5BOTA

X-ray co-structure of mmp-13 with ethyl 5-carbamoyl-1h-indole-2-carboxylate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
166
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Fragment-based discovery of indole inhibitors of matrix metalloproteinase-13.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5botA00
1R1JA 3EDIA 1I73A 1FM1A 2AYKA 3LGPA 4PKQA 3N2UA 5JMYA 1BKCA 2A8HA 5D1TA 1XFUA 3DPEA 4H3XA 2MLRA 3EHXA 4DV8A 1SLMA 1C7KA 3F15A 456CA 1JANA 1IACA 2JIHA 3LJTA 1G49A 1HFSA 1I76A 3DPFA 1XFYA 1BQQM 4GWMA 1YOUA 5BPAA 1HY7A 1ZXCA 1IAEA 2OW9A 4PKVA 1OO9A 1QIAA 1XUDA 2WO8A 4XBHA 2MZEA 3AYKA 3DSLA 1ZTQA 2AIGP 4GQLA 2E2DA 2CKIA 1JAPA 3I7GA 4CTHA 1CK7A 2X3AA 1SMPA 1USNA 2O3EA 5I4OA 4FXQA 1AF0A 1YP1A 1K7IA 2DW1A 1MMPA 1ATLA 1OM6A 2DW2A 4FU4A 1WNIA 5L79A 5I2ZA 4L19A 1GE6A 2D1OA 4FVLA 1GO8P 1Y8JA 1XUCA 2EROA 3L0VA 5CUHA 5I43A 4WKIA 5I0LA 2V4BA 1GXDA 3USNA 1JK3A 5CXAA 3ZXHA 4ON1A 3HBUP 1BKCE 1QIBA 1A85A 1BQOA 2MLSA 4I35A 2K9CA 3G42A 1Y0VA 3DNGA 1DTHA 2J83A 3U1RA 1ZXVA 1G12A 3EDGA 3KEKA 4GR8A 966CA 4PKTA 3N2VA 4H30A 3E8RA 1BUDA 1MNCA 2FV5A 3KMCA 4A7BA 1CGLA 3ELMA 2USNA 2K2GA 2PJTA 2W0DA 2Y6DA 1ASTA 1XFZA 3I7IA 3MA2A 1KUHA 2XS3A 4I03A 4H2EA 5H8XA 2JNPA 3F19A 1GO7P 1BKCI 1YQYA 1HV5A 3F18A 3TT4A 5B5PA 1OM7A 3Q2HA 1HTDA 4GWNA 1JKYA 1AYKA 4AIGA 3LQ0A 4DD8A 3VTGA 2OY2A 3SHIA 1A86A 1R55A 5BOYA 2DDFA 2L0RA 1CIZA 1R1HA 1D8MA 1C8TA 3KECA 3LE9A 4GR0A 4JQGA 4QKZA 3AIGA 1BZSA 3Q2GA 3KWVC 2OY4A 2X7MA 4G9LA 2OZRA 5I3MA 1CXVA 1R54A 1IAAA 4ILWD 3TS4A 5BOTA 3OHLA 1K7QA 3HDAP 2X3BA 4XM6A 1JJ9A 3DL1A 1KUGA 5CZMA 1C3IA 3KHIA 4XCTA 2N8RA 1QJJA 1Q3AA 3KRYA 4AYKA 3TVCA 1Y93A 1BIWA 2POJA 1R1IA 3O2XA 1RM8A 1UEAA 1EB6A 1JAOA 3LIKA 1HFCA 4PKWA 1DMTA 3AYUA 3KEJA 3LILA 5LABA 3RTSA 3EDHA 1G4KA 1GKDA 2Z2DA 1S4BP 2I47A 1PWPA 5D7WA 1H71P 1BUVM 3WV1A 4PKRA 1MMRA 4IN9A 2W13A 2DDYA 1CQRA 4GUYA 2OVZA 1CAQA 1EAKA 1IADA 1KAPP 1J7NA 4GF1A 1IAGA 4XM7A 3UVCA 4IJOA 2OW2A 2DW0A 3LKAA 2Y6CA 1QICA 1GE5A 4DF9A 1K7GA 3K7LA 4Q1LA 4WZVA 2XS4A 1UTTA 3LEAA 3WV3A 1JIWP 1XFXA 3B8ZA 3KMEA 1GE7A 1JAQA 1OS9A 3O64A 3LUMA 1PWQA 4L63A 4PKSA 1O0TA 3EWJA 1AKLA 1ND1A 3B2ZA 3BA0A 4HX3A 1Z3JA 2OI0A 3VI1A 4AXQA 3HDBA 3ZVSA 4WKEA 2OW0A 3B92A 2JT5A 3ZUKA 1QJIA 1HOVA 1UMSA 4R3VA 2ERPA 830CA 3V96B 1ZP5A 3HB2P 3LJGA 1FLSA 1XFWA 4H76A 1YCMA 1QUAA 2FV9A 4XM8A 4FXYP 4EFSA 2OW1A 2KRJA 1RMZA 2RJPA 3HY7A 1CGEA 3HY9A 1JIZA 4ZR5A 3F17A 4A3WA 2SRTA 5L7FA 3GBOA 2YB9A 2J0TA 3LK8A 1EUBA 3P24A 5D1UA 1OMJA 4H1QA 3CKIA 1OM8A 1B3DA 2MZHA 2O36A 4AUOA 4L6TA 4PKUA 1BM6A 1KUFA 4JP4A 1G05A 4GR3A 4JIJA 3HBVP 1SU3A 1SLNA 1IABA 1XFVA 3LUNA 1KUKA 1B8YA 2W14A 1L6JA 1ZS0A 4H84A 4IUWA 3EDZA 1PWUA 5B5OA 1SATA 2OXUA 1FBLA 2OVXA 3NX7A 3DWBA 1PWVA 3WV2A 1PWWA 1OS2A 2W15A 1MMBA 4J4MA 1KBCA 5D3CA 4JPAA 5D1SA 3F16A 2JSDA 3EHYA 1D8FA 4HMAA 4G0DA 4WK7A 4WF6A 1KUIA 5I12A 3RTTA 1CGFA 2E3XA 2X3CA 3HYGA 1UTZA 3F1AA 4H82A 1GKCA 1SRPA 3OHOA 2TCLA 2YIGA 1D5JA 2MZIA 2HU6A 1G9KA 5D2BA 1JH1A 2WO9A 2OXWA 3TSKA 3P1VA 3LIRA 3LJZA 1ROSA 3LMCA 1I1IP 2ERQA 1MMQA 2QPJA 2D1NA 1XURA 1UMTA 1BSWA 4H49A 1ZVXA 3G5CA 2RJQA 4DPEA 2CLTA 4JA1A 3L0TA 2OXZA 1O0QA 2WOAA 2JT6A 2W12A 3K7NA 3LQBA 1D7XA
