A 4B6PA 2BGIA 3JQ6A 1NBIA 3U3DA 1GHTA 5A6SA 2CD9A 2DJIA 3U4MA 3GLQA 2CUTA 3OPYA 4ARZA 2IS2A 3IXQA 3WJ2A 3NOXA 2NPIA 4ZVQA 3U3KA 1WHSA 4LYHA 2HM7A 3V32A 1JB1A 1AGPA 1FYVA 1OLUB 1XIVA 5DM60 1XZ8A 1ZXLA 4OHVA 4TTPA 3RE1A 4NH4A 5ECDA 4IUYA 4R69A 4DDKA 2FJ0A 2GD0A 4XKJA 4OXKA 1C4KA 2XBMA 2XUAA 3I5MA 3IBGA 3N0WA 3QVTA 4YQZA 3QPAA 4FHGA 4LE1A 5LP6C 3THXB 1OBCA 1N6NA 4AWXA 1UDXA 1YR7A 2UZIR 3MWFA 1UFRA 1ZMXA 4PINA 1VHWA 3H2BA 5ARCA 3TD2A 4EW1A 4D6PA 2DB3A 2RK6A 4YS6A 1CJMA 3I64A 1JZQA 3RCBA 1OLOA 3E53A 1S3IA 1WLYA 3TMKA 4F12A 2X5KO 4UAUA 3B5EA 5DNDA 4F6CA 4B2YA 4YRIA 4FFBA 1BWQA 4BP1A 2XCLA 3RVPA 4C5CA 4MHTA 4URWR 5E7JA 1M34B 3WK8A 4ZT6A 3GC6A 1IPEA 5DXJA 1V11B 2JDIA 3OSZA 1XQYA 3GLTA 2N47A 2ZJFA 4NV1A 1RI5A 3TNJA 4HDCA 2G1JA 4ID9A 1AUVA 3DC2A 1DTEA 4L4ZA 2UYCA 5HK8A 3ZJTA 1UBSB 2PPLA 4J03A 1OXXK 1UEJA 2QTLA 4OXYA 4MGYR 4V02A 1WBBA 3LQ1A 2IK8A 2HBRA 1QQ5A 2GVZC 3HYSA 4NJMB 4YLEA 3TCXB 2A94A 4KPUB 3LIIA 3COWA 3WQBA 2VDUE 4CEIA 3N9IA 1IVNA 2XYHA 4X7BA 1ULUA 1XP5A 3BICA 3OY7A 2JC3A 4DMLA 1NJ6A 3OIYA 2EX0A 3LUJA 4AG3A 4OYYA 1PGQA 1U3WA 3CRQA 1E1YA 1X38A 1DJNA 5TV2A 5EWMA 2J59A 2GBFA 3AM3A 4R4JA 5DK4A 4I1UA 2GBPA 3FFWA 3FUWA 3NFYA 2GVNA 1JR6A 1N2SA 2R48A 2BFDA 4PICA 3IALA 3L04A 2IY8A 4XVHA 3SOPA 5HQ3B 3RVBA 2V59A 4LJ6A 5C7LO 4F38A 1YZTA 1NJ8A 3DD5A 3FPHA 4RHEA 2P6RA 4FGZA 4XPIB 1JG2A 4EL5A 1CE8A 3C1AA 3G3EA 3V33A 4F7WA 3RIMA 2EW8A 2FQWA 1VHDA 1L5HB 2XXAB 1LK5A 2HHAA 3GFPA 4GBJA 4PC6A 3ZGLA 1TYZA 3S99A 1M2JA 1M2OA 4UMVA 3D8UA 1CUFA 4WEQA 2FLWA 2H1VA 4HV4A 4GKKB 3C3WA 1H1DA 4RTKA 2C0CA 3AFOA 3NI2A 2ESRA 3QE9Y 1QIDA 3A1TA 4FXOA 1XQ6A 4QRIA 1OMOA 3GWZA 4U8HA 3USES 3PD7A 3N0XA 3G59A 2IP4A 4FVTA 4I4LA 5IKMA 3DFKA 5KVVA 1G0NA 1MAWA 2IXBA 3KUDA 1K08A 3WLOA 1JJVA 1KEVA 