5BOWA

Crystal structure of il-38
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
SSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 family member 10
publication title Crystal Structure of Interleukin-38
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 33
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5bowA00
3VEQA 4EFQA 3OBTA 8I1BA 1V6WA 4I4OA 4P0KA 3WINA 1IRAX 1TOOA 1VCLA 3H6QA 4JPZA 4ZFYB 3O3QA 3PHZA 1FWUA 5BP5C 5DVHA 4I4PA 1AVWB 5FZUA 3WINC 4D8HA 2VXRA 3ZXDA 1BA7A 4OWLA 5FNXA 2ZQNA 3RSJA 3PUBA 1ITBA 1SZ6B 1Z0HA 4KC3A 3H6RB 3N0KA 3H6SE 1PUUB 1ILR1 4QBCA 3NBNA 2AAIB 1S0EA 2DS0A 4I6IA 1IJTA 3AZVA 1EPWA 2M49A 1J0SA 1NUNA 3OJVA 1TWEA 3FJKA 4J2YA 2VSAA 2Y9XE 3FGMA 3VSFA 4LO2A 3O4DA 2VXTI 3BA7A 3WO2A 4LO8B 1RG8A 1SR4C 4OWKA 4LO2C 4LO7B 3V0AB 2VLCA 2FFUA 2Y9WC 3AJ5A 4AN7B 1JY0A 3HN1A 2KLLA 3E8LC 4DEPA 3CA5A 2WBCA 4GOVA 3P6JA 4G9MA 4IHZA 2ERMA 1S0CA 4IY9A 3VUOA 2FFVA 2HWMA 4QD2C 3CRIA 5G00A 2NZ9A 3A22A 1OQLB 1FGAA 2K8RA 3V79C 1II4A 1KNMA 3AH1A 3BA5A 2HW9A 1BFCA 4JRAA 4I37A 2IHOA 2KI4A 3FJBA 2VSEA 1FMMS 3V0BB 3JUTA 3WMUA 3BRDA 4X38A 2KH2A 2NM1A 4Q9GA 3TC2A 2K43A 3CRGA 1YXWA 3POKA 4EFRA 1M16A 3S8KA 4D0ZA 3FJFA 4I8MA 3CRHA 1JLXA 2X2TA 4A7YA 4I4YA 3KMVA 1DLLA 2Z48A 3FUOA 2D23A 2YUGA 5EHAA 1XYFA 4P0LA 3AKIA 3O5WB 3OGFA 41BIA 1P63A 3OJ2A 3AJ6A 1Z4SA 2VU9A 2VUAA 1S0GA 1DQOA 7I1BA 3O44A 4KEIA 3D7WB 2KKIA 2RQ9A 4D0TA 4I0YA 5BXRA 3O4BA 2NYYA 4IZEA 1DIWA 2X2SA 3A21A 4JKXB 1YTOA 3QYDA 3CA3A 3PMEA 5D61A 1MD6A 4XFTA 3RMXA 1G9AA 3FUQA 5EG6C 4XFSA 2NVHA 1ISWA 4HA2A 4CJMA 3PG0A 4G6MA 4I2SA 1TIEA 4OWJA 4WBCA 1HCEA 4ENDA 3UJ4A 3CA6A 1W3GA 1IILA 1JTCA 5BP5A 1Q1UA 1S0LA 4ZKTB 4A7ZA 31BIA 4FVVA 1BASA 1HCDA 3CA0A 2GO2A 3IM7A 4L4IA 4USOA 2E4MC 1RY7A 21BIA 2NTDA 4I4SA 1TP0A 3NBDA 3H6RA 3ZC9A 1F31A 3BRFA 3S8JA 3WMVA 4J2SA 1IT0A 3AH2A 2Y9FA 2HZ9A 2HWAA 