chains in the Genus database with same CATH superfamily
1R1JA 3EDIA 1I73A 1FM1A 2AYKA 3LGPA 4PKQA 3N2UA 5JMYA 1BKCA 2A8HA 5D1TA 1XFUA 3DPEA 4H3XA 2MLRA 3EHXA 4DV8A 1SLMA 1C7KA 3F15A 456CA 1JANA 1IACA 1TVIA 2JIHA 3LJTA 1G49A 1HFSA 1I76A 3DPFA 1XFYA 1BQQM 4GWMA 1YOUA 5BPAA 1HY7A 1ZXCA 1IAEA 2OW9A 4PKVA 1OO9A 1QIAA 1XUDA 2WO8A 4XBHA 2MZEA 3AYKA 3DSLA 1ZTQA 2AIGP 4GQLA 2E2DA 2CKIA 1JAPA 3I7GA 4CTHA 1CK7A 2X3AA 1SMPA 1USNA 2O3EA 5I4OA 4FXQA 1AF0A 1YP1A 1K7IA 2DW1A 1MMPA 1ATLA 1OM6A 2DW2A 4FU4A 1WNIA 5L79A 5I2ZA 4L19A 1GE6A 2D1OA 4FVLA 1GO8P 1Y8JA 1XUCA 2EROA 3L0VA 5CUHA 5I43A 4WKIA 5I0LA 2V4BA 1GXDA 3USNA 1JK3A 5CXAA 3ZXHA 4ON1A 3HBUP 1BKCE 1QIBA 1A85A 1BQOA 2MLSA 4I35A 2K9CA 3G42A 1Y0VA 3DNGA 1DTHA 2J83A 3U1RA 1ZXVA 1G12A 3EDGA 3KEKA 4GR8A 966CA 4PKTA 3N2VA 4H30A 3E8RA 1BUDA 1MNCA 2FV5A 3KMCA 4A7BA 1CGLA 3ELMA 2USNA 2K2GA 2PJTA 2W0DA 2Y6DA 1ASTA 1XFZA 3I7IA 3MA2A 1KUHA 2XS3A 4I03A 4H2EA 5H8XA 2JNPA 3F19A 1GO7P 1BKCI 1YQYA 1HV5A 3F18A 3TT4A 5B5PA 1OM7A 3Q2HA 1HTDA 4GWNA 1JKYA 1AYKA 4AIGA 3LQ0A 4DD8A 3VTGA 2OY2A 3SHIA 1A86A 1R55A 5BOYA 2DDFA 2L0RA 1CIZA 1R1HA 1D8MA 1C8TA 3KECA 3LE9A 4GR0A 4JQGA 3DTKA 4QKZA 3AIGA 1BZSA 3Q2GA 3KWVC 2OY4A 2X7MA 4G9LA 2OZRA 5I3MA 1CXVA 1R54A 1IAAA 4ILWD 3TS4A 5BOTA 3OHLA 1K7QA 3HDAP 2X3BA 4XM6A 1JJ9A 3DL1A 1KUGA 5CZMA 1C3IA 3KHIA 4XCTA 2N8RA 1QJJA 1Q3AA 3KRYA 4AYKA 3TVCA 1Y93A 1BIWA 2POJA 3DTEA 1R1IA 3O2XA 1RM8A 1UEAA 1EB6A 1JAOA 3LIKA 1HFCA 4PKWA 1DMTA 3AYUA 3KEJA 3LILA 5LABA 1XAXA 3RTSA 3EDHA 1G4KA 1GKDA 2Z2DA 1S4BP 2I47A 1PWPA 5D7WA 1H71P 1BUVM 3WV1A 4PKRA 1MMRA 4IN9A 2W13A 2DDYA 1CQRA 4GUYA 2OVZA 1CAQA 1EAKA 1IADA 1KAPP 1J7NA 4GF1A 1IAGA 4XM7A 3UVCA 4IJOA 2OW2A 2DW0A 3LKAA 2Y6CA 1QICA 1GE5A 4DF9A 1K7GA 3K7LA 4Q1LA 4WZVA 2XS4A 1UTTA 3LEAA 3WV3A 1JIWP 1XFXA 3B8ZA 3KMEA 1GE7A 1JAQA 1OS9A 3O64A 3LUMA 1PWQA 4L63A 4PKSA 4L7AA 1O0TA 3EWJA 1AKLA 1ND1A 3B2ZA 3BA0A 4HX3A 1Z3JA 2OI0A 3VI1A 4AXQA 3HDBA 3ZVSA 4WKEA 2OW0A 3B92A 2JT5A 3ZUKA 1QJIA 1HOVA 1UMSA 4R3VA 2ERPA 830CA 3V96B 1ZP5A 3HB2P 3LJGA 1FLSA 1XFWA 4H76A 1YCMA 1QUAA 2FV9A 4XM8A 4FXYP 4EFSA 2OW1A 2KRJA 1RMZA 2RJPA 3HY7A 1CGEA 3HY9A 1JIZA 4ZR5A 3F17A 4A3WA 2SRTA 5L7FA 3GBOA 2YB9A 2J0TA 3LK8A 1EUBA 3P24A 5D1UA 1OMJA 4H1QA 3CKIA 1OM8A 1B3DA 2MZHA 2O36A 4AUOA 4L6TA 4PKUA 1BM6A 1KUFA 4JP4A 1G05A 4GR3A 4JIJA 3HBVP 1SU3A 1SLNA 1IABA 