1AHPA 1DIAA 3MC1A 1V7PC 1GY8A 3KEQA 2J0QA 3ZDAA 3DZBA 1XZQA 4AJ2A 5L8VA 1O0SA 5K3FA 4DCPA 5LQMA 4I6EA 3RUEA 2ZANA 3S1SA 1PJ8A 2AZDA 2AOXA 4E1BA 1RXIA 4FWBA 1MOPA 2A84A 4DYDA 5HE9A 4KOEC 1T5HX 2CNWD 3IVAA 1IHOA 2JANA 2XMQA 3KZCA 4JMPA 2I4NA 3T6KA 3JATA 4PQFA 3F5MA 4Z3DA 2OP0A 3VVMA 3DV0B 1UC8A 5I47A 3I3SR 4QBHA 1EE1A 3EH2A 2NTJA 4LWOA 4XIIA 2IZZA 2XKBA 1FDOA 1TKAA 2BKLA 4OOFA 5DW0A 1ZGAA 4FT4A 2OHIA 1PR4A 3PU6A 3QVGB 4W8GA 3ULKA 5JC8A 1P0MA 5D6NA 4YIHA 3AIIA 1QNFA 3ZHRA 3LKBA 1Z7BA 5H4HA 2YYSA 4X92A 3BT7A 1HDCA 3QF4A 4A92A 1XVLA 1BJKA 1SXJD 3ZWOA 5GZ3A 1I7DA 2G1UA 1P5FA 3MOSA 2AWOA 1CD5A 2Y2UA 3JQRA 1E61A 5EYPB 1T91A 5JO0A 1RHRA 3BWBA 5ECYA 2ZPAA 4RZHA 4H1VA 3V3KA 1UOEA 2JEYA 2VUUA 3KSMA 3B2NA 2JLYA 1MV8A 1P3DA 2PSJA 3OCZA 2Q99A 1IWPB 1NVVQ 1WHTB 2AEMA 2QI9C 3F5FA 1W34A 1NMEA 1K1EA 3E7PA 4CCWA 3OE1A 2NU6A 1ETUA 3QVOA 5I48A 2PXCA 4XWTA 1BX0A 4CKWB 2GZ3A 3LHKA 2DHQA 1XXHE 1RABA 1EHCA 2XT0A 2RGWA 1ZH6A 3BMXA 4O2BF 4AKSA 4E3WA 4WADA 1XMOB 1WMDA 2NSYA 4GQAA 5FBLB 3BWDD 4BX9A 2FW1A 1O08A 2WKSA 2ORWA 2XDQB 4Y9SA 4MVWA 1THGA 1NOKA 2GJ4A 3R6TA 4N0MA 1DCMA 2GFQA 5TJHA 1QE0A 3PJGA 4DT1A 2NVUB 1BS1A 4A8JB 1OH5A 1SO8A 3RVNA 1CUDA 4OMUA 4CM1A 4P80A 2A58A 2WWRA 2XUDA 4Y2JA 1EDZA 1VB5A 3MRVA 4ILKA 4OUKX 2Q3HA 1BGVA 2A0KA 2I80A 3HGTA 4NC9A 4P81A 3NM4A 4CETA 3ZY6A 1VM6A 2I2FA 1R8XA 1AM4D 2NXWA 2IYEA 3AMVA 4LYDA 4XARA 5J4VA 2A8YA 1U28A 3E7FA 2A1UB 4MPTA 4NPHA 1H4QA 3L8DA 1DIHA 4PG5A 2NUAB 1JIQA 4W1PA 2EXXA 4BFVA 2GEVA 1XZCA 4BATA 4ZVPA 2GYVA 1NUHA 2GZAA 2YZKA 3K5PA 4TVBA 4ZAGA 3HFRA 4ZT7A 4JXXA 3PJDA 4LRWA 4D80A 3FKJA 3H3JA 1EH5A 1HORA 2RHRA 3O7WA 4KJXA 4N12A 4DQLA 2XB6A 4PLYA 3CU5A 1TVKA 3D3WA 1IUNA 4C0AC 1L7QA 1QRTA 4B3SB 1RPTA 3VU0A 1JBKA 2JFWA 2OECA 3C6QA 4M0FA 2IDMA 