4Z9WB 4XFUA 4HJJA 1AXMA 3BRGC 4KEKA 4I4VA 1V6VA 4I4UA 3AZWA 1SR4A 3I2AA 3QR5A 5BXSA 3P53A 4QALA 5JLVA 1GGPB 5D63A 1AVUA 4OW4A 2AXMA 2Z49A 4F83A 2F2FC 1K5UA 2BFHA 4GAFA 3ZXGA 4I4RA 2FDBM 4JQ0A 2F8XC 2MIBA 2ZQOA 3FJHA 3W9TA 2BEBA 3N7JA 4LO7C 1ONKB 1S0BA 4JAWA 1TFMB 4XKIA 3HSMA 1AVXB 4EKXB 3LTQA 3A07A 1CVSA 1I1EA 3IAGC 1QQLA 4G1RA 1BLAA 4IY8A 3R4UA 3Q7YA 1A8DA 1HIBA 3WA1A 3V0BA 3BAUA 4G6JA 3LLPA 4GP0A 4QD2B 1IHKA 1ISVA 1NZKA 5BQUC 3P6IA 9ILBA 3BAVA 1T4QA 3FFZA 3VSZA 3I29B 1TWMA 3MALA 5FZYA 3CA4A 2P23A 5HPZA 6I1BA 2QYIB 2AQZA 1Q04A 4Z8SB 3O4AA 5DUYA 1BARA 1HWOB 1JT4A 3AKFA 3BAQA 4QC4A 1HKNA 4JP0A 4PC4A 2DREA 3HMYA 1L2HA 1FWVA 5FNWA 1S0DA 1XZZA 5F8YA 4ZFUB 1BFBA 1AFCA 2RG9B 4R6UB 3B9UA 4KEJA 1WD4A 3WO4A 4ISRA 3ILAA 4I1EA 4KBBA 1Q03A 3JRRA 4LO0C 4X39A 2K4AB 2Y9GA 3N7LA 4J23B 1E0OA 3NBCA 1W3FA 3F1RA 3UD9A 1AVAC 2QN4A 5BXTA 4OEFA 3BB2A 1IRPA 2D24A 3MPPG 1HWPB 2IWTB 3OJMA 1IOBA 1FV3A 1ISYA 1RZOB 3OBRA 3VT1A 4I3NA 3N7MA 1QXMA 2D20A 4GAIA 4DCKC 5EC5A 4A7KA 3BAGA 3CAHA 2FO1A 4ZFWB 5B2HA 2P39A 4I7IA 3RMYA 5BVPI 3F62B 4DENA 2E4MA 1EVTA 1TTUA 1DFQA 4ZOTA 2XOAA 3AKGA 1ISZA 3Q7XA 5FZZA 1HWMB 3O4OA 4GP3A 3FJ8A 3BA4A 5E24E 2ET2A 1G82A 1JT3A 2D7IA 4I1BA 1N4KA 1G9DA 3EF2A 3N7KA 2D1ZA 3OGGA 1V6XA 3WO3A 3A23A 3C9ZA 1ISXA 4ZBVB 4I4XA 2DRYA 3FJCA 3FJIA 3IM5A 1W3AA 2RSTA 4QKSA 2F2FA 1V6UA 1R8OA 2WRYA 4H9WA 4IZXA 3UDAA 3BAOA 3FJJA 3HOMA 5GAQA 3UJ0A 1I1BA 3FJAA 3V0AA 4ZGRB 1T9FA 1QQKA 1G9BA 1DQGA 4LO1A 4I4QA 3CQAA 4Q9PA 1K5VA 3RTJB 2Q3NB 4OEGA 4LO1C 4JKQA 2D43A 4TLPA 4EFPA 3R4SA 1S0FA 5D62A 3ZC8A 4QO3A 3BX1C 4L4HA 3VT0A 2GZBA 4LO3A 1FV2A 1JT5A 1PWAA 4QBVA 1D0HA 5F90A 1M2TB 3T8SA 3HALA 4LO3C 5BQUA 1UPSA 1XG6A 1Z2VA 1FMZA 1JT7A 3HBWA 3IM6A 4USPA 2D22A 4II0A 2BEAA 4QKRA 1WBCA 2ZR1B 2Q9XA 2ESUA 2LIEA 4X3AA 3K1XA 1PC8B 4P6AA 4ISQA 1XHBA 1JLYA 5I1BA 1WBAA 3CA1A 4H04A 5F8WA 1WD3A 