1XFVA 3LUNA 1KUKA 1B8YA 2W14A 1L6JA 1ZS0A 4H84A 4IUWA 3EDZA 1PWUA 5B5OA 1SATA 2OXUA 1FBLA 2OVXA 3NX7A 3DWBA 1PWVA 3WV2A 1PWWA 1OS2A 2W15A 1MMBA 4J4MA 1KBCA 1XM5A 5D3CA 4JPAA 5D1SA 3F16A 2JSDA 3EHYA 1D8FA 4HMAA 4G0DA 4WK7A 4WF6A 1KUIA 5I12A 3RTTA 1CGFA 2E3XA 1OZ9A 2X3CA 1UTZA 3F1AA 3HYGA 4H82A 1GKCA 1SRPA 3OHOA 2TCLA 2YIGA 3DTIA 1D5JA 2MZIA 2HU6A 1G9KA 5D2BA 1JH1A 2WO9A 2OXWA 3TSKA 3P1VA 3LIRA 3LJZA 1ROSA 3LMCA 1I1IP 2ERQA 1MMQA 2QPJA 2D1NA 1XURA 1UMTA 1BSWA 4H49A 1ZVXA 3G5CA 2RJQA 4DPEA 2CLTA 4JA1A 2YUFA 3L0TA 2OXZA 1O0QA 2WOAA 2JT6A 2W12A 3K7NA 3LQBA 1D7XA
chains in the Genus database with same CATH topology
1R1JA 3EDIA 1I73A 1FM1A 2AYKA 3LGPA 4PKQA 3N2UA 5JMYA 1BKCA 2A8HA 5D1TA 1XFUA 3DPEA 4H3XA 2MLRA 3EHXA 4DV8A 1SLMA 1C7KA 3F15A 456CA 1JANA 1IACA 2JIHA 3LJTA 1G49A 1HFSA 1I76A 3DPFA 1XFYA 1BQQM 4GWMA 1YOUA 5BPAA 1HY7A 1ZXCA 1IAEA 2OW9A 4PKVA 1OO9A 1QIAA 1XUDA 2WO8A 4XBHA 2MZEA 3AYKA 3DSLA 1ZTQA 2AIGP 4GQLA 2E2DA 2CKIA 1JAPA 3I7GA 4CTHA 1CK7A 2X3AA 1SMPA 1USNA 2O3EA 5I4OA 4FXQA 1AF0A 1YP1A 1K7IA 2DW1A 1MMPA 1ATLA 1OM6A 2DW2A 4FU4A 1WNIA 5L79A 5I2ZA 4L19A 1GE6A 2D1OA 4FVLA 1GO8P 1Y8JA 1XUCA 2EROA 3L0VA 5CUHA 5I43A 4WKIA 5I0LA 2V4BA 1GXDA 3USNA 1JK3A 5CXAA 3ZXHA 4ON1A 3HBUP 1BKCE 1QIBA 1A85A 1BQOA 2MLSA 4I35A 2K9CA 3G42A 1Y0VA 3DNGA 1DTHA 2J83A 3U1RA 1ZXVA 1G12A 3EDGA 3KEKA 4GR8A 966CA 4PKTA 3N2VA 4H30A 3E8RA 1BUDA 1MNCA 2FV5A 3KMCA 4A7BA 1CGLA 3ELMA 2USNA 2K2GA 2PJTA 2W0DA 2Y6DA 1ASTA 1XFZA 3I7IA 3MA2A 1KUHA 2XS3A 4I03A 4H2EA 5H8XA 2JNPA 3F19A 1GO7P 1BKCI 1YQYA 1HV5A 3F18A 3TT4A 5B5PA 1OM7A 3Q2HA 1HTDA 4GWNA 1JKYA 1AYKA 4AIGA 3LQ0A 4DD8A 3VTGA 2OY2A 3SHIA 1A86A 1R55A 5BOYA 2DDFA 2L0RA 1CIZA 1R1HA 1D8MA 1C8TA 3KECA 3LE9A 4GR0A 4JQGA 3DTKA 4QKZA 3AIGA 1BZSA 3Q2GA 3KWVC 2OY4A 2X7MA 4G9LA 2OZRA 5I3MA 1CXVA 1R54A 1IAAA 4ILWD 3TS4A 5BOTA 3OHLA 1K7QA 3HDAP 2X3BA 4XM6A 1JJ9A 3DL1A 1KUGA 5CZMA 1C3IA 3KHIA 4XCTA 2N8RA 1QJJA 1Q3AA 3KRYA 4AYKA 3TVCA 1Y93A 1BIWA 2POJA 3DTEA 1R1IA 3O2XA 1RM8A 1UEAA 1EB6A 1JAOA 3LIKA 1HFCA 4PKWA 1DMTA 3AYUA 3KEJA 3LILA 5LABA 3RTSA 3EDHA 1G4KA 1GKDA 2Z2DA 1S4BP 2I47A 1PWPA 5D7WA 1H71P 1BUVM 3WV1A 4PKRA 1MMRA 4IN9A 2W13A 2DDYA 1CQRA 4GUYA 2OVZA 1CAQA 1EAKA 1IADA 1KAPP 1J7NA 4GF1A 1IAGA 4XM7A 3UVCA 4IJOA 2OW2A 2DW0A 3LKAA 2Y6CA 1QICA 1GE5A 4DF9A 1K7GA 3K7LA 4Q1LA 4WZVA 2XS4A 1UTTA 3LEAA 3WV3A 1JIWP 1XFXA 3B8ZA 3KMEA 1GE7A 1JAQA 1OS9A 3O64A 3LUMA 1PWQA 4L63A 4PKSA 4L7AA 1O0TA 3EWJA 1AKLA 1ND1A 3B2ZA 3BA0A 4HX3A 1Z3JA 2OI0A 3VI1A 4AXQA 3HDBA 3ZVSA 4WKEA 2OW0A 3B92A 2JT5A 3ZUKA 1QJIA 1HOVA 1UMSA 4R3VA 2ERPA 830CA 3V96B 1ZP5A 3HB2P 3LJGA 1FLSA 1XFWA 4H76A 1YCMA 1QUAA 2FV9A 4XM8A 4FXYP 4EFSA 2OW1A 2KRJA 1RMZA 2RJPA 3HY7A 1CGEA 3HY9A 1JIZA 4ZR5A 3F17A 4A3WA 2SRTA 5L7FA 3GBOA 