3TRJA 1ID1A 1E1LA 4I55B 2AJDA 1WXGA 4HGZA 3OWHA 5CFZA 4HNSA 2CNLA 3NDIA 3LY5A 4KXMA 4RTQA 4D99A 3PXCX 3QKSB 4ZOLB 4W9RA 1NDHA 2WIJA 1W7AA 2MDTA 2R8EA 1MH9A 3MRXA 4IDNA 5I3ZA 1TXGA 6REQB 3MIZA 4MS3A 4DIOA 2HUPA 2D1FA 1HTTA 3D0OA 4LMPA 4YMSA 4ZEWA 3ZDEA 2FQQA 3AHDA 3N6XA 1NRXA 4IMPA 4F92B 1PWHA 3I52A 2JGIA 3ANTA 1Z56C 4GZ5A 3A27A 5J63A 4FNMA 3M6UA 3SC4A 2XW6A 3EVZA 4Q82A 4NBNA 2NZXA 3K6SB 3K92A 4KGZA 3PD1A 1N1EA 2C58A 5C5EA 2WP8J 1NQVA 1U8FO 1J22A 1E2UA 2VXBA 3V8EA 5FOQA 2IPMA 2RBKA 2O8EA 1L5MA 2V9PA 3DEFA 2GWRA 1YACA 3QX8A 1R66A 1CHDA 2B36A 4XCXA 1G0OA 4AJHA 1XVVA 1SH7A 2FFQA 3DAOA 4CMEA 1J8VA 2G1KA 2Z9CA 4UHEA 1RPJA 5K2OA 1C30B 1BWRA 3DOFA 3LZCA 4M76B 4XH9B 1O6FA 4JR0A 3LX5A 4PYKA 3U80A 1UIMA 4D9HA 2I4OA 4ZCMA 1K0UA 4I8DA 2HDOA 4FKZA 5AQ1A 3HGQA 1TCBA 2YV5A 2VRCA 3MD0A 3T35A 4PFSA 5IKXA 3CWCA 4C87A 3JQ7A 4G36A 2BLLA 1FNCA 4MX8A 1APBA 4I81A 4XOIA 3V3TA 3BUSA 3D31A 5DM4A 3DPSA 2CJWA 2GZ2A 4PYMA 3VYRB 1P6QA 3KL4A 1DX9A 1QYVA 1ULSA 2VPZA 2CV0A 1H5QA 4HNGA 1BVUA 2GM9A 2G77B 2BCGY 4JA0A 3M6AA 3RVDA 4D96A 2HK7A 2XCQA 4K6OA 4B80A 1E9FA 3OFNA 3OOHA 2BTEA 1OT5A 4HLCA 1JP7A 1E6EA 3A1DA 1LLCA 3AF2A 1AGRA 1CP3A 1KBOA 2P8SA 3B3JA 2O8CB 5F9FA 4L3WA 4ZU1X 2X9GA 1W4LA 5JI2E 5ALPA 1UBCA 1XEXA 5CDGA 1UT8A 2Y1DA 5FQNA 4AG5A 2AUMA 1BDMA 1IXZA 4I2NA 1E7SA 3FYDA 1T9HA 3OZCA 4REQA 1P9OA 2YOHA 3QXCA 2G40A 4MW4A 4Y9RA 3HA3A 2BGMA 3VR3D 4KE8A 5IFKA 5HE8A 3GFVA 1TM3E 1OU4A 3M0EA 4XWAA 4C03A 4CMGA 4HVLA 1OLUA 1NLZA 1VXRA 2GKSA 1WR8A 3W5JA 4F93B 4OJMX 3HU3A 3U7QA 2JRCA 2P69A 1Q44A 4EMBA 1OB5A 1A3CA 4MUEA 2P9QA 1YBHA 5LQDA 3QMVA 2WNIA 1V45E 4QUIA 4A9AA 2NXJA 3VMFA 3WYNA 2ZQ5A 4AFNA 2VRBA 1ZVVA 1NXTA 2HNKA 1LK7A 5JMPA 3DLPX 2JIRA 4BNUA 5K7SA 3U4HA 3GFGA 3MA0A 4MIKA 2FMUA 3NV7A 4KFSA 