5BOVA

Crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
b'DAGAFDKIQQIRAGDLNIGYVDIGPRDGQPVILLHGWPYDIQSYAQVAPALAQKGYRVIVPYLRGYGTTRFLSASTPRNGQPSAMAADIVHLMDALNIRQADLAGFDWGARTADIVAALWPQRVKSLVSVSGYLISSQQIGEKPLPPQAELSWWYQFYFATPRGEAGYRQNTHDFAKFIWHQASPQWQFSDATFAKTARALDNPDHVAITISNYRWRLGLEKGEAKYAGYEQRLAALPPITVPTITLEGANNGAPHPAPASYRAKFTGKYEHRDLPGAVGHNPPQEDPTAFVQAVVDADRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative epoxide hydrolase protein
molecule tags Hydrolase
source organism Klebsiella pneumoniae subsp. pneumoniae (strain atcc 700721 / mgh 78578)
publication title Crystal structure of a putative epoxide hydrolase (KPN_01808) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.60 A resolution
rcsb
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bovA00
1HQDA 3H2IA 4DMCA 5LZ8A 1XZAA 4IH1A 1ZGCA 5DYYA 1YSCA 1Q0RA 1UZAA 2GBIA 2ES4A 4BC1A 4EHBA 3PF9A 4J0GA 4M0MA 1TRHA 1Y7HA 5J3JA 4L72A 1ZD5A 4BYMA 4KYVA 4KE8A 2V96A 1CRLA 1K6EA 1BN7A 1THGA 4H7JA 3BL8A 3CCCA 2PU7A 3IDAA 2JEZA 5HQ3A 2XMCA 1KU0A 3FCXA 5ALIA 3B3QA 5C8ZA 2HRRA 1U2EA 4FWBA 4C01A 4X7BA 1UK9A 1QE3A 1E8DA 3RARA 4L0CA 3WK7A 4LXGA 4H7IA 5ESRA 2DQYA 1H22A 1OILA 2BCEA 4J7AA 1J06A 2VEOA 1ZI9A 1IUOA 1B6GA 5JD5A 1FSSA 1ZGBA 3WIOA 4B0OA 2XUHA 3QITA 2LIPA 1MU0A 2WU3A 1QGED 5HKBA 2QKYA 4DNPA 3H04A 4FBLA 1L7QA 4RE6A 3A6ZA 3DKRA 4UBMA 3WJ1A 1JJBA 4J0IA 2XUPA 4H0CA 4EZIA 1UKBA 3AINA 1UKAA 2V98A 4F60A 4W63A 3ESBA 2XMGA 4GW3A 4GECA 4LYEA 4E46A 3STVA 5BOVA 4BTVA 1EDBA 1YAHA 1AKNA 1AUOA 1A8SA 1N8SA 1XZKA 3FYTA 5ALNA 1CQZA 5AM5A 1MJ5A 1LBTA 4NVRA 4DM7A 5AKYA 4EY6A 2B4KA 4Y2XA 2JEYA 3AUKA 4GWLA 2PSJA 5K5EA 2OG1A 3E1GA 4QE3A 1UXOA 4EBBA 2ROQA 3V1NA 5ALZA 5ALOA 4H7HA 1IVYA 5KBYA 3DS8A 2HHAA 3F9CA 3BIXA 2CMFA 3WK9A 3S8YA 3QPCA 3FOBA 1DQYA 4GDMA 5JARA 1H2ZA 3C6XA 3G0BA 1CIJA 1XZGA 3FCYA 5EIAA 1SCIA 1ODTC 2WSLA 1AC5A 1NU8A 1VKHA 2XQGA 5EHNA 3M82A 2PL5A 4C4YA 1TCCA 4N8DA 2YH2A 3JW8A 4C89A 2PSHA 3VVLA 3CCBA 4HS9A 3I28A 1HKHA 3HEAA 5DNUA 5FV4A 1VZ3A 2PPLA 1XZFA 1JFRA 1R50A 3WK8A 1D07A 3FVTA 3UUEA 1MO2A 1XRRA 5F4ZA 5AKHA 2ZSHA 3WZMA 5HF8A 3BWXA 5AM4A 4W9RA 3R3WA 2QM0A 5DTJA 2XLCA 2DCMA 4BRZA 3ZLTA 1JI3A 1ZI8A 5ALHA 2R8BA 1GPLA 3R3XA 1K63A 2CKMA 3I2HA 2PSDA 1BN6A 3DL4A 3G9UA 3CN9A 2Z8XA 3PFCA 5K3CA 4KACA 1LZKA 3RM3A 1XLVA 2Q0XA 2J4CA 2WHQA 3OPMA 3A70A 2OCLA 1DTEA 5CH3A 5CBKA 4BAGA 5LZ5A 3WJ2A 4IHAA 2BKLA 4B84A 4WCVA 3G02A 1M33A 3U1TA 2OQIA 3HZOA 2JGLA 4UFOA 3DNMA 3KSRA 5I8PA 4P08A 1CUXA 4HXEB 2DSNA 5HF6A 2QMQA 3D2AA 4I3FA 4QLOA 5EHQA 2ZSIA 4G5XA 3H1AA 3I1YA 5CT5A 3R3ZA 4AN0A 1KEZA 1JMYA 3C70A 4WY8A 2PKYX 5JAHA 3VVMA 4OCZA 3F96A 4B7ZA 2J3DA 2QXTA 4UBKA 5AOCA 1CUWA 4I19A 1EB9A 5DLPA 2XUAA 4ITVA 1ETHA 5T4HA 3KWJA 4Y2VA 1YA8A 3FYUB 1BU8A 3IA2A 3H2GA 4N5IX 1QIDA 5LKAA 1N5RA 2OGSA 3PUHA 1GPKA 2O7VA 4K2AA 3H0CA 4FNMA 5JADA 4B82A 3IIIA 3C43A 3I2IA 3LIPA 4EUSA 3STYA 3K2IA 4X6YA 1DINA 5EGNA 1AMNA 1LPBB 5HKAA 4F21A 3D2BA 3I2FA 5LLSA 3G0IA 1LPPA 2JIDA 4UHCA 4BCDA 1XZEA 4GXNA 5DYWA 3DL7A 4TVKA 3AFIA 2OCIA 3TRDA 1R9MA 1LPOA 1EX9A 3BF8A 1Q83A 1R3DA 3WLAA 2IITA 1UK6A 4XX1A 2OXEA 3C6BA 4X85A 5FUMA 4HRXA 2ZYRA 4UBLA 4UHHA 1U65A 3Q8WA 2WLSA 5JASA 3SWWA 2OGZA 2CEKA 3PICA 2Y6UA 3W05A 3KOOA 4F5ZA 1UKCA 3D2CA 1W6RA 4FLFA 3H17A 3WK4A 2QTBA 3FLBA 4IH4A 1EXWA 1FFBA 2I03A 2WFLB 3O4HA 1CUAA 4WY5A 4HRYA 1RYYA 4FKBA 4EA6A 3IVMA 4F0JA 2BJHA 1QTRA 1BCRA 1EDDA 2X76A 2WJ4A 1IUPA 3HLKA 5JYCA 2JGMA 3DYIA 4AB1A 2W22A 4BCCA 4UHDA 4BATA 5K3EA 5T4BA 2QUBA 4N8EA 4MYDA 2ONCA 3PF8A 2ZYIA 2XB6A 3VKFA 4B9EA 1XZHA 3VJMA 3W9UA 3HRHA 3O95A 5CW2A 5ALMA 2JGEA 2O2GA 2XQKA 3WYDA 1ZIXA 2QJWA 1FFDA 3FSGD 1C4XA 5EI5A 1DT5A 3D4LA 1WB5A 4PSDA 2ZJ6A 4Q1VA 5ALQA 4C4XA 4CCYA 3PUIA 1MX1A 4Q05A 1CV2A 4U2DA 5DYTA 3W06A 4C4ZA 1YCDA 4DIUA 4A5SA 1F0NA 3HSSA 4D9JA 1PJAA 3AZOA 2HU8A 1BE0A 5CH8A 3ED1A 2OQVA 5E4JA 1QTIA 4AO6A 4AZ0A 5ALUA 3WIBA 4P93A 2W6CX 1XRPA 3D0KA 4CG1A 2Y1KA 3WWOA 1VA4A 1C7IA 1VA5A 5AKZA 4QZVA 3RLIA 1FFEA 3ANSA 1LPAB 4YK7A 1WHTA 3D59A 3OURA 5HF9A 5FPQA 4PF1A 4FNGA 2V9ZA 4UHBA 1N5MA 5C8XA 4BCBA 4FTWA 2H9YA 3VISA 2C7BA 3WWCA 3BXPA 4B80A 4V2IA 1E3QA 3BE8A 5D7BA 3FVRA 2X5XA 3IUMA 1QIJA 4BVLA 4OUKX 1UOOA 3FYUA 3TEJA 1SOMA 1EK2A 1HPLA 3MUOA 1S8OA 1C7JA 4MYSA 1DX4A 1P0QA 1Q0ZA 4EY7A 2IIVA 4BVJA 3WL8A 1BROA 2JGJA 4HZGA 1KU6A 3HXKA 2RGUA 1H2WA 2XQIA 3OG9A 1XQXA 2I3ZA 4M0EA 3QMMA 3JYHA 3AIMA 2AXEA 4KAJA 3QM1A 3AJAA 3RKSA 5DJ5A 4ARAA 2X8BA 1ACLA 3VJKA 1L7AA 5JAUA 4RGYA 3O4GA 1FFCA 3WKDA 4BDSA 4FLEA 3BDVA 4KJXA 1BRTA 1W4LA 4ARBA 3QPDA 2VJDA 3CXUA 5ALSA 1ZI6A 1XQVA 5AHXA 3B12A 4QDTA 1EA5A 4AXBA 4HXGA 2Z5GA 5K3DA 2XDWA 1THTA 4FLMA 4XVCA 5FDFA 1JMKC 2AJDA 3DJYA 1ZD4A 4U2EA 1UT6A 4A23A 3M81A 2WIKA 2EEPA 4G4GA 2WTNA 2HU7A 4XJVA 2WHRA 4MWSA 4HTAA 5ALDA 1CUEA 1TIBA 4X6XA 5D3KA 1UOPA 3C5WP 1CUSA 3L1IA 5LZ7A 1CUFA 3DYVA 2EDAA 4ETWA 3HACA 1HLGA 5A62A 1G4HA 1W1IA 3O9VA 3EIOA 4O08A 1J2EA 3F97A 1WPXA 3G9XA 1QIGA 5AM2A 1IZ7A 5C81A 4WFIA 4I4CA 4BAUA 2FJ0A 3R0VA 4QWMA 1SCKA 4LHEA 4MWTA 2O7RA 4J03A 1XROA 1EI9A 2WUGA 2BUBA 4WFJA 4CG2A 5AM0A 3WZLA 1R1DA 2ZYHA 4P92A 1CUJA 4CIAA 1CUDA 5I9IA 4QEKA 