2YB9A 2J0TA 3LK8A 1EUBA 3P24A 5D1UA 1OMJA 4H1QA 3CKIA 1OM8A 1B3DA 2MZHA 2O36A 4AUOA 4L6TA 4PKUA 1BM6A 1KUFA 4JP4A 1G05A 4GR3A 4JIJA 3HBVP 1SU3A 1SLNA 1IABA 1XFVA 3LUNA 1KUKA 1B8YA 2W14A 1L6JA 1ZS0A 4H84A 4IUWA 3EDZA 1PWUA 5B5OA 1SATA 2OXUA 1FBLA 2OVXA 3NX7A 3DWBA 1PWVA 3WV2A 1PWWA 1OS2A 2W15A 1MMBA 4J4MA 1KBCA 5D3CA 4JPAA 5D1SA 3F16A 2JSDA 3EHYA 1D8FA 4HMAA 4G0DA 4WK7A 4WF6A 1KUIA 5I12A 3RTTA 1CGFA 2E3XA 2X3CA 3HYGA 1UTZA 3F1AA 4H82A 1GKCA 1SRPA 3OHOA 2TCLA 2YIGA 3DTIA 1D5JA 2MZIA 2HU6A 1G9KA 5D2BA 1JH1A 2WO9A 2OXWA 3TSKA 3P1VA 3LIRA 3LJZA 1ROSA 3LMCA 1I1IP 2ERQA 1MMQA 2QPJA 2D1NA 1XURA 1UMTA 1BSWA 4H49A 1ZVXA 3G5CA 2RJQA 4DPEA 2CLTA 4JA1A 2YUFA 3L0TA 2OXZA 1O0QA 2WOAA 2JT6A 2W12A 3K7NA 3LQBA 1D7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1J A;  3EDI A;  1I73 A;  1FM1 A;  2AYK A;  3LGP A;  4PKQ A;  3N2U A;  5JMY A;  1BKC A;  2A8H A;  5D1T A;  1XFU A;  3DPE A;  4H3X A;  2MLR A;  3EHX A;  4DV8 A;  1SLM A;  1C7K A;  3F15 A;  456C A;  1JAN A;  1IAC A;  2JIH A;  3LJT A;  1G49 A;  1HFS A;  1I76 A;  3DPF A;  1XFY A;  1BQQ M;  4GWM A;  1YOU A;  5BPA A;  1HY7 A;  1ZXC A;  1IAE A;  2OW9 A;  4PKV A;  1OO9 A;  1QIA A;  1XUD A;  2WO8 A;  4XBH A;  2MZE A;  3AYK A;  3DSL A;  1ZTQ A;  2AIG P;  4GQL A;  2E2D A;  2CKI A;  1JAP A;  3I7G A;  4CTH A;  1CK7 A;  2X3A A;  1SMP A;  1USN A;  2O3E A;  5I4O A;  4FXQ A;  1AF0 A;  1YP1 A;  1K7I A;  2DW1 A;  1MMP A;  1ATL A;  1OM6 A;  2DW2 A;  4FU4 A;  1WNI A;  5L79 A;  5I2Z A;  4L19 A;  1GE6 A;  2D1O A;  4FVL A;  1GO8 P;  1Y8J A;  1XUC A;  2ERO A;  3L0V A;  5CUH A;  5I43 A;  4WKI A;  5I0L A;  2V4B A;  1GXD A;  3USN A;  1JK3 A;  5CXA A;  3ZXH A;  4ON1 A;  3HBU P;  1BKC E;  1QIB A;  1A85 A;  1BQO A;  2MLS A;  4I35 A;  2K9C A;  3G42 A;  1Y0V A;  3DNG A;  1DTH A;  2J83 A;  3U1R A;  1ZXV A;  1G12 A;  3EDG A;  3KEK A;  4GR8 A;  966C A;  4PKT A;  3N2V A;  4H30 A;  3E8R A;  1BUD A;  1MNC A;  2FV5 A;  3KMC A;  4A7B A;  1CGL A;  3ELM A;  2USN A;  2K2G A;  2PJT A;  2W0D A;  2Y6D A;  1AST A;  1XFZ A;  3I7I A;  3MA2 A;  1KUH A;  2XS3 A;  4I03 A;  4H2E A;  5H8X A;  2JNP A;  3F19 A;  1GO7 P;  1BKC I;  1YQY A;  1HV5 A;  3F18 A;  3TT4 A;  5B5P A;  1OM7 A;  3Q2H A;  1HTD A;  4GWN A;  1JKY A;  1AYK A;  4AIG A;  3LQ0 A;  4DD8 A;  3VTG A;  2OY2 A;  3SHI A;  1A86 A;  1R55 A;  5BOY A;  2DDF A;  2L0R A;  1CIZ A;  1R1H A;  1D8M A;  1C8T A;  3KEC A;  3LE9 A;  4GR0 A;  4JQG A;  4QKZ A;  3AIG A;  1BZS A;  3Q2G A;  3KWV C;  2OY4 A;  2X7M A;  4G9L A;  2OZR A;  5I3M A;  1CXV A;  1R54 A;  1IAA A;  4ILW D;  3TS4 A;  5BOT A;  3OHL A;  1K7Q A;  3HDA P;  2X3B A;  4XM6 A;  1JJ9 A;  3DL1 A;  1KUG A;  5CZM A;  1C3I A;  3KHI A;  4XCT A;  2N8R A;  1QJJ A;  1Q3A A;  3KRY A;  4AYK A;  3TVC A;  1Y93 