4YRJA 5JADA 1K3FA 1I33A 4AXBA 2OZLA 1GGFA 1R0SA 5EGNA 1KE2A 2I3AA 2PBRA 2ZRAA 4QFCA 4BU1A 4P4UA 1T6ZA 5C8VA 1H1TA 1E2JA 3IVMA 5DIFA 3USCS 3M1YA 4FYJA 1UFOA 1X7YA 1C3VA 2UVDA 3NVAA 5P21A 2FETA 4L02A 4Z1MA 2NGRA 1AUPA 1J1IA 2J48A 1N8NA 2G5GX 4CKCA 2FDXA 3GCGA 1KJQA 4JUDX 4M1MA 4R68A 4YJ3B 1QVWA 1T9ZA 3B8HA 2PLFA 1VMEA 4JLJA 3T5PA 3K94A 3KHSA 2J0EA 1KZ4A 1GGKA 1T8TA 4OREX 5C7YA 1KI2A 5KINB 4EHHA 3SZ3A 1PO7A 3CPSA 2NQ2C 3ZV7A 3D6AA 5T5QA 1EGAA 3JR7A 4OLHA 3V2UA 1Y1LA 4U7DA 1DCTA 2G08A 4QPNA 4YRMA 3H8JA 3T7EA 3HP7A 3KQOA 3ZCPA 5TT0A 4IF4A 1L4GA 1CR0A 1WY7A 1GG5A 2ZDGA 4K28A 3UMYA 3BJIC 2ISCA 2K7ZA 4YP7A 3FKSD 4JUIA 1IN4A 3EC7A 3DKRA 4KFUA 4LJ7A 4MR8A 4U63A 1FUKA 1TQ6A 2UDPA 3FOBA 1C7RA 3RTEA 1QC5A 3IBSA 4RORA 4TMZA 1NFFA 4N3NA 3RIEA 3SJUA 1Q21A 1XCJA 4JVNA 3HJTA 1ZR2A 4L5CA 5JVDF 2CDNA 1X1AA 4CMEC 1AB6A 2R2GA 1MC8A 5E38A 2BF7A 1JJAA 1LSJA 1MDFA 3HXOA 3JVUA 4JDUA 3VU9B 2H1FA 4N54A 4R8MA 4EGJA 3O0DA 4IVRA 3SHVA 5CIQA 5AM3A 4MUYA 2QX8A 3KOWA 4FQ7A 3HXQA 5A2QA 1HSZA 1OJ7A 4DIMA 4R9VA 4R2LA 4RD6A 5GOTA 1ISPA 1RWWA 2G88A 3SYLA 5JSKA 3ILHA 4GC5A 4BTVA 3JQ8A 2IHYA 4MUJA 3ER9A 3I30X 1HNXB 3DOHA 3QP9A 4HDRA 2X0IA 1C0KA 4XGQA 4PY2A 2WJWA 2IGBA 1N2CE 4CODB 4F71A 2V7XA 1A9SA 4KO8A 4BB6A 4CYMA 3FUVA 1Y89A 2B8WA 1ECBA 4BC1A 1NLMA 3K0AA 2NV2B 2EGGA 2MU1A 2FOLA 1U7PA 2VN8A 3ESYA 2L82A 1I4EB 4QM7A 4UEJA 3CZAA 5T3UA 5EHQA 5KKNB 4CF3A 4W5QA 2Z1DA 1Z06A 3QZUA 4AO6A 5I9SA 1QFSA 3N75A 3S2SA 5KTSA 1D3AA 2RMKA 2ZE8A 2IBMA 1MIOA 2RHDA 1Q3HA 3TIGA 4LNUB 3MJTA 4C7MA 2XY4A 2CNOA 1W25A 2HNBA 3EIXA 2CHVA 5L6MB 2H08A 1LPMA 3F6BX 2WV9A 4DR2B 1B3RA 1MHTA 4FBMA 4G89A 2Z6VA 3HXKA 4CNQA 4YAEA 1UFKA 4CN8A 1J0EA 5IJZA 4RO0A 1RRFA 5NLLA 1N1MA 5AOCA 4OQXA 1L5QA 2FWMX 4YDRA 5JG7A 2EP7A 2ZRMA 