1H2YA 4TPKA 3PDCA 3MGAA 3STUA 1CUZA 5ALWA 3QVMA 3HYSA 2Z8ZA 4CCWA 4OU4A 2WILA 3BIWA 1XQWA 1EHYA 5JZSA 2VAXA 1RWQA 1UFOA 5EFZA 1VLQA 3QBJA 3NWOA 5ALEA 5ALKA 1DX6A 2HU5A 3C45A 5HFAA 5D3ZA 4DLNA 2K2QB 1XLWA 5ALTA 2DR0A 5IVDA 5C8VA 3G0CA 2WM2A 1EINA 5ALYA 3ZPXA 4L3WA 3FAKA 4Y2UA 3A2NA 5A7HA 1MT3A 1ODSA 2QUAA 2FX5A 4BB0A 2QOEA 1EDEA 3IURA 5JD4A 1J1IA 3CN7A 2HIHA 3WWDA 2UZ0A 1OCEA 3V1KA 2B61A 2QS9A 3ZI7A 2WJ6A 1P0MA 5JANA 3FYUC 5AK5A 5AK6A 2WJ3A 4AO8A 4W1PA 1VE7A 1Z68A 4PO3X 5JZBA 1UWCA 3IUJA 1W76A 3O0DA 3GZJA 3N2ZB 1FJ2A 1EVEA 4PV7A 5AM1A 1BEZA 1QIMA 3L1JA 1BEEA 4LXHA 3GA7A 2OCKA 2ZJFA 2BGRA 4RPCA 1LPNA 5ALFA 3OM8A 1SFRA 4Q82A 5HK9A 2V97A 2XUGA 3IULA 3IB3A 2JBWA 4DMFA 5JAPA 4JYPA 1A88A 4DGQA 1Y7IA 3R41A 2O2IA 5FKJA 4AMZA 2PSEA 2WFLA 4K5QA 1IMJA 3WL7A 2H7XA 3LCRA 3DOHA 5JAOA 4ZV7A 4QDZA 2PBLA 1LBSA 2YASA 4E14A 1EK1A 1BCSA 1F0PA 2HA3A 3ESDA 3QMVA 4BVKA 4BAZA 2DHEA 2WG0A 1N1MA 1QLWA 4UHEA 4U2GA 5AP9A 4G8DA 1CEXA 1T4MA 1O6FA 2VSQA 5IH7A 4OYYA 5ALJA 1QZ3A 5K3AA 4U2FA 1AZWA 4KE6A 3GELA 1K8QA 5FRDA 2XUQA 3TJMA 2R11A 4G9EA 2XUOA 5C7YA 3AIOA 4Y2RA 5BWBA 4MQLA 4HXFB 3LLCA 2PUJA 1BS9A 4NZZA 3UMJA 1B41A 1XZJA 3F98A 4A16A 5AKKA 5ALVA 3G9ZA 3D3NA 2WUFA 3DEAA 2NW6A 5A71A 3T4UA 2HFKA 5ISMA 1XRNA 4EB0A 4DMHA 5FXMA 3I6ZA 5E4YA 3G0DA 3WKAA 5AI4A 4K6KA 1F8UA 3C6YA 1IUNA 2ACKA 2I3DA 1K5PA 5AICA 3FWHA 1DQZA 4BP9A 4B81A 2XE4A 5JD6A 3GBSA 4FDMA 4X93A 1R88A 2AJBA 3PE6A 1DWQA 1YR2A 2VJBA 3K9BA 4QLAA 4UBNA 2C5FA 4J0JA 4KAFA 1DWPA 5T4EA 1VOTA 5LYYA 3GUUA 1CUYA 4FBMA 1TCAA 1H2XA 2ORYA 4L9AA 3MUNA 2BUCA 1I6WA 2ECFA 4JNCA 5H3HA 2VT6A 2OAEA 4JEIA 2XQJA 4JUIA 1LNSA 1GT6A 1CQWA 3GROA 3EQ7A 5AKIA 3H19A 1WOMA 4N8SA 2WU4A 3VDXA 1WM1A 2XMQA 2ZJ7A 1E66A 4H35A 3W04A 1XZLA 4AO7A 2RI6A 4FOLA 4KE7A 1R4ZA 2CZQA 3WQHA 2C58A 1TKRA 2Z3WA 3S2ZA 1MX5A 1R9NA 2Y6VA 5DNWA 3WL5A 5LP1A 2WUDA 4GBGA 2P8SA 1JU3A 2G5TA 1YAJA 4W1RA 2QJRA 4Y2TA 5AM3A 1RP1A 1HBJA 2HM7A 4Y2PA 1HDEA 2XMBA 5BWCA 3BJRA 2O2HA 3WK5A 3L1HA 3STXA 5CT9A 4U2BA 4KEAA 3NGMA 4UBIA 3WL6A 2PU5A 2I78A 4BP8A 3R3VA 2G63A 1XLUA 1USWA 1XQYA 2XMSA 2WTMA 3D5EA 4G8CA 4LIPD 2G4LA 4BE9A 3WWEA 1YASA 4H7FA 4AX4A 3V48A 4B6GA 3WKBA 4CIBA 4ZXFA 3STWA 5CTAA 3AZPA 3A2LA 4UFPA 3AZQA 4WDQA 4G9GA 3H18A 5D6OA 4M0FA 1QOZA 3AIKA 1P0PA 2PUHA 2PX6A 2HA6A 3KDAA 1CUBA 4QWWA 3ICVA 1OXMA 4X3CA 2DHDA 4X00A 1XRMA 5AKXA 4ROTA 1JT2A 4GLBA 4OSEA 1PFQA 5LZ2A 5HF5A 3ILSA 4BRSA 3W9BA 5CURA 4C88A 2GBCA 4OB8A 2HDWA 1O6GA 4Y2YA 4YASA 1XKLA 4ZWNA 5JALA 1QJ4A 2AJLI 3EBLA 3DOIA 4MJ3A 3UUFA 2CB9A 2WFMA 2WQZA 4UFNA 5BV7A 1U8EA 1CUCA 4Q3LA 2C0QA 1VXOA 2EDCA 1MN6A 4NMWA 1YB6A 5AK3A 2CUTA 3M3DA 1GQRA 5HCUA 4BZWA 1T2NA 5CT8A 3HI4A 4X90A 2WIGA 3B5EA 4J0CA 3H2JA 2VATA 5IVKA 5AOAA 4WJLA 2Y2VA 3VJLA 1ZD2P 2XT0A 1AX9A 5T4FA 3R3YA 3LS2A 1ZJ5A 4MEBA 2QT9A 3ESCA 4FFWA 5AO9A 4X95A 3HABA 4ZI5A 1XKTA 4DSZA 4H18A 5AI9A 2QZPA 4B85A 2PSFA 3DCNA 4BTLA 1H23A 4KAAA 1UK8A 4INZA 2HADA 3ICWA 1A8UA 1VE6A 2VF2A 5K3BA 4Z49A 1XZIA 4NS4A 3QMWA 3QH4A 5CXUA 1EH5A 1XZCA 1YS1X 4GHWA 4FFVA 1QIKA 4E11A 4Y2QA 4IQ4A 4X97A 1SC9A 4S0XA 1W75A 3IBTA 1QIHA 4Y2SA 2VJCA 4B0PA 1ZD3A 3WMRA 3F8SA 5KREA 5EHXA 1CFJA 5ALRA 4AQDA 4DNFA 5SYNA 4UBOA 3HC7A 4DNOA 1CVLA 2RHTA 2XMRA 2OLEA 2VT7A 3DKKA 1AGYA 3A2MA 3G8YA 5JIBA 4P9NA 2BUAA 2WHPB 2BFNA 3ZWQA 4KRYA 4UPDA 1GKLA 3STTA 4AMYA 2H7CA 5IVIA 3FLEA 1GXSA 4E15A 3I2KA 2XUIA 4PSCA 2WIDA 3G7NA 3I6MA 5IVHA 6YASA 3H1BA 2RIPA 3AILA 2XQFA 1XZDA 2GBGA 4Q3OA 2AJ8A 4RNCA 3X3HA 5CT4A 3O4IA 4GEGA 2HRQA 2E3JA 1VXRA 4DYHA 1UOQA 3FSGA 4Q34A 1A8QA 4DSAA 3H2KA 3I6YA 1YA4A 1JJFA 4FHZA 1QFMA 4EY5A 1K4YA 1LPMA 3I2JA 1IZ8A 3JWEA 4X91A 3OC0A 1JKMA 4CFSA 3N0TA 4TGLA 1WB4A 4QA9A 1U4NA 2J4FA 1F6WA 4YX9A 1WHSA 2G5PA 1J07A 5E4TA 2XUJA 1QONA 3ZLVA 5HQ3B 3W2TA 3NUZA 1YS2X 2WKWA 5EHZA 1Y37A 3P2MA 4ZGBA 4X92A 1EB8A 5ALLA 4H7KA 2GYVA 3M83A 5FPPA 2JGFA 2XLBA 4K6GA 4PSUA 1X70A 4CCYB 1MPXA 3QYJA 2FJPA 2JGKA 4JH0A 3FBWA 1E5TA 4J0KA 1E8MA 3C8HA 4J0HA 3FNBA 3T52A 4PW0A 5AKJA 3VXKA 4X6UA 2WIJA 2XUDA 4Y7DA 1ZJ4A 4B9AA 1GZ7A 1G66A 1MX9A 2WG2A 4Q3KA 1XZBA 1LZLA 1ORWA 3C8DA 4IH9A 4G4IA 4BDTA 5CMLA 2VTVA 5ALGA 3BJMA 5SYMA 4C87A 3KWFA 4DTCA 5DTIA 5AIBA 2VQ6A 5AJHA 4EY4A 1A7UA 5AIAA 3WYNA 4UUQA 4ZRDA 1XFDA 4UHFA 1VZ2A 2Y2UA 2YXPX 3V1LA 4MEAA 4LYDA 2QR5A 4RE5A 3DLTA 2WIFA 5AI6A 2C0PA 1DT3A 3TGLA 3OOSA 5A6VA 4H7DA 3QZUA 3WI7A 5IKXA 3IUQA 3D7RA 5AH0A 1ZIYA 4Y2JA 1ISPA 4G4JA 5CH5A 5LZ9A 2RONA 3G0GA 2HA0A 4PNZA 1LPSA 5AI5A 3KXPA 2H7YA 1UK7A 3C5VA 3C6ZA 3H2HA 3Q0TA 3DD5A 1ZOIA 4J0DA 4Y9SA 4X94A 3U0VA 2OCGA 1GKKA 1ODCA 4DMKA 3V1MA 4LKOA 4OPMA 3QPAA 3O4JA 3RK4A 3EQ8A 3BF7A 5JATA 4WFKA 5ALXA 1AQLA 5K3FA 1ORVA 5CRIA 5LIPA 2XMDA 5KWJA 1SCQA 4MQMA 4GI1A 1CUIA 2DHCA 2OGTA 1VJ5A 2J3QA 1TQHA 2Z3ZA 1NU6A 1YB7A 3DDUA 3I2GA 3ZV7A 1QFSA 4H77A 2ACEA 4HVTA 3PI6A 2WHPA 1LLFA 3GFFA 1MAHA 5AOBA 5DWDA 1EVQA 5JZ9A 2D5LA 2RAUA 5LZ4A 2OPHA 4BE4A 2QVBA 1X2BA 2FUKA 5HK8A 4ZREA 3DQZA 1JJIA 4FMPA 1Q84A 4MXDA 4AZ3A 4H7EA 4K6HA 4LXIA 1TCBA 1MTZA 2XI4A 3YASA 4KRXA 2CBGA 1CLEA 1QO9A 2GZSA 3IUNA 5K3FB 1XRLA 4CG3A 4B83A 1G42A 2PM8A 2GYUA 4PQEA 4N5HX 1WCYA 4QNNA 2RHWA 3ZLUA 2HL6A 3NOXA 