A;  1BIW A;  2POJ A;  1R1I A;  3O2X A;  1RM8 A;  1UEA A;  1EB6 A;  1JAO A;  3LIK A;  1HFC A;  4PKW A;  1DMT A;  3AYU A;  3KEJ A;  3LIL A;  5LAB A;  3RTS A;  3EDH A;  1G4K A;  1GKD A;  2Z2D A;  1S4B P;  2I47 A;  1PWP A;  5D7W A;  1H71 P;  1BUV M;  3WV1 A;  4PKR A;  1MMR A;  4IN9 A;  2W13 A;  2DDY A;  1CQR A;  4GUY A;  2OVZ A;  1CAQ A;  1EAK A;  1IAD A;  1KAP P;  1J7N A;  4GF1 A;  1IAG A;  4XM7 A;  3UVC A;  4IJO A;  2OW2 A;  2DW0 A;  3LKA A;  2Y6C A;  1QIC A;  1GE5 A;  4DF9 A;  1K7G A;  3K7L A;  4Q1L A;  4WZV A;  2XS4 A;  1UTT A;  3LEA A;  3WV3 A;  1JIW P;  1XFX A;  3B8Z A;  3KME A;  1GE7 A;  1JAQ A;  1OS9 A;  3O64 A;  3LUM A;  1PWQ A;  4L63 A;  4PKS A;  1O0T A;  3EWJ A;  1AKL A;  1ND1 A;  3B2Z A;  3BA0 A;  4HX3 A;  1Z3J A;  2OI0 A;  3VI1 A;  4AXQ A;  3HDB A;  3ZVS A;  4WKE A;  2OW0 A;  3B92 A;  2JT5 A;  3ZUK A;  1QJI A;  1HOV A;  1UMS A;  4R3V A;  2ERP A;  830C A;  3V96 B;  1ZP5 A;  3HB2 P;  3LJG A;  1FLS A;  1XFW A;  4H76 A;  1YCM A;  1QUA A;  2FV9 A;  4XM8 A;  4FXY P;  4EFS A;  2OW1 A;  2KRJ A;  1RMZ A;  2RJP A;  3HY7 A;  1CGE A;  3HY9 A;  1JIZ A;  4ZR5 A;  3F17 A;  4A3W A;  2SRT A;  5L7F A;  3GBO A;  2YB9 A;  2J0T A;  3LK8 A;  1EUB A;  3P24 A;  5D1U A;  1OMJ A;  4H1Q A;  3CKI A;  1OM8 A;  1B3D A;  2MZH A;  2O36 A;  4AUO A;  4L6T A;  4PKU A;  1BM6 A;  1KUF A;  4JP4 A;  1G05 A;  4GR3 A;  4JIJ A;  3HBV P;  1SU3 A;  1SLN A;  1IAB A;  1XFV A;  3LUN A;  1KUK A;  1B8Y A;  2W14 A;  1L6J A;  1ZS0 A;  4H84 A;  4IUW A;  3EDZ A;  1PWU A;  5B5O A;  1SAT A;  2OXU A;  1FBL A;  2OVX A;  3NX7 A;  3DWB A;  1PWV A;  3WV2 A;  1PWW A;  1OS2 A;  2W15 A;  1MMB A;  4J4M A;  1KBC A;  5D3C A;  4JPA A;  5D1S A;  3F16 A;  2JSD A;  3EHY A;  1D8F A;  4HMA A;  4G0D A;  4WK7 A;  4WF6 A;  1KUI A;  5I12 A;  3RTT A;  1CGF A;  2E3X A;  2X3C A;  3HYG A;  1UTZ A;  3F1A A;  4H82 A;  1GKC A;  1SRP A;  3OHO A;  2TCL A;  2YIG A;  1D5J A;  2MZI A;  2HU6 A;  1G9K A;  5D2B A;  1JH1 A;  2WO9 A;  2OXW A;  3TSK A;  3P1V A;  3LIR A;  3LJZ A;  1ROS A;  3LMC A;  1I1I P;  2ERQ A;  1MMQ A;  2QPJ A;  2D1N A;  1XUR A;  1UMT A;  1BSW A;  4H49 A;  1ZVX A;  3G5C A;  2RJQ A;  4DPE A;  2CLT A;  4JA1 A;  3L0T A;  2OXZ A;  1O0Q A;  2WOA A;  2JT6 A;  2W12 A;  3K7N A;  3LQB A;  1D7X A; 
#chains in the Genus database with same CATH topology
 1R1J A;  3EDI A;  1I73 A;  1FM1 A;  2AYK A;  3LGP A;  4PKQ A;  3N2U A;  5JMY A;  1BKC A;  2A8H A;  5D1T A;  1XFU A;  3DPE A;  4H3X A;  2MLR A;  3EHX A;  4DV8 A;  1SLM A;  1C7K A;  3F15 A;  456C A;  1JAN A;  1IAC A;  1TVI A;  2JIH A;  3LJT A;  1G49 A;  1HFS A;  1I76 A;  3DPF A;  1XFY A;  1BQQ M;  4GWM A;  1YOU A;  5BPA A;  1HY7 A;  1ZXC A;  1IAE A;  2OW9 A;  4PKV A;  1OO9 A;  1QIA A;  1XUD A;  2WO8 A;  4XBH A;  