3OH8A 4LK3A 3WL4A 1R3DA 3MJ4A 2JGMA 5ADWA 2Q2VA 5K8CA 1KQGA 2AMVA 2ZIGA 2QM8A 4MWEA 1EBFA 4RDHA 3W6UA 4UOZA 4CFSA 3MN1A 4DDHA 2OBFA 2O7QA 4HUTA 3P27A 1RKUA 1CF2O 4DRXB 3A28A 4BO5A 3PJFA 3SKXA 3ADDA 1ADJA 2YOGA 2IBSA 1U7OA 3GK3A 1SK9A 5TQVA 1E32A 1PYDA 2PS3A 3TJRA 3QEMB 2QW0X 5JY6A 2FI1A 3EIHA 3KDPA 4A5SA 1GM5A 1OWMA 4UAGA 2ENUA 4GBGA 3W4KA 1NHWA 3ZU4A 1TLTA 1PT9A 1NXQA 1UR5A 1PRYA 4IXMA 4UUBA 3V8PA 1E0JA 4BJ3A 2AF3C 1GN9A 4R6XA 2ZWOA 1ODCA 1KDTA 4L5YA 2DAPA 1S3SA 2VOJA 3G8AA 4R7ZA 1RFLA 1T0JB 5EWLA 1UPTA 1SZDA 2ZIXB 1CUAA 2O8EB 2P2DA 5ECWA 4LKOA 3T06B 3L8YA 4DADA 4JLNA 4R5MA 4EDFA 2J0UA 3Q3HA 4CV1A 2R7KA 2PZEA 2X58A 3L05A 3GPIA 4B7AA 3AF0A 4OLBA 1V3VA 1G55A 1KY2A 3JTMA 1WL8A 1C9MA 2JAXA 1TL7C 3QTLA 4A8JC 5E1OA 3AR8A 1A7AA 4KJZA 2FEWB 2Z3ZA 1NASA 1P5RA 3RDPA 2AG0A 3QELA 4PO8A 1N6OA 1SBQA 1Y3BE 2O6LA 3P2OA 4EJFA 2X0NA 3UGTA 4B3JA 1XTVA 4TMWA 2VTBA 4INZA 1DEAA 1R9NA 1UZUA 5T4FA 4DZRA 5JH7B 1XT6A 2XGMA 4GOOD 4Z0NA 2YWEA 3ELUA 3O84A 5DN6D 1AMUA 2Y3IA 1F60A 4NATA 3URKA 4G67A 2V45A 3WGJA 4Y6GB 1QU2A 5CU7A 3A6KA 4D3YA 1GT91 3EIUA 3JCZA 4MOWA 1C4XA 4XJSA 4CLXA 2HMVA 5HIMA 5DI9A 2NAPA 1Z6QA 3B13B 4TLAA 4DIEA 2ZYHA 5ICFA 2I71A 4JHLA 4PPQA 3BZUA 5CLIA 1X1DA 4CHTA 1VIDA 4P5DA 1L1QA 3PK0A 1RXUA 4RJJA 3GGPA 1NUAA 4M87A 1LW7A 3VR2A 1EFCA 5EZSA 2H0RA 3IHKA 5JFGA 2GNAA 2OXIA 2FW8A 3S2GA 5BORA 3KOYA 4K88A 3VZQA 4EA6A 1GAWA 1LX6A 2JD0A 2VCYA 1G8YA 3DPIA 4RA9B 2PZKA 3KVOA 2YS6A 3R7WA 3VDQA 4E1VA 3LI2A 5F3WB 4GMFA 3TKYA 1KJNA 1NA5A 3IEPA 5LNK1 2P3LA 3VC1A 3VPCA 5EPOA 2XHEA 1ZW1A 1JU3A 4ZC1A 5IDYA 1XB2A 2OGTA 4QT4A 1R50A 3FWYA 3MTGA 1TJ5A 4D3FA 1E89A 1JU9A 2D59A 3ES9A 3NHPA 5AJWA 3GRPA 3GN2A 4K3UA 3D2CA 1UBUS 2Q21A 2RGXA 3FNRA 3NNSA 2OMKA 4HH1A 4LY0A 4Q16A 4ZOAA 3WL6A 2JLUA 