3SX4A 4HAIA 3KD2A 1CUVA 4U2CA 5A7FA 2HA5A 2DFPA 4YPVA 1XZMA 1QIEA 4AN1A 3BDIA 3C87A 4G1FA 5EIEA 5AKLA 2OAGA 4C6HA 5FOQA 1NX9A 3R40A 2B20A 1FFAA 2VJAA 4OB7A 5AKGA 4WDRA 2QRUA 3E4DA 1QIIA 5FLKA 2GBFA 2BAGA 7YASA 1QO7A 2CJPA 2D0DA 2HA4A 4XWGA 5AI0A 1AURA 1WB6A 1CUHA 5KWIA 3LIIA 3F67A 3OTQA 2HA7A 4QDUA 2XUFA 1ACJA 1MAAA 4QDOA 3ESAA 2VA9A 1PV1A 3E3AA 2GZRA 2C4HA 1CUUA 4OD0A 5CXXA 4BC0A 1QIFA 3PFBA 3ANTA 3WKCA 2IX9A 3FLAA 2ZVDA 2H1IA 3WWPA 2XUKA 4OB6A 4IO0A 4UBJA 1E8NA 2ZYSA 1GQSA 4OU5A 1CUGA 1GPNA 4OYLA 5HZGA 3K6KA 5A2GA 1DWOA 3V9AA 2QXUA 3WK6A 5LKRA 3G9TA 3LP5A 3WA7A 1TAHA 4J3JA 1CPYA 4BBZA 5I7UA 4DNQA 2GYWA 1LGYA 2B9VA 3I1IA 2AJCA 4XIIA 1G5FA 5DNVA 5CT6A 1GGVA 2BGNA 1MNAA 4G8BA 1JU4A 2HA2A 2YYSA 1X2EA 3SK0A 4CI9A 5AK4A 3WA6A 1MNQA 2JF0A 2WFZA 3E0XA 3WKEA 1E89A 4ZV9A 5FP0A 2WUEA 2VAVA 5AI8A 2C5GA 4BZZA 5HFNA 4W1QA 1L7RA 3MVEA 4KR0A 4KE9A 1TK3A 1P0IA 1HL7A 1DU4A 4X71A 3HJUA 5AKEA 3O9MA 4QDXA 2XMZA 2WG1A 4EY8A 1XRQA 2JGIA 3SC2A 5ALPA 4W1SA 2HFJA 5E2IA 3R3UA 1WPRA 5YASA 1ZICA 2PVSA 5A7GA 2DQZA 3EF3A 4JYMA 3EQ9A 1W52X 1CR6A 5EIHA
chains in the Genus database with same CATH superfamily
3QBDA 1HQDA 4XD7D 4R05A 1NQOA 3IKLA 3P9QA 4FYIA 4LX0A 4RDCA 2IPXA 3V4LA 1BIFA 4UARA 2PLFA 1C0KA 4LVCA 3SC2B 4IH1A 3TPZA 2OCXA 4L5AA 4WK0B 4CF5A 4CMEC 2A0WA 2QRMA 3IHTA 4M7WA 4P84A 3U9TA 1Q0RA 4JLSA 1XZPA 2CJXA 2GBIA 2JARA 1U02A 2VC2B 1BGVA 4II2A 1IHYA 4R2XA 3DDHA 1U31A 1TRHA 4I2VA 4ZZ3A 4J3FA 5B3AA 2V4MA 2JKZA 1DO0A 4L72A 2F1KA 5FLXA 3HU5A 3VBCA 2P11A 4N7BA 3RROA 4RLQA 4FE4A 4KYVA 4BNMA 4PYOA 4CG0A 3LDAA 4OGGA 1K66A 2A33A 2FWAA 2P2SA 1H6AA 4GBED 1U8CB 4NFHA 4KFTA 3UJ6A 1R4MA 3WTBA 5CA1F 1BN7A 4YRCA 4TL9A 1Z7EA 3K6SB 3IDOA 1OROA 2UUAB 1A4XA 3IT2A 2E5WA 2SBTA 4J9UE 4G3XA 1J99A 1QM5A 3BL8A 3C41J 2AN3A 3CCCA 3IDAA 4IVRA 5DHPA 5FQNA 5JEEA 1X14A 3IMEA 1VYHA 4ZO9A 5HQ3A 1H0SA 3CUEF 3ZVNA 3SYRA 3D3EA 2JFPA 4FZVA 5AVTA 1BQ4A 2GZ3A 4D42A 3K6JA 5DGIA 3X44A 4EG0A 4XQ0A 3CGWA 4LG1A 2HRRA 3O7WA 1H8EA 4RJ2A 3W9YA 1XVTA 1E6LA 1PZGA 2HD4A 2HLHA 4FWBA 4F6CA 5L6LB 3OIYA 2FSSA 3JALB 3H3XA 4LVNA 2UVDA 3RTCA 3W1EA 1A98A 1E8DA 1SNYA 3L7DA 4G5GA 4RU1A 2AOTB 3RYFB 4B74A 3DUFA 4FKZA 1RXVA 4PBTA 3W0LB 2FR1A 3KJXA 4MV1A 1N1DA 1RCUA 3PPVA 1A96A 5DSTA 5A0FA 1GPWB 1NLMA 5ESRA 2DQYA 3QHQA 1H22A 2QGFA 2X2EA 2A58A 3MINB 1VBMA 1VFPA 4P38A 3SZUA 4BNLA 4DQXA 4IICA 1NGSA 2FDCA 5FBVB 2O54A 3LT0A 1ARZA 1PT9A 1ZGBA 3QY0A 2BBOA 2PCLA 2UXDB 1M1UA 2GJ4A 1Y3BE 2A30A 2LIPA 3JAMA 1YK0A 5TF0A 4HY3A 4IKOA 2F3PA 3O1JC 4CTJA 3ZI0A 3H5OA 2R87A 1OKKA 1QGED 1USKA 3NHRA 3LQYA 1VKNA 5G02A 5HKBA 4D26A 1TB4A 1JB1A 2C03A 2QKYA 2YJNA 3AOGA 3HCRA 5CP8A 4NR0A 3U1BA 1UADA 2P3QA 1I6LA 3AEZA 2EV9A 1Q1AA 1WUKS 1KMNA 3A6ZA 4NLLA 4RE6A 3BAZA 5GP1A 1IU9A 4BJHB 2FMFA 3FE2A 1JHMA 5A3RA 2XUPA 1E7SA 2ZIWB 4IIFA 5FO0A 1PEAA 4XYLA 4LX8A 4RFSB 3UT5A 3J81A 1BC5A 2H4HA 5KIAA 4QPDA 1CXZA 3ACBA 4L9SA 4CTNA 3AL0C 1PNRA 4Q6BA 4P36A 2J30A 2FI1A 4XM2A 1XEFA 4HXYA 2NUTB 5LQMA 1U2ZA 3PP8A 4FMBB 1NLYA 4JLMA 4L7QA 5E1BA 1OUMA 4ZVOA 1HFWA 3RE1A 2BTQB 4PG4A 4NYIR 1BMFD 1OTHA 5JVDF 1Z4OA 4BTVA 3LQQA 1JPJA 3E7DA 3PI7A 2EQ5A 5IS2A 4A0HA 4ZKDA 2RD2A 4OQFA 2ZS9A 1GXSB 4UM5A 3IILA 1ZBDA 3VFDA 4FJ2A 1ZUIA 3BFXA 3CF6R 3HJGA 4RQTA 5GY7A 5A6SA 2VQFB 1JUDA 1JVNA 4D7AA 5ICGA 2IYAA 3TKAA 1ZM7A 2WRZA 3D6NB 2AFHE 4RGQA 5B5SA 1CQZA 3LWDA 3LOUA 1QV7A 4Y1EA 1DRWA 3W8RA 4LKRA 4FHGA 4CMCA 3L82B 1U8XX 1KH1A 3C3JA 5M3BA 2AZ4A 1CF9A 3VRHA 4IGFA 2ZZMA 2QG4A 2PIAA 4W9NC 4JJZA 5AKYA 5EP4A 4AM8A 3PD7A 4U7FA 1Q1QA 3RI3A 5CB4A 3T3EA 1V6SA 2QX9A 1ND6A 4C1NA 9LDBA 1RPJA 4NAUA 4MRMB 1E7YA 2WE7A 4WKNA 2I3GA 3MSCA 5ED0A 5IF3A 3I72A 3NHWA 3W8FA 5KO2A 3VNQA 2E1PA 4KWTA 3OU7A 3P0JA 3L1KA 5DTMA 3ZHTA 3UPTA 2C98A 2NZVG 4LDRA 2O8CA 2OG1A 3X1JA 1VPVA 1J2YA 3E1GA 1B2LA 1UXOA 4EBBA 3V1NA 5LD2B 4I1SA 4ZC1A 1JTVA 4QOFA 4YYEA 1SH7A 3P0IA 1C4KA 4RDXA 4WAUA 3PFWO 5KBYA 1EHCA 2Y93A 2NXWA 2GXUA 5CDYA 2D06A 2HHAA 4MKGA 2GPAA 4I0WB 5JBIA 1A8HA 2GBPA 3NEAA 4HQLA 3S8YA 3QV2A 2BFBB 2IU0A 4E13A 3QPCA 3FOBA 4DAOA 3E8MA 5JARA 1JI0A 2PX3A 5JQWA 1EP9A 2LNDA 1T13A 3C6XA 3EMDA 3EUAA 4HZUA 2BIFA 1IWPB 2MMCA 3FCYA 4WN9B 1VCNA 5EIAA 1TKCA 3M2TA 3PSHA 3ZU2A 4DLKA 5B36A 1LI5A 3CO5A 5HA5A 2XRZA 1VKHA 2IY7A 2XQGA 4NS1A 3D0OA 4X61A 5FA5A 3TIVA 2EJWA 4R1MA 3IJEB 4OI4A 2IE0A 2YXEA 4PCAA 1UMBA 2PXCA 1L7DA 4RFVA 4GRDA 3EFOA 4ZT4A 1Z36A 2OCDA 1N2SA 1JLMA 1PN3A 3PNMA 4FYKA 4ZZ2A 4C89A 2QJFA 2PSHA 2B1QA 3OCWA 3AP3A 4PTYA 4QRHA 4XDHA 5DIZA 2OFFA 3VVLA 4UVDA 2IYQA 1RC0A 3VUEA 3QX9A 3SKYA 4NATA 1WAMA 1QFJA 3M5CA 4D6YA 1KI6A 3EAFA 1UXIA 2NUAA 3DWGA 1JLHA 1RZVA 1ISGA 2R8EA 3HEAA 3LYUA 4J90A 4KPUB 5DYNA 4BX8A 4AJEA 4HNUA 4F92B 4RM2A 1PGOA 4A8HA 1E9AA 3DE5X 3DT8A 3ZVLA 1K7XB 4TM8A 2VKQA 3MW8A 1IJFA 1R0BA 3PITA 4HRAA 4N18A 5FTWA 2JGRA 2FJUA 3IAM1 4L28A 1FU4A 1VZ3A 2BEKA 2YW9A 2ZI3A 1K3UB 1OX5A 1QQTA 1L1RA 1T5LA 2JD0A 2QWXA 4PR3A 2YTZA 4XW2A 4UM9B 5BSKA 1RR6A 2BHRA 3KJIA 4FZ3A 4MVJF 2ZT7A 1DBSA 5C2JB 1W8DA 1FS4A 2X2PA 4E7PA 2HSZA 2DUUA 1K27A 1WPGA 3SYMA 2X9QA 2EL7A 1VM6A 1IWBB 3PHJA 5EZ5A 2I6QA 2H63A 2OSVA 5AKHA 5HGXA 1M67A 1KDPA 1X7WB 1GN8A 3EPPA 1Z56C 3IH5A 