2MZE A;  3AYK A;  3DSL A;  1ZTQ A;  2AIG P;  4GQL A;  2E2D A;  2CKI A;  1JAP A;  3I7G A;  4CTH A;  1CK7 A;  2X3A A;  1SMP A;  1USN A;  2O3E A;  5I4O A;  4FXQ A;  1AF0 A;  1YP1 A;  1K7I A;  2DW1 A;  1MMP A;  1ATL A;  1OM6 A;  2DW2 A;  4FU4 A;  1WNI A;  5L79 A;  5I2Z A;  4L19 A;  1GE6 A;  2D1O A;  4FVL A;  1GO8 P;  1Y8J A;  1XUC A;  2ERO A;  3L0V A;  5CUH A;  5I43 A;  4WKI A;  5I0L A;  2V4B A;  1GXD A;  3USN A;  1JK3 A;  5CXA A;  3ZXH A;  4ON1 A;  3HBU P;  1BKC E;  1QIB A;  1A85 A;  1BQO A;  2MLS A;  4I35 A;  2K9C A;  3G42 A;  1Y0V A;  3DNG A;  1DTH A;  2J83 A;  3U1R A;  1ZXV A;  1G12 A;  3EDG A;  3KEK A;  4GR8 A;  966C A;  4PKT A;  3N2V A;  4H30 A;  3E8R A;  1BUD A;  1MNC A;  2FV5 A;  3KMC A;  4A7B A;  1CGL A;  3ELM A;  2USN A;  2K2G A;  2PJT A;  2W0D A;  2Y6D A;  1AST A;  1XFZ A;  3I7I A;  3MA2 A;  1KUH A;  2XS3 A;  4I03 A;  4H2E A;  5H8X A;  2JNP A;  3F19 A;  1GO7 P;  1BKC I;  1YQY A;  1HV5 A;  3F18 A;  3TT4 A;  5B5P A;  1OM7 A;  3Q2H A;  1HTD A;  4GWN A;  1JKY A;  1AYK A;  4AIG A;  3LQ0 A;  4DD8 A;  3VTG A;  2OY2 A;  3SHI A;  1A86 A;  1R55 A;  5BOY A;  2DDF A;  2L0R A;  1CIZ A;  1R1H A;  1D8M A;  1C8T A;  3KEC A;  3LE9 A;  4GR0 A;  4JQG A;  3DTK A;  4QKZ A;  3AIG A;  1BZS A;  3Q2G A;  3KWV C;  2OY4 A;  2X7M A;  4G9L A;  2OZR A;  5I3M A;  1CXV A;  1R54 A;  1IAA A;  4ILW D;  3TS4 A;  5BOT A;  3OHL A;  1K7Q A;  3HDA P;  2X3B A;  4XM6 A;  1JJ9 A;  3DL1 A;  1KUG A;  5CZM A;  1C3I A;  3KHI A;  4XCT A;  2N8R A;  1QJJ A;  1Q3A A;  3KRY A;  4AYK A;  3TVC A;  1Y93 A;  1BIW A;  2POJ A;  3DTE A;  1R1I A;  3O2X A;  1RM8 A;  1UEA A;  1EB6 A;  1JAO A;  3LIK A;  1HFC A;  4PKW A;  1DMT A;  3AYU A;  3KEJ A;  3LIL A;  5LAB A;  1XAX A;  3RTS A;  3EDH A;  1G4K A;  1GKD A;  2Z2D A;  1S4B P;  2I47 A;  1PWP A;  5D7W A;  1H71 P;  1BUV M;  3WV1 A;  4PKR A;  1MMR A;  4IN9 A;  2W13 A;  2DDY A;  1CQR A;  4GUY A;  2OVZ A;  1CAQ A;  1EAK A;  1IAD A;  1KAP P;  1J7N A;  4GF1 A;  1IAG A;  4XM7 A;  3UVC A;  4IJO A;  2OW2 A;  2DW0 A;  3LKA A;  2Y6C A;  1QIC A;  1GE5 A;  4DF9 A;  1K7G A;  3K7L A;  4Q1L A;  4WZV A;  2XS4 A;  1UTT A;  3LEA A;  3WV3 A;  1JIW P;  1XFX A;  3B8Z A;  3KME A;  1GE7 A;  1JAQ A;  1OS9 A;  3O64 A;  3LUM A;  1PWQ A;  4L63 A;  4PKS A;  4L7A A;  1O0T A;  3EWJ A;  1AKL A;  1ND1 A;  3B2Z A;  3BA0 A;  4HX3 A;  1Z3J A;  2OI0 A;  3VI1 A;  4AXQ A;  3HDB A;  3ZVS A;  4WKE A;  2OW0 A;  3B92 A;  2JT5 A;  3ZUK A;  1QJI A;  1HOV A;  1UMS A;  4R3V A;  2ERP A;  830C A;  3V96 B;  1ZP5 A;  3HB2 P;  3LJG A;  1FLS A;  1XFW A;  4H76 A;  1YCM A;  1QUA A;  2FV9 A;  4XM8 A;  4FXY P;  4EFS A;  2OW1 A;  2KRJ A;  1RMZ A;  2RJP A;  3HY7 A;  1CGE A;  3HY9 A;  1JIZ A;  4ZR5 A;  3F17 A;  4A3W A;  2SRT A;  5L7F A;  3GBO A;  2YB9 