3Q7WA 4GOYA 1DFCA 3BADA 4OEEA 2UUSA 1PUMB 1R8NA 3NBEA 2J3PA 1AF9A 1CE7B 1YF8B 4OUJA 3AKHA 4I96A 4ZLBB 4LO0A 2DRZA 3SNVA 2NP0A 1HWNB 3RTIB 3VWCA 1DZCA 4X37A 3BAHA 1BFGA 4Q91A 2I1BA 4IQPA 5F8SA 3UD7A 3O49A 3VT2A 1JQZA 4HR6C 4AN6A 2FGFA 3O4CA 5JMCA 5BOWA 1EV2A 5DZUA 2L5XA 1BLDA 1PZZA 2AFGA 1EYLA 4P0JA 3IIRA 2LIQA 1YBIA 3NJ5A 2D44A 1RMLA 1DZDA 3I2XA 1BFFA 3BTAA 4IYBA 4J2XA 5BXPA 1DJSB 3AH4A 1FN0A 3CU1B 3ZX7A 2MC2A 4FGFA 4YOLA 2KI6B 1G9CA 2MLLB 4EEEB 5DSSB 1ABRB 4G9NA 2D7RA 4ZA3B 3FJ9A 3FJEA 4J2KA 1FQ9A 3UD8A 4EB2B 3FJDA 1MC9A 1YYNA 4F34A 4IONA 2R9KB
chains in the Genus database with same CATH superfamily
3VEQA 4EFQA 3OBTA 8I1BA 1V6WA 4I4OA 4P0KA 3WINA 1IRAX 1TOOA 1VCLA 3H6QA 4JPZA 4ZFYB 3O3QA 3PHZA 1FWUA 5BP5C 5DVHA 4I4PA 1AVWB 5FZUA 3WINC 4D8HA 2VXRA 3ZXDA 1BA7A 4OWLA 5FNXA 2ZQNA 3RSJA 3PUBA 1ITBA 1SZ6B 1Z0HA 4KC3A 3H6RB 3N0KA 3H6SE 1PUUB 1ILR1 4QBCA 3NBNA 2AAIB 1S0EA 2DS0A 4I6IA 1IJTA 3AZVA 1EPWA 2M49A 1J0SA 1NUNA 3OJVA 1TWEA 3FJKA 4J2YA 2VSAA 2Y9XE 3FGMA 3VSFA 4LO2A 3O4DA 2VXTI 3BA7A 3WO2A 4LO8B 1RG8A 1SR4C 4OWKA 4LO2C 4LO7B 3V0AB 2VLCA 2FFUA 2Y9WC 3AJ5A 4AN7B 1JY0A 3HN1A 2KLLA 3E8LC 4DEPA 3CA5A 2WBCA 4GOVA 3P6JA 4G9MA 4IHZA 2ERMA 1S0CA 4IY9A 3VUOA 2FFVA 2HWMA 4QD2C 3CRIA 5G00A 2NZ9A 3A22A 1OQLB 1FGAA 2K8RA 3V79C 1II4A 1KNMA 3AH1A 3BA5A 2HW9A 1BFCA 4JRAA 4I37A 2IHOA 2KI4A 3FJBA 2VSEA 1FMMS 3V0BB 3JUTA 3WMUA 3BRDA 4X38A 2KH2A 2NM1A 4Q9GA 3TC2A 2K43A 3CRGA 1YXWA 3POKA 4EFRA 1M16A 3S8KA 4D0ZA 3FJFA 4I8MA 3CRHA 1JLXA 2X2TA 4A7YA 4I4YA 3KMVA 1DLLA 2Z48A 3FUOA 2D23A 2YUGA 5EHAA 1XYFA 4P0LA 3AKIA 3O5WB 3OGFA 41BIA 1P63A 3OJ2A 3AJ6A 1Z4SA 2VU9A 2VUAA 1S0GA 1DQOA 7I1BA 3O44A 4KEIA 3D7WB 2KKIA 2RQ9A 4D0TA 4I0YA 5BXRA 3O4BA 2NYYA 4IZEA 1DIWA 2X2SA 3A21A 4JKXB 1YTOA 3QYDA 3CA3A 3PMEA 5D61A 1MD6A 4XFTA 3RMXA 1G9AA 3FUQA 5EG6C 4XFSA 2NVHA 1ISWA 4HA2A 4CJMA 3PG0A 