3LKZA 5AM4A 2ODQA 3SR0A 5B64A 1NUSA 2WF5A 3R3WA 3LF2A 5A9RA 3I12A 4L51A 2X7HA 2X2OA 3ASYA 1N7HA 3AKYA 2PT7A 3DWIA 3TLBA 3UT0A 2O06A 3ETEA 3U5TA 2QAGB 2AN1A 2M2IA 2QBYB 3QKSB 2VVTA 4OSOA 4BRZA 2YFKA 4CMEA 5HR5A 5DM70 3WGLA 2FWRA 2R8BA 3N76A 4LSMA 2A5DA 4KODA 1DC3A 3EZNA 5K05A 1K63A 3WBBA 1T5HX 3B3FA 3I2HA 3LXUX 2D1SA 4AY5A 1HNZB 3RS7A 1ZVKA 3HR8A 1BN6A 1G9SA 1X1BA 1YRWA 3KTOA 2PS9A 3O31A 4ZYUA 3ZKAA 3V1UA 2Z8XA 3WNQA 3HP7A 4AS2A 1P2SA 2I8CA 2YY6A 421PA 1DC4A 1JHXA 3CVUA 3L49A 1YRQA 3UAOA 1CCWA 2JBAA 2Q2OA 3E9ZA 3F90A 2RMKA 3Q0IA 4M99A 4DJTA 1ZCBA 2CF6A 3QNUA 3WYAA 3EZLA 4MS4B 4BVFA 1J97A 3A6FA 1FTNA 3CWQA 5FAXA 1BWRA 4TWRA 1U7DA 1OZ0A 4ZCMA 4TV8B 5CBKA 4GGOA 4I66A 5LZ5A 4OVKA 4YB8A 5JCJD 2D59A 2W98A 2OFOA 4M6WA 3N7TA 2BKLA 2OHOA 2ON6A 4IHAA 3K16A 3GRYA 4WOCA 4X20B 4JP1A 4B84A 2B94A 2G4VA 4H3KB 4P3KA 5AMXA 3D7SA 3G02A 3JWJA 3MTDA 3GA5A 1F8XA 3PRHA 3ETCA 3QHPA 3UH1A 1BMTA 3HA7A 1KJNA 1TM4E 3SC6A 3AM1A 3HZOA 3ZNNA 1H5QA 2AQHA 3NBMA 2JGLA 4TX1A 2HTEA 2YWDA 4GWKA 3ESRA 3RANA 4GMHA 4YAKA 4EZBA 2PQ2A 4KXMA 1O0CA 3KYJB 2P3SA 3AHFA 3DNMA 3UMGA 3RUCA 5K7SA 4J1TA 3CZMA 2YQZA 4OQ4A 2D0OB 3SBXA 3IQXA 4EG3A 2P69A 2C82A 2H3EA 3IMFA 1C7QA 1SCUA 2FEKA 1ZWLA 3D43A 2N0SA 1FFSA 1IBSA 4S0ZA 3RUPA 2ZSIA 4LJ9A 1N8TA 1UJ4A 5FTLA 2C9DA 3IUBA 4E07A 1ZLXA 3OF3A 4RV9A 5K6AA 4PAWA 3EOAI 3AKDA 4K1XA 1KEZA 1P9WA 3K4HA 4YRLA 2FLKA 4F7DA 1ZU4A 3G2OA 1F4LA 4GH5A 4Z0TA 1EM6A 1WF3A 1UKYA 2OL4A 2PKYX 2XWQA 5PGMA 4JIGA 3VKUA 1UC4B 4ME6A 4FD2A 4KAXA 2BGUA 2OM2A 3VVMA 5L8VA 4AY6A 3PXDA 4H2DA 1OH8A 3N2KA 2QXTA 3ZS8A 4TYMA 3D8HA 4O02B 1QHXA 2O52A 5ARBA 1L7NA 2EZTA 4QU0A 1U0BB 2RGXA 1CUWA 3CR8A 1U2SA 3KOUA 1XTPA 4LS3A 4IUYA 4MARA 4RPKA 2GF9A 5CLJA 1NJGA 2ZSFA 2GZ2A 5DLPA 1I7SB 2RI0A 3QQPA 3BSYA 3BCSA 2AQ8A 3KWJA 4F9EA 2VBGA 4S1WA 2XSZA 4Y2VA 1Q0TA 1SCJA 1YA8A 3UQYS 3ENVA 2E87A 3QIVA 5K1ZA 1PE0A 3EGDA 2BEJA 2D3WA 3G2NA 3KLNA 4HQOA 4L4UA 4MWGA 5DX1A 5E6SB 5KI6A 4ZIRA 1JPUA 1FFXB 1AM4D 1DFGA 3MWEB 5BWNA 1OPRA 3EHDA 5LKAA 3TKYA 1G4UR 1TIPA 2Q3MA 1E2GA 1TK2A 5FTNA 5KYTA 1I0LA 3R1IA 1SU7A 3QVVA 3MHPA 2O7VA 3IOCA 4UVHA 5BN3A 4ER3A 3ZHQA 1Q74A 4YHHB 3ZWYA 1I7PA 2NU9B 3H0CA 4AG5A 4I2NA 3PEUA 4PX9A 5LM3A 4R2MA 1VMEA 1HDRA 2FF5A 1P74A 2ZB2A 3OFNA 5E6RA 4A2QA 4EPXA 2FN8A 3E7FA 3W2EA 2AS0A 1V4NA 3LIPA 4K81B 4NEHB 4XYEA 2IUUA 1I9GA 1KJIA 2ODNA 4UAGA 1FP6A 1EJ0A 3GJ5A 1U28A 3JZDA 2I3AA 2E5FA 3QNMA 1QJCA 1U7XA 2X7XA 3EISA 3NHSA 4GOMD 5ERGB 3ZU5A 1QDLB 3CE6A 4C3OB 4F96A 1ITZA 4PXAA 1OAAA 3QXXA 1E69A 4F21A 4AWAA 1E4VA 1U1EA 1LPPA 2FLWA 5C8YF 3U81A 3BA1A 4TMKA 4S3MA 2NP7A 1EFKA 4JEMA 5C8XA 1KZ7B 2WMOB 2YXLA 2PL3A 3MD9A 1JLRA 3SKXA 1KGDA 1XN4A 2C42A 1MDBA 1SC4A 2VZEA 1NWHA 2WB4A 2MSEB 1ZHFA 4WFQA 3LL4A 4OP2A 2OCIA 1M74A 1NMEA 2ABWA 4MPRA 3SSNA 3MLEA 4KWEA 4EL0A 3WGIA 3U7IA 4F93B 2QT0A 2AMFA 2Q29A 4UM8B 4MQBA 3V8PA 3WDLA 4ATNA 3HDQA 1LPOA 1SVLA 3GLFA 3VPHA 2DLDA 3SZGA 1Y8RA 3LRPA 4ZOBA 3I09A 1XP8A 1RYDA 1SZPA 2NO4A 4XX1A 4P3YA 1FX0B 3UGKA 1CZRA 1JQLB 1TMKA 3KM0A 4MW7A 1Z7BA 1VFNA 2FPUA 2XSZD 1DAIA 1C3JA 5EL0A 1L5OA 3ABQB 1GQQA 3HU1A 2BFWA 4JU8A 3QOXA 3SEQA 1CY7A 3TUIC 2ZYRA 2OLKA 2IQIA 2DQSA 3BRWD 2V74B 5FWAA 4RA6B 2POCA 2L2QA 2B37A 2AL7A 1ZM3A 3F7NA 1E9CA 3W77A 1TPYA 4JC0A 4DDWA 2QNBA 3ZQJA 2CEKA 3PICA 4LBZA 1G3QA 1KR2A 4O2BB 5EJ6A 5IZ4A 2Y6UA 4PLFA 4R8SA 1VJRA 1SN7A 1I13A 2GM5A 3D2CA 3GFTA 3LX5A 4JXKA 1QZXA 3I9V6 4FW8A 4ZU6X 5TS3A 1GO2A 3UOAB 3DLPX 2WWXA 3H3FA 3UHOA 3PNKA 5JMPA 3H17A 1RFLA 2QTBA 3GJ7A 3L7IA 3T5DA 3OX4A 3U39A 4KLAA 3UCFA 1O8BA 1HE2A 4TKZA 4YO8A 1H93A 2SICE 3JYQA 3GLGE 2J32A 2I03A 4UQLA 3O1IC 1X80B 4C0LA 3K0AB 3DP7A 1UZMA 2JLYA 3O4HA 2H2FA 1GFSA 4HDNB 3L8DA 4PPYA 3IPLA 1IM5A 1EKXA 3AHEA 1SHKA 5J2UA 2VXBA 3PKIA 4D2IA 4EA6A 1BDBA 4EO9A 4QUDA 4UQOA 5DBFA 5KX5A 2HK6A 3K31A 2O3RA 4DCPA 5FWYA 1MF7A 2X5NA 5F5XA 3P19A 1BCRA 4KGZA 4BJ6A 4DARA 2VSFA 4CTOA 1RM3A 2VXOA 1ZGHA 5DM2A 3N58A 3FZYA 4YMHA 2X76A 2BFEA 5ILOA 4NULA 4IIUA 4UUMA 5JCOA 1FP1D 3HLKA 3PZRA 4XLTA 2G1PA 2HT1A 5G2OA 3UYKA 2QR3A 2HJRA 2IHTA 5H83A 5JE8A 2R9VA 3R9XA 1LSUA 1NR7A 1Q21A 2CY0A 4JOBA 2BGIA 1KQNA 1VKOA 4BMZA 3Q8LA 3Q7IA 3AF3A 4UHDA 2CJFA 5EIWA 5F3RA 3TMYA 1Q20A 3VR3A 2JEOA 4IW3B 4S2EA 5T4BA 3UEOA 3IRUA 2IODA 4ZI3A 2BFEB 2QUBA 3A6LA 3DMHA 1W94A 4CQMD 1ML3A 1CY2A 1SXJE 2W6OA 2Q28A 3AUAA 1D2EA 2BFMA 2NVBA 1V71A 3E03A 1HLPA 2HQ1A 2ONCA 121PA 2UYOA 2BFDA 2ZYIA 5F12A 4H1UA 4F56A 3VKFA 4G1BA 1XZHA 4LZPA 1ATZA 5HGJA 4N0QA 5KNBD 4FFMA 4G6ZA 4E6PA 3O95A 3CVYA 4DCVA 2WU8A 3S1SA 1YOVA 4UATA 1N2CA 1VHJA 2XDQA 2XYHA 3DBRA 4FDTA 4KVFA 2ZITA 3TF5A 2J09A 2ZLBA 1E1CB 4YP5A 4DRZA 1ZIXA 1T15A 3JPYA 4IIJF 4TSRA 3AB7A 4CKEA 5C46F 4YRFA 2QTTA 3BCRA 1DT5A 3RJTA 4YN3A 3DOCA 2A9FA 3LW7A 3U7RA 3WADA 1PJ3A 3IHLA 5KCMA 3HDJA 4WINA 4QYIA 4EJSC 4XH9B 3RKUA 2Q2NA 4JK3A 5EWLB 4L57A 2LCQA 1X77A 5FX2A 2JCYA 3ZHYA 1LV7A 3HXOA 5EIXA 2LD4A 1F2TB 3RVJA 3ADKA 3PUIA 1MX1A 4PYLA 1UMCB 2BP7B 2MSWA 3QVTA 3T7RA 1CV2A 4UM7A 3TDMA 3W06A 1P62B 1NC1A 4Y1GA 4C4ZA 3SVZA 4QOEA 5IM4A 1JEQB 3KKEA 4IXWA 1AF4A 5E7IA 1UL1X 2GZDA 4DIUA 4A5SA 1NBAA 1Z39A 3MGGA 4GI2A 2JJ8A 2ZRJA 3CNQS 2DLCX 3V5NA 3Q3IA 