2J5XA 1Y8RA 5CDYA 4PVDA 3H6HA 3HSSA 4C08A 1RADA 3A1SA 1NNEA 4K6KA 3ICVA 4XDGA 1NKVA 5KHAA 3C3AA 4FI3C 4HEA1 3V1UA 4INOA 2G04A 1I3LA 3FSJX 1F3LA 1IG0A 5E6SB 4G8DA 5B64A 4Q19A 2B9EA 5KWVA 3R8CA 1UOOA 3KR2A 4RTRA 4WNAB 4JEUA 3CLUD 3NWPA 2EJUA 2PH1A 4B33A 1QCYA 3I04A 2ZI7A 3JD3A 2Q2WA 3TVTA 3REFA 4EZIA 2P78A 4ND8A 3U0VA 3S1AB 3UV3A 4GOND 1UT5A 2V4ZA 1DU4A 4CTJA 2XE8A 3QJGA 1SCQA 3M6IA 3OT5A 1IOLA 3U3XA 1OT3A 5ALTA 3QG5A 5B58T 2FSHA 3GNTA 2AG6A 2ZRPA 4OKIA 4EY3A 5KYNA 2LDBA 1Z2DA 2PZBA 3JWEA 4PGAA 4ALLA 4TKVB 1IUPA 2Y99A 1V4VA 5KYUA 2RK3A 3LDGA 4ECAA 4TS3A 3WBFA 3OZWA 2RG1A 2HY7A 5KTMA 4JZKA 1MQ9A 3QVGA 4ZYYA 1QGED 1RRKA 3BSFA 5AXCA 4DXHA 1UWKA 4UZSA 1X2BA 1L4UA 4CIXA 1VJGA 4KH0A 3KJQA 2NSHA 2G9RA 3T1OA 1Z7WA 2NV6A 3P9QA 4HJRA 4BX3A 4POOA 1A8IA 2N1BA 5HUHA 2FPGA 2QJOA 5F9HA 4EHFA 2P9JA 1L8QA 1PT5A 1II9A 5EWJA 5IDVA 3JQDA 3THSA 1M83A 3U1VA 1EFRA 1AN0A 1Z0DA 3QFTA 1C41A 1NKSA 4R81A 4REQB 1I3KA 2OXFA 1LDNA 2ACKA 3E8SA 2D4HA 4J16C 4XXHA 4A0QA 1FXWF 3CNQS 3NHMA 2X76A 1N5RA 4CQLA 1HV8A 3C8ZA 3SAJA 5ADHA 1AC5A 2QVBA 4IZHA 3M6FA 3RYIA 3NDPA 3W2EA 3RQSA 3IOEA 1UJNA 1Z4PX 2O9JA 1FQWA 3VZRA 3UHPA 4CIYA 1HKUA 2XWBF 3AIOA 1E3MA 1ZD3A 5JXHA 1XZKA 3OU2A 4ZZ3A 4RHXA 5HRCA 1FW8A 3TIFA 3PR2B 1MMFB 1X86B 1EVEA 1XZIA 2YVQA 3WJAA 2PWAA 4HXYA 2J3JA 4CUZA 2OQIA 4P32A 2JLCA 1O94C 4RK5A 2YVLA 2D7DA 1E8NA 5TRTA 2VS1A 1YA6A 4KWTA 3GJXC 5CT4A 3QBEA 1XTRA 3OZDA 3QUAA 4Z9BA 1H69A 2KSQA 4RK4A 2CXOA 2XMPA 3PNMA 4COKA 1KDRA 1U31A 4URVR 2QYSA 3O8OB 1TC2A 2BMEA 3VOSA 1U3VA 4M8NE 4D97A 4ENWA 4KQFA 2Q6IA 5FBVB 4FD3A 3UK7A 4WFJA 1KI6B 3RVMA 1T29A 3VOTA 1Y9JA 4RKFA 4DVGA 2C99A 5ALLA 3COYA 5K01A 1UWLA 4CIWA 2ECPA 3ANNA 1KO8A 2A3NA 3GA0A 3KT3A 4AYXA 2IITA 3KEMA 2X9QA 4QDOA 4XTCS 2ZULA 4E70A 2QTFA 