4G6MA 4I2SA 1TIEA 4OWJA 4WBCA 1HCEA 4ENDA 3UJ4A 3CA6A 1W3GA 1IILA 1JTCA 5BP5A 1Q1UA 1S0LA 4ZKTB 4A7ZA 31BIA 4FVVA 1BASA 1HCDA 3CA0A 2GO2A 3IM7A 4L4IA 4USOA 2E4MC 1RY7A 21BIA 2NTDA 4I4SA 1TP0A 3NBDA 4MZGB 3H6RA 3ZC9A 1F31A 3BRFA 3S8JA 3WMVA 4J2SA 1IT0A 3AH2A 2Y9FA 2HZ9A 2HWAA 4Z9WB 4XFUA 4HJJA 1AXMA 3BRGC 4KEKA 4I4VA 1V6VA 4I4UA 3AZWA 1SR4A 3I2AA 3QR5A 5BXSA 3P53A 4QALA 5JLVA 1GGPB 5D63A 1AVUA 4OW4A 2AXMA 2Z49A 4F83A 2F2FC 1K5UA 2BFHA 4GAFA 3ZXGA 4I4RA 2FDBM 4JQ0A 2F8XC 2MIBA 2ZQOA 3FJHA 3W9TA 2BEBA 3N7JA 4LO7C 1ONKB 1S0BA 4JAWA 1TFMB 4XKIA 3HSMA 1AVXB 4EKXB 3LTQA 3A07A 1CVSA 1I1EA 3IAGC 1QQLA 4G1RA 1BLAA 4IY8A 3R4UA 3Q7YA 1A8DA 1HIBA 3WA1A 3V0BA 3BAUA 4G6JA 3LLPA 4GP0A 4QD2B 1IHKA 1ISVA 1NZKA 5BQUC 3P6IA 9ILBA 3BAVA 1T4QA 3FFZA 3VSZA 3I29B 1TWMA 3MALA 5FZYA 3CA4A 2P23A 5HPZA 6I1BA 2QYIB 2AQZA 1Q04A 4Z8SB 3O4AA 5DUYA 1BARA 1HWOB 1JT4A 3AKFA 3BAQA 4QC4A 1HKNA 4JP0A 4PC4A 2DREA 3HMYA 1L2HA 1FWVA 5FNWA 1S0DA 1XZZA 5F8YA 4ZFUB 1BFBA 1AFCA 2RG9B 4R6UB 3B9UA 4KEJA 1WD4A 3WO4A 4ISRA 3ILAA 4I1EA 4KBBA 1Q03A 3JRRA 4LO0C 4X39A 2K4AB 2Y9GA 4MZFB 3N7LA 4J23B 1E0OA 3NBCA 1W3FA 3F1RA 3UD9A 1AVAC 2QN4A 5BXTA 4OEFA 3BB2A 1IRPA 2D24A 3MPPG 1HWPB 2IWTB 3OJMA 1IOBA 1FV3A 1ISYA 1RZOB 3OBRA 3VT1A 4I3NA 3N7MA 1QXMA 2D20A 4GAIA 4DCKC 5EC5A 4A7KA 3BAGA 3CAHA 2FO1A 4ZFWB 5B2HA 2P39A 4I7IA 3RMYA 5BVPI 3F62B 4DENA 2E4MA 1EVTA 1TTUA 1DFQA 4ZOTA 2XOAA 3AKGA 1ISZA 3Q7XA 5FZZA 1HWMB 3O4OA 4GP3A 3FJ8A 3BA4A 5E24E 2ET2A 1G82A 1JT3A 2D7IA 4I1BA 1N4KA 1G9DA 3EF2A 3N7KA 2D1ZA 3OGGA 1V6XA 3WO3A 3A23A 3C9ZA 1ISXA 4ZBVB 4I4XA 2DRYA 3FJCA 3FJIA 3IM5A 1W3AA 2RSTA 4QKSA 2F2FA 1V6UA 1R8OA 2WRYA 4H9WA 4IZXA 3UDAA 3BAOA 3FJJA 3HOMA 5GAQA 3UJ0A 1I1BA 3FJAA 3V0AA 4ZGRB 1T9FA 1QQKA 1G9BA 1DQGA 4LO1A 4I4QA 3CQAA 4Q9PA 1K5VA 3RTJB 2Q3NB 4OEGA 4LO1C 4JKQA 2D43A 4TLPA 4EFPA 3R4SA 1S0FA 4MZHA 5D62A 