1VYUA 3USZA 4BRUA 4B3HA 4FC6A 1CVRA 5K9ZA 3L7YA 2HJGA 3R24A 2IYNA 2ZE5A 3OH8A 4D3DA 3JY6A 2IY9A 2E49A 3DKIA 2ODAA 2F48A 1UEXC 1YE5A 1XRPA 3ZXYA 2X1LA 3IDQA 5FBWB 3N2LA 2I2FA 1CTQA 1VJ0A 1LF5A 3KFVA 5F1OA 5JISA 1XNQB 3CNNA 4DA0A 1F48A 4YWJA 5KVQA 5LQUA 1VA5A 1JIKA 3UM9A 2HEIA 2P3OA 4UE6A 1M2GA 4EGAA 2XADA 3RLIA 4AWBA 4RAOA 4CLEA 3HCFA 2OP1A 1LPAB 2AC4A 1YDMA 4IIVA 4LYYA 4QARA 5K0FA 1YH3A 4YR9A 1QYDA 3FDJA 2PX4A 1X1QA 3QVWA 4PF1A 1UBOS 1I2CA 4X45A 4BKQA 2O2XA 1KYYA 3A04A 1UBKS 1ORHA 4G1VA 4JKOA 2GN4A 1TYBE 1DQPA 1VHQA 3MAAC 1QHIA 1SCUB 1KZHA 2UYHA 3PJEA 1T9KA 4BCBA 2V03A 3I01M 1FU8A 1OXBB 5GIPE 2YMLA 3OY2A 3DW3X 3OPNA 3BXPA 4II3A 4N0MA 5K0GA 4EARA 1M34A 1GG8A 4L07A 3M0EA 2IU4A 4MJXA 4DG5A 2NU9A 4QGSA 2CNOA 3BE8A 4LOLA 2EZ8A 3LYLA 2RAVA 1ZISA 1VPWA 2ZM6B 2ET6A 4MW6A 1E1RD 4N5MA 2A8YA 2GQ0A 4CM3A 1O5IA 3OKCA 4H16A 1QIJA 1NW8A 3NIBA 3VX4A 1VJGA 4E88A 4W99A 4D8VA 3UW1A 3EGDB 4BKRA 1UOOA 3PXGA 2OBXA 4L7VA 4JBLA 4N9WA 1CY4A 2IC5A 3AY6A 1AKQA 3TRKA 1EK2A 4LAFA 3ASZA 2ZAMA 2IOQA 2ZUSA 5KMGA 4MQ4A 1XA4A 3EMKA 3PL5A 1WBBA 1X7GA 5CVUA 1HPLA 3FCOA 3ZDYB 3LTNC 1UJ5A 1TECE 1DX4A 1U0RA 1DCMA 3S3TA 2H2WA 2D5BA 2F64A 3NNNA 5I4KA 2ATCA 4OK3A 2WHEA 3WHIA 1P75A 4HX9A 4Q9KA 3H1PA 1V1MB 2ZUFA 2J7PD 4AJPA 3W5JA 3U40A 2MDTA 1V5FA 2F1RA 4JJ8A 5LDGA 2UYYA 1BROA 3WL8A 3DULA 3LL7A 4HZGA 4Q47A 1J9EA 2VUIB 3TOXA 3EGWA 3HXKA 1QP4A 4U00A 1JDZA 1NXSA 1ZIDA 3D02A 2I3ZA 4RS3A 5H3CA 4P22A 4ZRNA 3WO0A 1RQLA 4FR2A 3QMMA 1H9AA 1R0KA 4DR4B 1Q5PA 3O74A 2DCUA 3QVGB 3AIMA 2EATA 2AXEA 5TPWB 2GZHA 1JT9A 1ZG3A 4BU1A 3N2EA 1C41A 1OXUA 2W83A 2X8BA 4M54A 1A50B 1ACLA 1L7AA 2IXEA 2X6RA 3OUTA 2Z6VA 3VJKA 3LFHA 4RGYA 3OTOB 3KUCA 2OHJA 2XKBA 4ND8B 4BEWA 4IUBS 1NULA 1XN1A 4RY8A 5BVGB 5IU6A 3BDVA 1MJGA 2WUVA 3DCJA 4KJXA 1JQJC 3NS7A 3OJWA 1Y5LA 1RW4A 3RC2A 5HKKD 3CXUA 5AXDA 3NASA 2Q6VA 2QQ5A 3RIEA 1NQAO 3ONNA 4KFRA 3CR3C 1MIHA 2H1RA 4MB6A 2LCIA 3B12A 3LPAA 4QIHA 1BA2A 4CBVA 3D6TB 3GRCA 1V26A 4FQ8A 3UENA 4NENB 2R6CA 1XIVA 3WISA 4AXBA 1IVNA 5KOJB 3ZDDA 4HNAB 2KMLA 3EVAA 3CSDA 3ZI4A 4WEQA 4ZCQA 4FLMA 4JR0A 3MQFA 3GP5A 3NV9A 1B00A 3L9XA 1AHHA 4NV0A 1IZYA 2X23A 2O2EA 5JLJA 2C2GA 3IA7A 4M1WA 4DL9A 3IQDB 1UPTA 3CKMA 3DJYA 1XQ1A 5K8JB 2YZGA 3JYNA 2Z8YM 5P8WA 1GQ2A 4MK4A 5TGZA 2R68A 2ZAYA 3LM8A 2XBMA 3U1VA 2QVXX 4JBNA 4P6VF 5J40A 3A1DA 4DDMA 1SKAA 4MR9B 1KVQA 1P3Y1 1SVNA 4NBKA 3NHZA 4CPDA 4C6TA 4FYVA 1IZ0A 3TTWA 2IKSA 2JFYA 3BXOA 4G4GA 3EC1A 4CQLB 2FSUA 1HFJA 3OSZA 1R66A 1OWMA 1SA0A 3BQNB 4KXLA 3INYA 4YAOA 3ETNA 2NPOA 3S1LA 4D4HA 5KC9A 4C2UA 2WHRA 5HIAA 2FNAA 2HNBA 2OBLA 1TU3A 1XQ6A 3HI6A 1P4RA 4KGXA 3CLRD 2NTNA 4MQEB 1T0BA 2PZJA 5ALDA 4AIIA 4V3BA 3T3OA 1CIVA 1RWXA 4AKTA 4X6XA 2HTFA 2QW0X 3EY9A 4H9GA 3C5WP 3O94A 1JKFA 2O1EA 3CQ9A 4KYIB 5AJTA 1CUSA 1T3ZA 4V0ME 1HZZA 5LZ7A 2IPOA 1CUFA 3Q9LA 5A1TA 1UMDA 1KOFA 2GXQA 3ML1A 2ZB3A 4JKYA 2ZUTA 1P0FA 2C9MA 3WP0A 3ZJUA 5A62A 3T1OA 1G4HA 2ISCA 1W1IA 1SK9A 5IAKA 4EYQA 2VYVA 1B3RA 4ZQCB 2CV1A 1NW3A 3RJ5A 4E2YA 3EVDA 3DA8A 3F97A 1YBFA 5DNDA 2QU7A 2B25A 2ZJAA 1IXZA 4P5DA 1DEKA 1NZDA 4D45A 8MHTA 4FCCA 4WW0A 1NY6A 2X0FA 4XEUA 3F0TA 2ZWOA 4FCTA 4HH0A 4L8WB 4AECA 2A6PA 1VI2A 4CM9D 2C5LA 3E3NA 1HY3A 1M6WA 1LK0A 1NOJA 2AWOA 2FMXA 1Q12A 1PWEA 2HGZA 1Y4SA 2HWWA 2PBRA 1J49A 3FVWA 3MB8A 4G2NA 4RIFA 3WVNA 2IV7A 4HVLA 1BVRA 3NWEA 2P4UA 2FW8A 3CISA 3KUUA 4URXR 3UBMA 4LGCA 1ADFA 1W0JD 4XA8A 5DZSA 3ZDCA 4S12A 1XROA 4YT2A 5ERYA 2P4EA 3RIGA 4Q24A 4J6EA 3B78A 5G53C 1W4ZA 4LVUA 4WFJA 4Q93A 1MLDA 5JWRA 3F2IA 5AM0A 3VNBA 4K9QA 4CG2A 2RBGA 4KQJA 4DYVA 5ELMA 5LA6B 2MSDB 4EKYA 3PEYA 1FX0A 2QD1A 3FNGA 3MRSA 1CUDA 5A9SB 4PG5A 4X3PA 3VPBA 3Q41A 3O47A 4I81A 3PPXA 1Z28A 3FMFA 2WP8J 1CU1A 3ZU6A 1UQTA 2H65A 2PRKA 1AGNA 4AX8A 4PSKA 2NM0A 1LS1A 2WC1A 3V1TC 1Z2CA 4CEJA 3HYSA 2VP5A 1ONSA 1P2GA 3HE3A 4IYRA 1SOVA 2WILA 1L4MA 3MWGA 4ARCA 2ORVA 1N2BA 1ZITA 1GFZA 3LC2O 3DE0X 1YR9A 5AHOA 1MW9X 4TXJA 4JOSA 1SOUA 1NPTO 2HT6A 5HM8A 2FYTA 3R09A 4DCOA 3PPIA 3NWOA 3BB1A 4K9NA 5J2UB 3CVOA 3HY4A 5KQGA 2ISSD 3KTAB 5HFAA 4WNIA 3VDRA 4FFSA 2WM3A 2P9YA 2RGNA 4KUGA 2CE2X 1T2AA 5D1NA 5D3ZA 2K2QB 3QOYA 1YB1A 4AZ0B 1AV6A 1QB7A 1XLWA 3HJCA 3NFRA 4JBWA 1IN8A 2ORIA 2V6FA 4G81A 2SCUB 1UBGA 2ZBDA 3WXBA 4FYMA 1QS0B 1XMOB 3G0CA 1I10A 2WM2A 4LTNA 2XTZA 5FFFA 4TKVB 4ZVVA 2MIIA 2VP4A 1EINA 1TX4B 3IQHX 3M1YA 4PYRA 4QBHA 1X13A 1G3RA 2HIMA 3EIQA 4LYFA 3HGMA 4Q4AB 1TEXA 3FAKA 1KEVA 2H4XA 3G89A 5BN3B 2XKKA 3SU8A 1P9OA 4HLDA 2WYUA 1E2HA 4J7XA 4HT3B 2R62A 3A14A 2DT5A 2PX8A 3TFQA 1ODSA 3RWMB 2QUAA 2YOFA 1C3OA 4EFLA 3AY7A 4HMQA 4GMXA 4KMRA 4BB0A 1F9AA 1Q1ZA 5FTKA 1W29A 4ESOA 1Z63A 3IURA 4MLDA 4RC9A 1J1IA 2BJVA 3M9WA 4ML3A 5LD2C 2BEUB 3GOHA 3HNOA 1XL0A 4MUFA 5I45A 4JROA 1CWUA 1EDZA 1G8YA 3UK2A 1UDWA 4LF8B 3D5QA 2MSLA 2NSDA 3ITKA 4LRXA 1JDVA 3JQ8B 2BHNA 4HB4A 1GA4A 3BMCB 2HIAA 2REXB 1P6QA 3O8BA 2HK8A 4D98A 5JANA 4YY3B 4DUGA 2AKEA 3CRZA 3K92A 2J6BA 5JC8A 1VE7A 3FIJA 5LXTB 3ZGZA 2QGNA 3AF2A 3C16C 4H27A 5K45A 3G8BA 4WZ6A 4CR8A 2NP6A 2WT9A 3GJXC 1CF2O 1RE0A 3LFTA 1F2DA 1TF5A 1WSBA 4HG2A 2FGJA 3GZJA 3SM3A 1U6IA 2HWKA 4MNTA 1FJ2A 2C9ZA 1IB0A 3W6NA 2WPDA 1XLTA 3BL6A 3NIDB 