A;  2J0T A;  3LK8 A;  1EUB A;  3P24 A;  5D1U A;  1OMJ A;  4H1Q A;  3CKI A;  1OM8 A;  1B3D A;  2MZH A;  2O36 A;  4AUO A;  4L6T A;  4PKU A;  1BM6 A;  1KUF A;  4JP4 A;  1G05 A;  4GR3 A;  4JIJ A;  3HBV P;  1SU3 A;  1SLN A;  1IAB A;  1XFV A;  3LUN A;  1KUK A;  1B8Y A;  2W14 A;  1L6J A;  1ZS0 A;  4H84 A;  4IUW A;  3EDZ A;  1PWU A;  5B5O A;  1SAT A;  2OXU A;  1FBL A;  2OVX A;  3NX7 A;  3DWB A;  1PWV A;  3WV2 A;  1PWW A;  1OS2 A;  2W15 A;  1MMB A;  4J4M A;  1KBC A;  1XM5 A;  5D3C A;  4JPA A;  5D1S A;  3F16 A;  2JSD A;  3EHY A;  1D8F A;  4HMA A;  4G0D A;  4WK7 A;  4WF6 A;  1KUI A;  5I12 A;  3RTT A;  1CGF A;  2E3X A;  1OZ9 A;  2X3C A;  1UTZ A;  3F1A A;  3HYG A;  4H82 A;  1GKC A;  1SRP A;  3OHO A;  2TCL A;  2YIG A;  3DTI A;  1D5J A;  2MZI A;  2HU6 A;  1G9K A;  5D2B A;  1JH1 A;  2WO9 A;  2OXW A;  3TSK A;  3P1V A;  3LIR A;  3LJZ A;  1ROS A;  3LMC A;  1I1I P;  2ERQ A;  1MMQ A;  2QPJ A;  2D1N A;  1XUR A;  1UMT A;  1BSW A;  4H49 A;  1ZVX A;  3G5C A;  2RJQ A;  4DPE A;  2CLT A;  4JA1 A;  2YUF A;  3L0T A;  2OXZ A;  1O0Q A;  2WOA A;  2JT6 A;  2W12 A;  3K7N A;  3LQB A;  1D7X A; 
#chains in the Genus database with same CATH homology
 1R1J A;  3EDI A;  1I73 A;  1FM1 A;  2AYK A;  3LGP A;  4PKQ A;  3N2U A;  5JMY A;  1BKC A;  2A8H A;  5D1T A;  1XFU A;  3DPE A;  4H3X A;  2MLR A;  3EHX A;  4DV8 A;  1SLM A;  1C7K A;  3F15 A;  456C A;  1JAN A;  1IAC A;  2JIH A;  3LJT A;  1G49 A;  1HFS A;  1I76 A;  3DPF A;  1XFY A;  1BQQ M;  4GWM A;  1YOU A;  5BPA A;  1HY7 A;  1ZXC A;  1IAE A;  2OW9 A;  4PKV A;  1OO9 A;  1QIA A;  1XUD A;  2WO8 A;  4XBH A;  2MZE A;  3AYK A;  3DSL A;  1ZTQ A;  2AIG P;  4GQL A;  2E2D A;  2CKI A;  1JAP A;  3I7G A;  4CTH A;  1CK7 A;  2X3A A;  1SMP A;  1USN A;  2O3E A;  5I4O A;  4FXQ A;  1AF0 A;  1YP1 A;  1K7I A;  2DW1 A;  1MMP A;  1ATL A;  1OM6 A;  2DW2 A;  4FU4 A;  1WNI A;  5L79 A;  5I2Z A;  4L19 A;  1GE6 A;  2D1O A;  4FVL A;  1GO8 P;  1Y8J A;  1XUC A;  2ERO A;  3L0V A;  5CUH A;  5I43 A;  4WKI A;  5I0L A;  2V4B A;  1GXD A;  3USN A;  1JK3 A;  5CXA A;  3ZXH A;  4ON1 A;  3HBU P;  1BKC E;  1QIB A;  1A85 A;  1BQO A;  2MLS A;  4I35 A;  2K9C A;  3G42 A;  1Y0V A;  3DNG A;  1DTH A;  2J83 A;  3U1R A;  1ZXV A;  1G12 A;  3EDG A;  3KEK A;  4GR8 A;  966C A;  4PKT A;  3N2V A;  4H30 A;  3E8R A;  1BUD A;  1MNC A;  2FV5 A;  3KMC A;  4A7B A;  1CGL A;  3ELM A;  2USN A;  2K2G A;  2PJT A;  2W0D A;  2Y6D A;  1AST A;  1XFZ A;  3I7I A;  3MA2 A;  1KUH A;  2XS3 A;  4I03 A;  4H2E A;  5H8X A;  2JNP A;  3F19 A;  1GO7 P;  1BKC I;  1YQY A;  1HV5 A;  3F18 A;  3TT4 A;  5B5P A;  1OM7 A;  3Q2H A;  1HTD A;  4GWN A;  1JKY A;  1AYK A;  4AIG A;  3LQ0 A;  4DD8 A;  3VTG A;  2OY2 A;  3SHI A;  1A86 A;  1R55 A;  5BOY A;  2DDF A;  2L0R A;  1CIZ A;  