1RXYA 1GGHA 3HCDA 1X87A 3QXHA 4QU5A 2DH6A 3R8FA 5DCWA 3C0KA 4CMAA 2R65A 3RF7A 4AZ0A 1KPIA 1ZN8A 1QGOA 2WVGA 3KB2A 1BAPA 2XD4A 2QROA 3L93A 4ND2A 4L85A 2XB4A 4JSYA 4YIKA 4AQYB 3PDUA 5LZ4A 3CG0A 1N92A 3MCUA 3ENQA 4IMIB 1AT1A 3UJCA 2H1OA 1UBMS 2H2HA 1KEZA 2QN9A 3SS9X 4EUEA 3U16A 3NYIA 3M4ZA 5JQWA 3LP6A 1WEKA 1TZBA 3FGOA 4POAA 1MVOA 1HOXA 3EQ9A 1K7YA 3OX1A 4TV8B 5HMLA 5IXSA 4MS3B 6REQA 2G82A 2EKPA 1LLFA 2NVBA 5EJ6A 4MQ4A 5LOVA 3CR7A 4YAJA 1V37A 1U0NA 4G5FA 3WMXA 1JAYA 1MLDA 1L3IA 2AW3A 3HU1A 2DFKB 2OGWA 2O2YA 4H1WA 1FY2A 3BIXA 1V16A 2Z95A 3BJZA 3CNNA 4D45A 2C8VA 4YPVA 3CWZA 4WOPA 5KOHA 4MVJH 5FR1A 3HCFA 1JILA 1H0KA 4M9UA 1XMIA 4F3RA 4A4DA 1XCOA 2PR2A 2W4QA 2XRMA 4BNGA 4CQNA 2A33A 1QUEA 2PZLA 3IQFA 1N9ZA 2FN7A 5HTKA 13PKA 2C4TA 4JBNA 1KOGA 4HDOB 1XPOA 4H7DA 2F48A 1M1YB 2WU1A 2HC9A 4PW0A 5JASA 1WDWB 4OQYA 2Q07A 1SXHA 3LX6A 1CETA 1FSFA 4MUKA 2HADA 2HUNA 2ZUWA 4HRXA 2JGFA 5A04A 2BMAA 3AF6A 3EEYA 3Q8XB 1PR3A 1EK0A 2PKEA 2IV7A 1CUIA 1C81A 2A0XA 3BMQA 3ASVA 1H8HA 2PUBA 2FMTA 1Z75A 2A9VA 2IV2X 2DTDA 2XYRA 2BGUA 2COKA 3GBSA 3K73O 4WXRA 1T2FA 4Q34A 3WDSA 4LDAA 3MQFA 3C3MA 4H6XA 4KRYA 4WX2B 1LI5A 4G0UA 1DWPA 2RARA 3KT0A 3EF3A 4A15A 3AVXA 2ZWAA 2K6GA 1N34B 3QY9A 1ESZA 1VBNA 2QRZA 4RMNA 4JEIA 1IUOA 3HACA 5DLPA 1K5PA 4OOEA 2W90A 5EHIA 4P5EA 5C1PA 3NEJA 4BOYA 1BA3A 4ZI7F 4GOXA 4IOKA 1H94A 3L4BC 4O4HB 2XNHA 3KZOA 2C2KA 3M5PA 2OORA 3IERA 4DNOA 5I9BA 4G4JA 1QZUA 3PNSA 4RY0A 3IP5A 2HX1A 1BO6A 4PZEA 3BA1A 2O8NA 2R6DA 3BWYA 3BL5A 3DG9A 8OHMA 2G83A 1NOJA 1F06A 4U9IS 4GMDA 3RBVA 1Z0ZA 2F43B 1P91A 4LBVA 2Q6LA 4JI1B 2PSHA 2CEAA 1EGQA 1TCCA 1YFKA 5EZ6B 4K2HA 1Q83A 4TT8A 2WWYA 3S44A 3JWGA 3O26A 1XPUA 1SURA 5F1KA 3RVOA 1FNMA 2WA1A 1DAKA 3CPHA 3L1VA 4RMHA 4AKGA 4BNWA 3EA0A 3UW1A 