1NBIA 4HSGA 4YJGA 3KQYA 4PV7A 3KQQA 3VNSA 4MO2A 5CLQA 3EEYA 4JIMA 3VR2A 1H66A 1WSDA 2MOKA 3ESYA 1Z0ZA 4PSAA 2GBLC 1TADA 1MAVA 3DMTC 4JVNA 3WLRA 2XVZA 3VI3B 2R97A 2F4VB 4WNAA 5EMMA 4CEHA 4MS3B 5ALFA 1XYVA 4UNRA 2ATXA 3S29A 3U4DA 4Q82A 1N9GB 3NDRA 5LYJA 3NHPA 5I7AA 4XWTA 1GG2A 1HT3A 2HJVA 2JFNA 2V97A 2XUGA 3ECAA 3OIGA 4UAJA 4JFRA 2ODWA 5ECDA 3RC3A 1IQRA 3D7LA 1FFYA 1NONA 2V7PA 2WD7B 3G6WA 4RV4A 5KMGB 1Q7GA 1TCUA 4L15A 5AD1A 1SQSA 4WH0A 1V1MA 4DGQA 2IVFA 5FQOA 2EBWA 3RAEC 3R41A 4ZO8A 1SOAA 1E0JA 1DRUA 3D1LA 3Q3EA 1W36C 2QL5A 1GRNA 2JLRA 4MWDA 4RK0A 5KKAA 1E20A 4X1YA 3BUSA 3DOHA 4D9BA 2REQB 1XNGA 5HUHA 4B6EA 3OQHA 4ZV7A 2VPZA 4ZK6A 3JZIA 2WZBA 4KLZA 4WGGA 3UAYA 1UJMA 1ULZA 2L82A 2PBLA 2QVGA 1LBSA 2Z2XA 4IFTA 5KJCA 1FDVA 2R3SA 2R7KA 2H8GA 1BCSA 2XYVA 3LX4A 3ZIAD 3JRXA 4REMA 4MGIR 2YWCA 4W5NA 1U81A 3QMVA 2JGNA 3IDZA 5TMEA 1LBEA 4TS4A 2WG0A 4BAZA 2NO5A 2HMSA 4HCJA 3TQRA 1VL5A 2F1JA 4KDFA 5ER6A 3A26A 2C1XA 1T43A 4MVJA 4G8DA 5EIBD 1KI4A 2YN0A 5GM2A 3J80A 1FMLA 1O6FA 1U6KA 1XALA 1YQQA 3AXTA 2BDTA 4QFMA 2BL4A 3ER6A 3A28A 3B53X 4WNAB 5LQDA 4OI1A 4P0QB 4GUDA 5KYWB 4CHTA 2CBZA 1ZGAA 4NK5A 5GJBA 1K8QA 4F9FA 3D7NA 4F3CA 2OXRA 1UDRA 1P60A 3RVSA 5IVPA 3KPYA 2R11A 3H6GA 5DT2A 5M2QA 1F2UB 1G6KA 2AN5A 2IYRA 1BJTA 4LJLA 4XGRA 4TZTA 4R1UA 1RQ2A 2PRYA 2BDEA 4ZYLA 3N8HA 4GL2A 1PEDA 4OUDB 3RYCA 1T6BY 5JJCA 1UEIA 1TMYA 3BD6A 1N0VC 4B3RB 5BR4A 2PHZA 5JXIA 1U3CA 5AKKA 3X1WA 4RMNA 1TM2A 2QD3A 1YOVB 5KNBH 3FPEA 2H5JA 2ZI5A 3GFPA 1R5OA 3G9ZA 3M6LA 4QVKA 3CBQA 4UNQA 3DEAA 3T4UA 3THYB 3SJUA 1QGZA 1P17A 4EJ0A 3RRMA 1KSHA 4BNHA 3ZWCA 1QP8A 3RU7A 4L8LA 2XIJA 1MG0A 3G17A 2V7WA 5IMSA 5AI4A 4ERXA 2HF7A 4K6KA 3DEHA 3EQZA 3C6YA 3G8CA 3SHFA 5I9LA 2I3DA 3OT5A 1YQUA 5EERA 1FRVA 1EFHA 1VGQA 4K40A 4EWLA 3KEFA 1DQZA 4BP9A 3A05A 1E61A 1VL8A 5TE9A 2XE4A 3MJCA 3ABZA 3H16A 3GBSA 1BTOA 1QMGA 4DE5A 1OPXA 1U5AA 1WEKA 5J5AA 3GAMA 1FSFA 5I7FA 2FVYA 4J16A 1OBHA 2KS6A 1I2BA 3NVAA 3P26A 2P5SA 3R0ZA 2EX4A 1N2GA 3LJKA 1MD9A 1YACA 2NWQA 1QHHB 2IYYA 2C5FA 5T3YA 5BUQA 1HDGO 1ZBQA 4RQUA 3ZDEA 4RHXA 2VK2A 1THMA 1NYLA 2NZYA 3KXDA 1DWPA 2CFSA 4TL7A 1NBOA 2Z6UA 1XTIA 2B69A 2VHTA 4B33A 2PSSA 4IMPA 3A1WA 3R0VA 1ODIA 5TGDA 3ZUGA 2NYRA 6ADHA 2EG9A 4A10A 1OB2A 4UD6A 2HJHA 1OLXB 2FW7A 1BX1A 2R65A 3IEVA 1MUUA 1O87A 3UN1A 4DIEA 1VL1A 5LA6F 5F9HA 2F62A 1H2XA 1YFZA 3UH0A 3LD9A 4MVJH 1NQUA 1XTQA 3S55A 3ZD8A 2NOAA 3B89A 3QOFA 4WA8A 3VR4H 4B1FA 2VT6A 3D64A 1UH5A 3A4MA 4JEIA 3UHPA 2QLJA 1J0AA 4CMBA 3FJ1A 4LTDA 4BMYA 4F3YA 1DAFA 5M29A 3TTXA 1E2UA 4QATA 2PGDA 1BJRE 3OC6A 1V39A 2BMWA 2MR6A 2ONZA 2QQFA 3EQ7A 3H42B 2AG8A 4Q39A 4F8EA 1SUWA 3Q40A 4GNKA 4TTRA 5FNVF 3FROA 1Z5NA 2X9LA 2ZYWX 1TUIA 3DHVA 3P8ZA 4KIJA 4CU5A 2NU7A 3R5KA 5F2KA 4BMPB 2C4NA 4HN2A 2K2WA 4PZ9A 4M1ZA 3VDXA 3R2JA 1SU6A 3LC1O 4H35A 4MYTA 4TVOA 4GYYA 5LBIA 1R6AA 5A6SB 2Z30A 1R6XA 3THXA 2P9EA 3QUSA 4U8GA 5C34B 3P32A 2FDRA 4EGJA 1Y3CE 1FUKA 2H5EA 1R4ZA 4P98A 4TVSA 2NXNA 1ZMOA 3ZGOA 3GDHA 2JVJA 2XXAA 1D4ZA 4DJDC 5JNWA 5GJWC 2Q4DA 4QPNA 3MYYA 1YFLA 2C58A 5KJ6A 4QGHA 1SXJC 2FE1A 5THXA 1RS0A 1SK8A 5DNWA 3WL5A 1JN0A 1T9DA 2WKRA 1Z6ZA 1W30A 5IDWA 1O95C 2W6NA 5LP1A 1FTYA 2WUDA 2CD7A 3JWHA 4GBGA 4LJRA 2HJSA 4OJYA 3KSUA 2JGAA 5K8IA 2VHYA 1KFBB 1F3LA 4OM7A 2WABA 2QJRA 4DCMA 4J1TC 2G67A 1ZIPA 4W6ZA 4P7GA 3HKDA 4EJ6A 5C3MA 4J4HA 1DHTA 1LUAA 1YO6A 2ZT8A 1ABEA 1HOTA 5JS2A 1KPHA 1GFIA 1R5JA 2HQSA 4PPNA 3P97A 1UCFA 2R66A 1HTBA 4PO1A 1KAQA 2XWBF 1PT8A 1GHTA 3BJRA 4WVFA 5AHWA 3W5VA 3QX7A 4PRZA 4XJSA 1EK5A 3L1HA 3P5BA 3UV7A 3IVGA 3D6HA 3WK5A 3FGZA 2C4TA 3KHUA 3NBUA 4MIEA 3NO4A 4IX1A 4QQKA 3P71T 4KEAA 3NGMA 2VIIA 3WL6A 2IYFA 2PU5A 3T34A 4DFDA 1JEYA 2PNJA 2O5EA 2FEOA 2J7KA 2GN2A 3LSYA 2W2MA 5MN6A 4DWOA 4YXWA 1PRYA 4J0FA 3KAJA 5JYDA 2W4QA 2EF0A 3RRZA 4IIJA 4QTZA 5KYNA 4DIMA 1E79A 1XQYA 3V2UA 3BJIC 2VG8A 2PS1A 1T6ZA 1UBFA 4PZUA 3TE6A 3IVCA 3NOQA 4HYEA 3PNPA 3MOIA 4C3UA 3K09C 1NMXA 2VLIA 2WAYA 3NJ8A 3GC6A 4G8CA 4TMZA 2HBRA 2CZGA 5IEBA 5C52B 4R68A 2P4SA 3HUTA 5B12A 5C1PA 4OMDA 1DDOA 2NLOA 1LNZA 1RRVA 4RNDB 3V48A 4E5DA 2ERYA 2O8DA 4IJWA 4B6GA 2OXTA 3MC1A 2W11A 2JFVA 4ZXFA 3EFHA 3D9QX 4I5IA 3TFWA 3KEQA 4QU5A 1A04A 2PVPA 4G24A 1X8XA 1RZUA 1VPDA 5EHIA 1S2LA 4TKUB 2VJYA 3W5AA 1DG9A 3BMQB 1YC2A 1Y33E 2BI4A 4XQ9A 3WXMA 1W49A 1VL2A 1KE2A 1RYMA 5A5DA 3F3SA 4AU1A 5IXSA 3OJFA 2REBA 4ZT2A 3SVTA 2J1LA 2UZIR 2PUHA 2X19A 2IUTA 2BBWA 4LI3X 1MAWA 4ZJPA 2HA6A 5AW0A 4RTSA 3G2QA 2V7VA 4N7JA 3ICVA 2I1WA 1YB2A 3OJLA 4MVWA 3BPSA 4Y9UA 1LLQA 2X3UA 3WBFA 1OXMA 2DVMA 4X00A 2CL6X 5DEIA 4UCFA 1IDN1 4ROTA 1J8FA 4UD2A 4B47A 3M89A 4G37A 4ESHA 3SEAA 5DM1A 3U4AA 5F76A 1JT2A 1YNSA 3K5PA 4YAEA 1U4SA 5DX0A 2QSZA 3GA0A 2F8LA 2YJZA 4UCXA 4Y2GA 2UXBB 2Q5EA 2V9PA 3AG6A 1FU7A 3KSDO 3OO1A 3W9BA 4DABA 1VGVA 2R96A 3ABOB 1ZY2A 2GBCA 1YDWA 5E6RB 4D44A 5E1DA 2HQRA 1WEHA 1ULBA 4M88A 3JD2A 1Z2AA 1USVA 2AR7A 5B4TA 3QKRA 1SEPA 1W85B 3N0XA 3ZWAA 4ZWNA 3P2KA 5FOVA 3HUEA 1U1DA 3DNFA 3EBLA 2Z1NA 3MLAA 4JZYA 4B75A 4GX5A 1MIOB 3K70C 2O3QA 1YZQA 2FOXA 2J9RA 1L5GB 2ZBRA 3MILA 1KXZA 3TQHA 3UUFA 3KCQA 2B1RA 4NZPA 4PCVA 2A0YA 2AHRA 1CK4A 3FSRA 3R4CA 4YQEA 3DBIA 4KWHA 