1R1H A;  1D8M A;  1C8T A;  3KEC A;  3LE9 A;  4GR0 A;  4JQG A;  3DTK A;  4QKZ A;  3AIG A;  1BZS A;  3Q2G A;  3KWV C;  2OY4 A;  2X7M A;  4G9L A;  2OZR A;  5I3M A;  1CXV A;  1R54 A;  1IAA A;  4ILW D;  3TS4 A;  5BOT A;  3OHL A;  1K7Q A;  3HDA P;  2X3B A;  4XM6 A;  1JJ9 A;  3DL1 A;  1KUG A;  5CZM A;  1C3I A;  3KHI A;  4XCT A;  2N8R A;  1QJJ A;  1Q3A A;  3KRY A;  4AYK A;  3TVC A;  1Y93 A;  1BIW A;  2POJ A;  3DTE A;  1R1I A;  3O2X A;  1RM8 A;  1UEA A;  1EB6 A;  1JAO A;  3LIK A;  1HFC A;  4PKW A;  1DMT A;  3AYU A;  3KEJ A;  3LIL A;  5LAB A;  3RTS A;  3EDH A;  1G4K A;  1GKD A;  2Z2D A;  1S4B P;  2I47 A;  1PWP A;  5D7W A;  1H71 P;  1BUV M;  3WV1 A;  4PKR A;  1MMR A;  4IN9 A;  2W13 A;  2DDY A;  1CQR A;  4GUY A;  2OVZ A;  1CAQ A;  1EAK A;  1IAD A;  1KAP P;  1J7N A;  4GF1 A;  1IAG A;  4XM7 A;  3UVC A;  4IJO A;  2OW2 A;  2DW0 A;  3LKA A;  2Y6C A;  1QIC A;  1GE5 A;  4DF9 A;  1K7G A;  3K7L A;  4Q1L A;  4WZV A;  2XS4 A;  1UTT A;  3LEA A;  3WV3 A;  1JIW P;  1XFX A;  3B8Z A;  3KME A;  1GE7 A;  1JAQ A;  1OS9 A;  3O64 A;  3LUM A;  1PWQ A;  4L63 A;  4PKS A;  4L7A A;  1O0T A;  3EWJ A;  1AKL A;  1ND1 A;  3B2Z A;  3BA0 A;  4HX3 A;  1Z3J A;  2OI0 A;  3VI1 A;  4AXQ A;  3HDB A;  3ZVS A;  4WKE A;  2OW0 A;  3B92 A;  2JT5 A;  3ZUK A;  1QJI A;  1HOV A;  1UMS A;  4R3V A;  2ERP A;  830C A;  3V96 B;  1ZP5 A;  3HB2 P;  3LJG A;  1FLS A;  1XFW A;  4H76 A;  1YCM A;  1QUA A;  2FV9 A;  4XM8 A;  4FXY P;  4EFS A;  2OW1 A;  2KRJ A;  1RMZ A;  2RJP A;  3HY7 A;  1CGE A;  3HY9 A;  1JIZ A;  4ZR5 A;  3F17 A;  4A3W A;  2SRT A;  5L7F A;  3GBO A;  2YB9 A;  2J0T A;  3LK8 A;  1EUB A;  3P24 A;  5D1U A;  1OMJ A;  4H1Q A;  3CKI A;  1OM8 A;  1B3D A;  2MZH A;  2O36 A;  4AUO A;  4L6T A;  4PKU A;  1BM6 A;  1KUF A;  4JP4 A;  1G05 A;  4GR3 A;  4JIJ A;  3HBV P;  1SU3 A;  1SLN A;  1IAB A;  1XFV A;  3LUN A;  1KUK A;  1B8Y A;  2W14 A;  1L6J A;  1ZS0 A;  4H84 A;  4IUW A;  3EDZ A;  1PWU A;  5B5O A;  1SAT A;  2OXU A;  1FBL A;  2OVX A;  3NX7 A;  3DWB A;  1PWV A;  3WV2 A;  1PWW A;  1OS2 A;  2W15 A;  1MMB A;  4J4M A;  1KBC A;  5D3C A;  4JPA A;  5D1S A;  3F16 A;  2JSD A;  3EHY A;  1D8F A;  4HMA A;  4G0D A;  4WK7 A;  4WF6 A;  1KUI A;  5I12 A;  3RTT A;  1CGF A;  2E3X A;  2X3C A;  3HYG A;  1UTZ A;  3F1A A;  4H82 A;  1GKC A;  1SRP A;  3OHO A;  2TCL A;  2YIG A;  3DTI A;  1D5J A;  2MZI A;  2HU6 A;  1G9K A;  5D2B A;  1JH1 A;  2WO9 A;  2OXW A;  3TSK A;  3P1V A;  3LIR A;  3LJZ A;  1ROS A;  3LMC A;  1I1I P;  2ERQ A;  1MMQ A;  2QPJ A;  2D1N A;  1XUR A;  1UMT A;  1BSW A;  4H49 A;  1ZVX A;  3G5C A;  2RJQ A;  4DPE A;  2CLT A;  4JA1 A;  2YUF A;  3L0T A;  2OXZ A;  1O0Q A;  2WOA A;  2JT6 A;  2W12 A;  3K7N A;  3LQB A;  1D7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...