1Q7BA 4CU5A 5IYZA 3F6RA 4ZICA 1SQ0A 2EEPA 3WKDA 5ICMA 1SVIA 2QD3A 4IGEA 2ZBEA 1WXHA 4FYPA 4OBBA 3V7YA 4D82A 3TGLA 4GECA 3KZVA 4TKUB 1R0XA 1E5VA 3CRRA 4OSPA 5TQ2A 4HTAA 3DA8A 3W78A 5I4BA 3CZRA 2P9FA 1E3EA 5HBRA 1GNRA 1TYDE 2I22A 2BJVA 2XWSA 4I66A 1VL2A 1F6DA 1BE6A 1M0SA 3L6UA 4IEFB 4MW1A 3KDAA 3RS2A 2ZB2A 2I66A 4M1KA 4ETWA 3HUUA 5BWNA 5FPYA 3QU7A 4FBLA 3SN6A 4P7FA 1QP4A 4U2DA 1T36A 3QW4B 1HC7A 4OIMA 1CFZA 4Q3DA 1V7CA 1HXHA 3BTVA 5C5DA 1E9RA 1N75A 3NBKA 1P45A 1URPA 2I2WA 2J6BA 2DM6A 3O2SB 1M3SA 1QKJA 2EATA 3AC0A 3DE4X 3BIWA 2ZB3A 2R6JA 5AK5A 2O1WA 4BVGA 3C3CA 1XVUA 2OZEA 3B7PA 5KOIA 1ABFA 5AI6A 5A3SA 621PA 1P2GA 1FQJA 3AHIA 5FBWB 3FTQA 3F8WA 4KKVA 1KK0A 2CLLB 4TQUS 2QJWA 2LP4Y 2DWQA 3NBMA 3EW9A 5BW4A 4ROSA 1GPNA 1ZH4A 4GPBA 4DGSA 3U5ZB 4QM6A 3HRKA 5C2JB 3G2OA 4OBWA 3R8XA 1P9NA 1I7QB 1XMPA 5CYOA 2W93A 1Z0UA 3IUJA 3NBXX 3WGVA 5AVYA 5AW6A 2QU7A 2EEZA 2GN1A 4GVXA 4C7OB 4E30A 3EZNA 1QE5A 3TB6A 2IPOA 2FSIA 3AJEA 3JQFA 1T2DA 3E22B 2BVNA 2GAJA 1NSYA 1YDEA 4KIWA 5FFMA 1R0CA 3MERA 1UKEA 5FV7A 2AYYA 3W5CA 4JNKA 5KZMB 1AA9A 3WOHA 4QIHA 2BHRA 3AF4A 3OESA 2R6R1 4OV6B 4PBRA 1LD3A 1QS0B 1WO8A 3ORHA 4QUDA 4IQ0A 2JGEA 2GTPA 3KB1A 3AXSA 3WDKA 2K2QB 2QZ9A 1SUCA 3L0BA 4DWJA 3KLMX 1P2UA 4FFRA 2OBYA 3BMQB 3HQ4O 4KKXB 2Q0QA 3SFZA 4B76A 4AO8A 4DTIA 2Q3EA 4TTTS 3VR5H 2ILTA 2MYUA 1QIMA 2H2DA 3BA6A 3WHPA 3C70A 1SBIA 3DT9A 2DJ5A 2FLVA 1BJTA 4JKOA 5F35A 1I1QB 1QAQA 1TYEB 2BFBA 4LOLA 5DOZA 1T10A 4LCJA 2PM8A 4F86A 3PXEA 2J46A 1OD6A 1ZOPA 2OO5C 2QTHA 5E4YA 4K6HA 4WJKB 4BBJA 3ZCQA 5HIKA 2P6MA 4O4HA 5F7ZA 3I32A 1OTXA 4AJ4A 1L5KA 4ETNA 1PK7A 4YMWA 2E3JA 1J8FA 5EG5A 3BZWA 5JRDS 3I2YX 3A25A 4BMOB 4RVUA 3DJYA 2OQ2A 1NZDA 4XEHA 5JU6A 4KWCA 3BKWA 2A35A 1S9DA 4MQLA 4TTIA 3B60A 3G88A 4WRRA 2ZI6A