2OA0A 4AKEA 2JA2A 2HNKA 2VHJA 4EUHA 3TQSA 3O38A 1NM5C 3PGLA 3GVXA 4RY2A 5A9TA 1BNCA 3DAPA 4Z1MA 2WJIA 1CVIA 2LPMA 2WT8A 3LG2A 4MRNA 2VP0A 4UPVA 1DCFA 4HB0A 2X8AA 3TLGB 3X1YA 1KRWA 4EX6A 3T4EA 4IMIB 3O82A 1SIWA 3NCTA 3JWIA 1S2GA 1XVAA 1TUBB 3K9CA 3SZOA 4LWZA 2R8OA 2XYPA 3IQIX 4M37A 4TYQA 3VNAA 3W2IA 3OZ7A 1YB6A 4BVAA 3OJXA 3LF1A 3N87A 5AK3A 1X7HA 1XJCA 2WMNB 1THZA 4KXVA 4BZWA 3QF4B 1IWOA 5SZJA 1QK5A 3AGPA 3MUEA 1FTQA 2QLFA 4FFLA 4X90A 5HDBB 2VNHA 4I14A 4WMLA 4DEYA 5KTTA 3TFOA 2WJJA 3H2JA 1O97D 4HGZA 3B13B 1QOPB 3CZ4A 4WJLA 1BRMA 2Y2VA 3NYIA 3FOWA 4KGVA 3K9WA 4XR4A 1EE2A 2H2HA 1U2RA 2OHIA 2DY0A 1DC6A 5B57C 2FY8A 4PINA 4BGEA 3CURA 4BTEA 4CMAA 2PH7A 4F2WA 2GS9A 3OPQA 4V0RA 1PEKE 4D9KA 3C5CA 3SFTA 1HNNA 3PQCA 3EYWA 4FFWA 1NASA 4ZQFA 5C8YA 3VZPA 5CAEA 4RSGA 1D2NA 4L6CA 2O7SA 1HDCA 1KGSA 2JFQA 5JTTA 3ADPA 1XKTA 1GTL1 3PFIA 3HB7A 4DSZA 2AW5A 1KZGB 5AI9A 1UP4A 1E9RA 4Z9FA 3NWJA 4B85A 4U8HA 1XHLA 3DCNA 1MBZA 1NXTA 2J5XA 2QVCA 2XCQA 1P31A 1ZNQO 2VEDA 3A3YA 3HR4A 3L07A 3LPDA 4JLJA 3ZHSA 4AJOA 2SHKA 1LQ2A 2G06A 4F84A 1XDGA 4PAOA 4RVUA 4UHJA 1R5BA 3O8QA 2OZLB 4X1KB 4NS4A 5HFJA 3ECCA 5EJAA 5IZCC 3B9RA 1JR3D 4G4SP 1G8FA 5CXUA 3D0RA 4K9LA 4HQ0A 3TOZA 3ZZ0A 3RK0A 3VVBA 1HG1A 1VMDA 2J0EA 4GOXA 5JNTA 2NV0A 4FFVA 2CVQA 4TV8F 4JJIA 3LUCA 4NNOA 2M9MA 4E11A 1KPGA 3AFMA 3OZRA 4ITRC 4X97A 4E09A 4S0XA 1W75A 3QKSA 5FI0B 2NXCA 3S6JA 4CGZA 3Q8KA 1IPEA 5KINB 1FZTA 4Z4HA 1QHYA 2BWJA 3D0QA 5HRAA 2FZ5A 1DJOA 3K1TA 3OTHA 4R51A 2AD1A 2V0CA 1QCDA 3WNZA 2JHFA 4JEHA 3WB9A 5C4IA 2JD2A 4B0PA 3ZHUA 1IHXA 4FOTA 4M1SA 2ZUVA 4XUCA 1N0WA 3KR1A 1TLFA 4A8JC 1ZD3A 1TM5E 2AXQA 2HCJB 5DNEA 1A7JA 5I8ZA 4KXXA 3G2PA 4CM8A 1DG1G 5JH7A 3FM9A 5GONF 3VKWA 1EVIA 2CNBA 3KTDA 3KKOA 4IDQA 3ZYCA 3HBNA 4Q7LA 5EHXA 1Z45A 3IKVA 3JAWB 4Q66C 1KMHB 5E9AA 4AZSA 1UXJA 4LRYA 5IC6A 4DNFA 4IXMA 3IL2A 3KLPX 2FP3A 4Q18A 4ZTUB 3WLPA 1Z4JA 2HMUA 1TYDE 1KYQA 3CPEA 4UBOA 1R10A 1DE0A 2GPBA 4IJMA 3KQPA 5GOTA 3TRHA 2CUZA 3QKUA 5CCDA 2FPGB 1GNTA 2ZIZA 4HBZA 2B35A 1X7ZA 2Q6IA 5H82A 1CVLA 4YIHA 1E1CA 1UFQA 3KKNA 1DRKA 5JSFA 2EBFX 2HXSA 2H3HA 1SGWA 3DBRB 2XOKD 4I8XA 2QTLA 5KWEA 5EJ8A 1N2CB 1AKWA 5BW5A 2VK1A 2PD6A 5EJ2A 4W9NA 1H4VB 2XMRA 3KYIB 1DNPA 2IEDA 3X2SA 4EEZA 1YRYE 1JHOA 2NAFA 3MERA 5KB3A 2OLEA 4M1QA 5AW3A 3PDIA 4ACBA 2ZQZA 3O4VA 5K01A 3DKKA 3RG8A 1NI4B 4G0WA 2CHQA 1GAXA 4MEJA 2F43A 1CRQA 4NMLA 1DLJA 2BPOA 3AEYA 3FG9A 3RVOA 2CV0A 2VRWA 2KX7A 1HSOA 4BFCA 1W2HA 4IX9A 1I6KA 1NVXQ 2XRFA 4JVSB 1Y3IA 5JIBA 3MBIA 3E82A 4CDMA 5L51A 1JDBB 1YVRA 3N05A 4LOKA 2VOJA 4OOEA 3DQQA 3LCMA 1R37A 3EH1A 4KQGA 4N40A 5EWMB 3RBAA 3ZWQA 4BEJA 5B3JC 5C5DA 5KSOA 5KWSA 2CV2A 3QEKA 1PZMA 4DOMA 1Q19A 4DQDA 5KNLA 5C5IA 1X1CA 3PDHA 4WBSA 3OQNA 3NVDA 1D2CA 1RXCA 3D6MA 3FLEA 5T5QA 1XD8A 3AERB 2JH8A 3QF7A 4EPYA 2YV1A 3Q6IA 4E15A 3EOZA 1J1UA 4PSCA 1EUCA 1I80A 3HU2A 2VFAA 5KTSA 1BCRB 3E5HA 4L4YA 3TOCA 5JR3A 4BEBA 7AT1A 2GEVA 3WNBA 5L7YA 5U4XA 3FUWA 2WIDA 4HJRA 3BTSA 1M10A 3I6MA 4N5LA 6YASA 2I7XA 1GN9A 1PJSA 3ASVA 2GWHA 1PDVA 3ISVA 4MVJI 3T54A 4EO7A 5JRZA 3K9GA 4YONB 4ALLA 3LPLA 3FCSB 4MWEA 3TTYA 3ND7A 1KS2A 4CLOB 3TZKA 2Q1UA 1QRTA 1YJXA 3FMGA 3NC1C 2VDVE 3PHGA 1N8KA 4XSHA 1SURA 4RTRA 5KQSA 2P7IA 4W9MC 1LDBA 3KB6A 4NNJA 3IXLA 5EPUA 3ZWDA 2NYAA 4CGYA 1OLUB 2PNFA 3O03A 4ANFA 3FMPB 3LLUA 1TK9A 1JW9B 2WF6A 1P1FA 2J5RA 5I51A 1UOQA 4BHTA 3TSOA 2YOHA 5DLQC 1T4DA 5FL7A 2FCAA 1TW3A 4WOPA 1HE3A 3FSGA 3RV3A 3GAFA 4Q34A 1ZCZA 2H1CA 2X5JO 1H8ED 3L6OO 3TMKA 2BR3A 4IXTA 4QPCA 5JNLA 4R1OA 3FOCA 2I6GA 3I6YA 4R71A 3R5FA 1RKBA 1IZZA 1V3QE 4RA6A 5EE3A 4EKEA 5IAAA 2GVNA 3DTVD 1SD2A 3FDZA 1F9EA 1A5TA 2Q6TA 3ZGVA 1VL6A 2I66A 2GCIA 2X40A 1D5CA 1ULSA 2QE7A 2BKUA 1PUJA 3LV8A 4TMWA 3RO7A 4P86A 3RDPA 4EBFA 5LQRA 3V3TA 2GLUA 3ENQA 1MT0A 4YCJA 1LTQA 4R1SA 4WWHA 4A5OA 3JVIA 3JWEA 4UMFA 3GW8A 1CNMA 2G9RA 1K2WA 3L1VA 4TL6A 2YBDA 3PPYA 5EKDA 5SY6A 3NH9A 1KYXA 4DA4A 4OP3A 2WOJA 4Y18A 4BB5A 4CFSA 5E2BA 5L3ZA 4J7UA 3IT0A 2A14A 1C7FA 4QA9A 4D56A 3S8MA 4QFDA 1AXRA 2Z04A 4BBJA 2JFGA 2J4FA 3WYBA 3SHVA 3CX4A 3HWWA 2Q7XA 3PT5A 4TYWA 1GPDG 1RYBA 2G5PA 2P9BA 5E4TA 1SG9A 4PLZA 4XLLA 3WP1B 4AUMA 4QG7A 1BVHA 1UAYA 1Q1EA 4Q4HB 2C3MA 2CLHB 4PM4A 2QRVB 1WKVA 5COBA 4ZAFA 4HVAA 5KDLA 1E1QD 1WY7A 4JI1B 4OP1A 1RJDA 1MR3F 1XRJA 2EFJA 5HQ3B 1NXPA 3WHKA 1XMXA 3HKBA 3MPOA 4CN9A 1LXCA 1XE3A 3PWTA 2IS4A 3D1JA 1L4KA 2OC9A 1I32A 3VO9A 4DHEA 5A3QA 3L0SA 4TTJA 4HWPA 1TUBA 3K2QA 3KJZA 4ZMSA 2QEQA 2MCFA 3SF0A 4HTFA 1XCBA 1QGYA 1R16A 4OQEA 5BSTA 5CDFE 3I5UA 3JQFC 5KSPA 4Q1AA 4I1RA 1RJWA 3ZZUA 2Y4OA 3G7SA 3JD3A 4FEEA 4L0QA 1WXDA 1XWFA 2BJWA 2HLDA 1QVRA 3CLUC 4PTLA 2P2NA 4QNMA 4ZU1X 5TVKA 2D1FA 3U7JA 3ZDRA 1YHNA 1TAQA 4H1HA 3QU7A 2PJZA 3AJEA 2WAAA 3G49A 1TEZA 2IUYA 2CL7X 4K0KB 2QTRA 2I9PA 2VNAA 2ZQ5A 4XGIA 5D5PA 1K8ZB 5KSWB 1EBFA 1H2FA 1SD5A 2JGKA 5HRUA 3PYMA 2QMOA 1Y1PA 3FBWA 3B7PA 4F06A 3E1SA 3F3YA 3DVAB 1YKGA 1E8MA 3P0RA 1LFAA 4J0KA 3FNBA 4J0HA 3TX6A 3RC1A 3BGDA 4E5NA 2O4CA 4CW7A 2P5YA 1YFKA 5BNIA 2Q49A 2G0TA 3LYHA 4NU5A 2WAOA 1F20A 1OA1A 4XOUA 5CHYA 1Z34A 2WIJA 2JAUA 5F52A 5BURA 1V9CA 1ZJ4A 3H0EA 1I2AA 1XP5A 2Y92A 2NZ2A 3OEWA 5K3OA 2H4ZA 