3ZC8A 4QO3A 3BX1C 4L4HA 3VT0A 2GZBA 4LO3A 1FV2A 1JT5A 1PWAA 4QBVA 1D0HA 5F90A 1M2TB 3T8SA 3HALA 4LO3C 5BQUA 1UPSA 1XG6A 1Z2VA 1FMZA 1JT7A 3HBWA 3IM6A 4USPA 2D22A 4H75A 4II0A 2BEAA 4QKRA 1WBCA 2ZR1B 2Q9XA 2ESUA 2LIEA 4X3AA 3K1XA 1PC8B 4P6AA 4ISQA 1XHBA 1JLYA 5I1BA 1WBAA 3CA1A 4H04A 5F8WA 1WD3A 3Q7WA 4GOYA 1DFCA 3BADA 4OEEA 2UUSA 1PUMB 1R8NA 3NBEA 2J3PA 1AF9A 1CE7B 1YF8B 4OUJA 3AKHA 4I96A 4ZLBB 4LO0A 2DRZA 3SNVA 2NP0A 1HWNB 3RTIB 3VWCA 4UY4A 1DZCA 4X37A 3BAHA 1BFGA 4Q91A 2I1BA 4IQPA 5F8SA 3UD7A 3O49A 3VT2A 1JQZA 4HR6C 4AN6A 2FGFA 3O4CA 5JMCA 5BOWA 1EV2A 5DZUA 2L5XA 1BLDA 1PZZA 2AFGA 1EYLA 4P0JA 3IIRA 2LIQA 1YBIA 3NJ5A 2D44A 1RMLA 1DZDA 3I2XA 1BFFA 3BTAA 4IYBA 4J2XA 5BXPA 1DJSB 2NS2A 1FN0A 3AH4A 3CU1B 3ZX7A 2MC2A 4FGFA 4YOLA 2KI6B 1G9CA 2MLLB 4EEEB 5DSSB 1ABRB 4G9NA 2D7RA 4ZA3B 3FJ9A 3FJEA 4J2KA 1FQ9A 3UD8A 4EB2B 3FJDA 1MC9A 1YYNA 4F34A 4IONA 2R9KB
chains in the Genus database with same CATH topology
3VEQA 4EFQA 3OBTA 8I1BA 1V6WA 4I4OA 4P0KA 3WINA 1IRAX 1TOOA 1VCLA 3H6QA 4JPZA 4ZFYB 3O3QA 3PHZA 1FWUA 5BP5C 5DVHA 4I4PA 1AVWB 5FZUA 3WINC 4D8HA 2VXRA 3ZXDA 1BA7A 4OWLA 5FNXA 2ZQNA 3RSJA 3PUBA 1ITBA 1SZ6B 1Z0HA 4KC3A 3H6RB 3N0KA 3H6SE 1PUUB 1ILR1 4QBCA 3NBNA 2AAIB 1S0EA 2DS0A 4I6IA 1IJTA 3AZVA 1EPWA 2M49A 1J0SA 1NUNA 3OJVA 1TWEA 3FJKA 4J2YA 2VSAA 2Y9XE 3FGMA 3VSFA 4LO2A 3O4DA 2VXTI 3BA7A 3WO2A 4LO8B 1RG8A 1SR4C 4OWKA 4LO2C 4LO7B 3V0AB 2VLCA 2FFUA 2Y9WC 3AJ5A 4AN7B 1JY0A 3HN1A 2KLLA 3E8LC 4DEPA 3CA5A 2WBCA 4GOVA 3P6JA 4G9MA 4IHZA 2ERMA 1S0CA 4IY9A 3VUOA 2FFVA 2HWMA 4QD2C 3CRIA 5G00A 2NZ9A 3A22A 1OQLB 1FGAA 2K8RA 3V79C 1II4A 1KNMA 3AH1A 3BA5A 2HW9A 1BFCA 4JRAA 4I37A 2IHOA 2KI4A 3FJBA 2VSEA 1FMMS 3V0BB 3JUTA 3WMUA 3BRDA 4X38A 2KH2A 2NM1A 4Q9GA 3TC2A 2K43A 3CRGA 1YXWA 3POKA 4EFRA 1M16A 3S8KA 4D0ZA 3FJFA 4I8MA 3CRHA 1JLXA 2X2TA 4A7YA 4I4YA 3KMVA 1DLLA 2Z48A 