2YNMC 1MX9A 1TFRA 1H2AS 1NYQA 2WG2A 1GLGA 3ELBA 3HCCA 3LNCA 4WY2A 4BLPA 3W5BA 1E5LA 3DE6X 3PA6A 5CMLA 5AVSA 2ZATA 2MINB 2V6MA 2VTVA 1ZN2A 2WZCA 3KKMA 4RSRA 3ZHOA 3AR5A 4C87A 2R7NA 1UJBA 3CLVA 4JKIA 4DTCA 3DZFA 1IE3A 5F2EA 5DTIA 5AIBA 5AJHA 2B2NA 3BKWA 2I4MA 5K2MA 1A7UA 3HCDA 1FDTA 2QTVA 3H99A 3EAQA 1P2BA 5EMNA 1N5KA 3SZLA 3T1NA 2BV3A 3WYNA 4A0RA 4CUKA 3HWX1 3EXHC 5LQJA 7ABPA 1KK3A 4UHFA 1UXGA 2N3ZA 4D3SA 2A57A 4R31A 1YS4A 1R6DA 2P9ZA 1F1BA 3F5FA 3P4UA 1I7LA 1R8YA 2CXXA 2G6BA 1UDAA 4MV9A 3NHAA 5D7NA 1FYFA 2OV1A 4RXMA 1TT5B 2R6GA 1XKQA 2R25B 1CQXA 3DLTA 4H6WA 3EE6A 3TSCA 4CQNA 1JIUA 2A9QA 2C0PA 3GLFE 1DT3A 2VUHB 2JIZA 4Y9RA 3OOSA 1JLLB 1Q50A 3I83A 5G1OA 2Q62A 5CEJA 4EF5A 3V4VB 4XTCS 3SX2A 1L5FA 3L0OA 5TXGA 5A6VA 4GR4A 1U9IA 2ZCUA 3E5MA 2EGHA 3INNA 2C2ZA 3FVQA 3W6PA 2W0MA 4BP1A 1YJCA 1ADBA 3KR9A 3TO5A 3WI7A 4AJJA 1PQWA 3CBGA 1AA6A 3IUQA 3D7RA 3W3AH 1KQPA 5C7IO 1TQ8A 4RXUA 2H08A 5DWQA 5FWDA 1D6MA 5FUWA 1MOPA 4F71A 4HGYA 1ULTA 5CH5A 3NONA 4E5KA 1OAKA 1TQ4A 4YMVA 1FXSA 3VQTA 1RIFA 4LV6A 3HP1A 4IXNA 2WDPA 3QUAA 5JH7F 5DNUA 4KX3A 2DECA 2B34A 5AI5A 4BIIA 3H2HA 3KT6A 3D3JA 3Q0TA 5EA2A 1HE8B 1Y9DA 4MW0A 5J2TF 3U17A 4BVGA 3PE4A 2WNHA 2F8MA 5ECGC 5FR2A 5BMVA 2HU2A 1G9TA 2V58A 1KH3A 1ODCA 4JI5B 3TS1A 2GHRA 1MFPA 2DWCA 3OLWA 2R6ZA 1BXGB 4G5SA 3QPAA 1QAQA 1V7CA 1ZU5A 2DBQA 2QLMA 2Q3HA 1YUBA 3GRRA 3JAWA 5DPMA 3BF7A 4PN7A 2GEDA 2J5BA 5JATA 3UWMA 3PC4A 3HEMA 1AQLA 2W48A 1XVLA 2KQUA 5TT1A 4DZTA 3LCUA 4NCBA 2GPYA 3RG2A 5G3YA 2CL5A 3TW4A 1OGIA 2PUFA 1OXXK 3ETHA 1RI3A 4QEZA 3LMKA 2P90A 4TUYA 2I7CA 3PWZA 3ZOKA 4HVCA 1HTWA 3P5SA 2AEEA 2B99A 4ISBA 1QWSA 3RWOA 2R1TA 4B79A 3DE1X 4GI1A 4EFMA 1IHUA 1YU9A 2EHDA 4IOKA 5CUQA 3FNHA 4YFYA 3IPCA 4FEYA 1TQHA 1Z5VA 3M9XA 4EFKA 2TMKA 2Z3ZA 1C4OA 4CQLA 5D86A 1QH0A 2HCTA 4V0SA 4ZA2A 3HN6A 1XTSA 3ITDA 1P7PA 3BAFA 1JIQA 1WZ2A 2H5LA 3T1HB 1H4TA 3A4NA 3FXAA 2ODPA 1QQBA 1BKSB 5K8TA 3JQ7B 1MAHA 5DWDA 2EX0A 2H6EA 5JZ9A 1XCJA 3GIDA 2FZKA 4U7HA 2VDRB 2D5LA 4KPUA 4PG7A 4G65A 4RZXA 2F43B 1OZAA 1ECPA 3H13A 4ZO4A 5EY5B 5LZ4A 3PEEA 2BE7A 1BYUA 2GILA 1S02A 2PX0A 1MOSA 2QP3A 4X1KA 2ZIUB 1MXFA 1UDCA 2I8AA 3B6JA 3AETB 1FQOA 4LE1A 4XCQA 5KVCA 2OBNA 1CDEA 1J4AA 1KJJA 4ROSA 2QVBA 1X2BA 5MFZA 2DKFA 1R4AA 1M1YA 2JAPA 2O0JA 2JAHA 3AUYA 1X7XA 3PR2B 3TAHA 4MQFA 1LNQA 4WHMA 1U7UA 3FYDA 3Q3CA 4QBTA 4TTQA 1HKUA 1E7WA 3JQGA 3I23A 4HDQB 4YWHA 4LBWA 4NXMB 1BH2A 4QXQA 4UUOA 4G23A 2FSGA 2A59A 4GPEA 2EYUA 2IF0A 5MGBA 4LDJA 5JQGA 1EFRA 1RLOA 2ODEA 1E7MA 3KYBA 1JSCA 5DASA 5ENDA 2OYRA 1NFRA 3QMPA 4EKDA 1QO9A 5TPZA 4EA7A 2BM9A 3IUNA 3KV1A 1PSZA 5K3FB 1MDFA 2FW6A 3KR0A 3ZBTA 1IRXA 2BFBA 3WR5A 4G36A 3CF0A 2CVHA 4HGNA 5BSMA 5A5FA 3INRA 4QVIA 1INLA 4JLUA 3HPRA 3LUPA 4N5HX 4EQZA 3E3MA 1ZN7A 5CT8A 4ZT3A 4LWQA 3PFKA 1T34A 2RHWA 3ZLUA 4JVOA 3ANLA 4TOIA 4UDNA 1I94B 2HL6A 4V03A 1P6XA 1EBBA 3I2YX 3VU3A 2X3FA 4Y30A 4GM1A 5DHTA 3SX4A 1JR3A 3G0HA 1T29A 1O9BA 4HAIA 1NN0A 4MO9A 3HJBA 4OQNA 1CUVA 1KI7A 1T8PA 3I76A 1H9CA 9ATCA 4WJZA 4Z1MD 3WFJA 1I3MA 2XR1A 5CVCA 1A4UA 3B1VA 4INAA 4ZC8A 1IAVA 1YRLA 4RK1A 4AZTA 5JDIC 3HVUA 2MMGA 2YINC 4BLOA 4NJEA 3REFA 3GDWA 4B40A 3CUSA 4ZMRA 3TD2A 2B30A 3K94A 4L22A 1KFCB 2NO9A 4I4LA 2QL6A 3W90A 2C4MA 4UTXA 1N5OX 1QU2A 2OV2A 1Z35A 1B93A 1HYHA 1WULS 3DTNA 3E9DA 1H6DA 4N82A 4UZEA 2PQ0A 1PO7A 4CM4B 1E9EA 5EIEA 3PV0A 5K20A 3ROXA 4BN5A 2YFQA 4ZCTA 4DADA 1P9LA 3OEHA 3I73A 2CLEB 4L27A 5HKOA 3R40A 2B20A 1TTHA 2DFVA 2G70A 2R8ZA 3WL4A 4MMXB 5AKGA 3WTCA 2IXAA 3IT3A 2QRUA 1SKYB 3K1YA 1CT9A 4CKBA 1LX7A 2VHQA 1K86A 1PT6A 4YT8A 3IB6A 1RAIA 4F4UA 4C4AA 4DCSA 2IZOA 3B6ZA 4ZO6A 4F6RB 1JSRA 1T6XA 2WA1A 4EW3A 2IBTA 5F5NA 2BZSA 1S9DA 1A69A 1O4VA 4LGMA 1QO7A 3NM6B 2JIZD 4XWGA 1LY1A 3L92A 1QRUA 1RVDA 2Z4SA 4CM7A 1P29A 1WB6A 3OLZA 2L19A 2YX1A 3FF4A 1FMCA 2ZUCA 5LCXA 4FXPA 4E5YA 4O5OA 5IK2D 1E63A 5KNDD 3IBYA 1QRDA 4IGAA 3TIFA 1P2VA 4HAYA 3LTEA 3MJ4A 4G85A 1C0PA 5DYIA 3O8CA 3A27A 1H1TA 1DKMA 2A5LA 1PV1A 2BMDA 2VA9A 4QFBA 3X1KA 3AVUA 5FNZA 4Q9HA 1Z7YA 4TWZA 3WRXA 2ZDHA 5LU8A 1G5TA 1NUQA 2Q07A 3H75A 1LKZA 3KBOA 4EVIA 3UHJA 2X4DA 3K9LA 3CLTD 4XDYA 2R7LA 3KZOA 3QOWA 1KYWA 3D81A 5CXXA 3FPJA 4YALA 5EJFA 2A1UB 2VPYA 2MYUA 2FG7C 1XDUA 1J7JA 3ID6C 1L7PA 3M4XA 5FBRB 4JB0A 4WZAA 3WKCA 5BR1A 3BE6A 2WY2D 1DOAA 2H1IA 4Q3BA 1RLTA 2XUKA 2ESRA 4RCZA 1CD5A 2GK6A 4YT4A 1XXLA 3GYBA 3LO8A 4IO0A 1QGUB 2VCEA 4N03A 3ZWXA 5LLTA 3S99A 1IQ0A 2V6GA 5JD3A 4F5WA 4Z6KA 5MDHA 4LXTA 3JU3A 3M1IA 1KO7A 2PD4A 1MTOA 2G72A 2IP1A 4M1EA 3JQRA 3IBCA 1NX6A 1GQSA 2Y1FA 4PFSA 3BZUA 4ZICA 3PXEA 3AVWA 1JHDA 2IEAA 3UYLA 1CUGA 2QLLA 3CUTA 1JLLA 2PN1A 3RS8A 1RLIA 4XM1A 1NFQA 2OHGA 5IULC 2Q4EA 4OA5A 3IERA 4Z4GA 5A2GA 1DWOA 2CEAA 2Q8NA 1XXHA 3MWKA 3H5WA 3SBEA 3F47A 3U3RA 3WGZA 1IJKA 1Z5WA 1PL7A 1U2DA 3LA6A 4Q9JA 3UK6A 1XD9A 5ADHA 2O14A 1I0IA 4IY1A 4MRSA 2AEJA 1V2HE 5CGQB 4J1QA 2VYVD 5DNVA 4QXAA 3AYZB 5ADUS 3NC0C 1AGXA 3JZAA 2QP9X 3IEPA 4H31A 3GHHA 4WOKA 4WZAE 5H70A 1AIPA 1Z4NA 4BUCA 5KTRA 1EGVB 2FR8C 2YYSA 3NAMA 1X2EA 3AI1A 1NXQA 1B15A 4FFRA 3UGQA 4DLBA 3UK0A 3AP1A 1P44A 3KFXA 4XD7A 2R751 1JQDA 1C0LA 2VO1A 4GO1A 3KDPA 4XARA 4BFTA 3B5JA 1KXJA 5IPFA