3FUOA 2D23A 2YUGA 5EHAA 1XYFA 4P0LA 3AKIA 3O5WB 3OGFA 41BIA 1P63A 3OJ2A 3AJ6A 1Z4SA 2VU9A 2VUAA 1S0GA 1DQOA 7I1BA 3O44A 4KEIA 3D7WB 2KKIA 2RQ9A 4D0TA 4I0YA 5BXRA 3O4BA 2NYYA 4IZEA 1DIWA 2X2SA 3A21A 4JKXB 1YTOA 3QYDA 3CA3A 3PMEA 5D61A 1MD6A 4XFTA 3RMXA 1G9AA 3FUQA 5EG6C 4XFSA 2NVHA 1ISWA 4HA2A 4CJMA 3PG0A 4G6MA 4I2SA 1TIEA 4OWJA 4WBCA 1HCEA 4ENDA 3UJ4A 3CA6A 1W3GA 1IILA 1JTCA 5BP5A 1Q1UA 1S0LA 4ZKTB 4A7ZA 31BIA 4FVVA 1BASA 1HCDA 3CA0A 2GO2A 3IM7A 4L4IA 4USOA 2E4MC 1RY7A 21BIA 2NTDA 4I4SA 1TP0A 3NBDA 4MZGB 3H6RA 3ZC9A 1F31A 3BRFA 3S8JA 3WMVA 4J2SA 1IT0A 3AH2A 2Y9FA 2HZ9A 2HWAA 4Z9WB 4XFUA 4HJJA 1AXMA 3BRGC 4KEKA 4I4VA 1V6VA 4I4UA 3AZWA 1SR4A 3I2AA 3QR5A 5BXSA 3P53A 4QALA 5JLVA 1GGPB 5D63A 1AVUA 4OW4A 2AXMA 2Z49A 4F83A 2F2FC 1K5UA 2BFHA 4GAFA 3ZXGA 4I4RA 2FDBM 4JQ0A 2F8XC 2MIBA 2ZQOA 3FJHA 3W9TA 2BEBA 3N7JA 4LO7C 1ONKB 1S0BA 4JAWA 1TFMB 4XKIA 3HSMA 1AVXB 4EKXB 3LTQA 3A07A 1CVSA 1I1EA 3IAGC 1QQLA 4G1RA 1BLAA 4IY8A 3R4UA 3Q7YA 1A8DA 1HIBA 3WA1A 3V0BA 3BAUA 4G6JA 3LLPA 4GP0A 4QD2B 1IHKA 1ISVA 1NZKA 5BQUC 3P6IA 9ILBA 3BAVA 1T4QA 3FFZA 3VSZA 3I29B 1TWMA 3MALA 5FZYA 3CA4A 2P23A 5HPZA 6I1BA 2QYIB 2AQZA 1Q04A 4Z8SB 3O4AA 5DUYA 1BARA 1HWOB 1JT4A 3AKFA 3BAQA 4QC4A 1HKNA 4JP0A 4PC4A 2DREA 3HMYA 1L2HA 1FWVA 5FNWA 1S0DA 1XZZA 5F8YA 4ZFUB 1BFBA 1AFCA 2RG9B 4R6UB 3B9UA 4KEJA 1WD4A 3WO4A 4ISRA 3ILAA 4I1EA 4KBBA 1Q03A 3JRRA 4LO0C 4X39A 2K4AB 2Y9GA 4MZFB 3N7LA 4J23B 1E0OA 3NBCA 1W3FA 3F1RA 3UD9A 1AVAC 2QN4A 5BXTA 4OEFA 3BB2A 1IRPA 2D24A 3MPPG 1HWPB 2IWTB 3OJMA 1IOBA 1FV3A 1ISYA 1RZOB 3OBRA 3VT1A 4I3NA 3N7MA 1QXMA 2D20A 4GAIA 4DCKC 5EC5A 4A7KA 3BAGA 3CAHA 2FO1A 4ZFWB 5B2HA 2P39A 4I7IA 3RMYA 5BVPI 3F62B 4DENA 2E4MA 1EVTA 1TTUA 1DFQA 4ZOTA 2XOAA 3AKGA 1ISZA 3Q7XA 5FZZA 1HWMB 3O4OA 4GP3A 3FJ8A 3BA4A 5E24E 2ET2A 1G82A 1JT3A 2D7IA 4I1BA 1N4KA 1G9DA 3EF2A 3N7KA 2D1ZA 3OGGA 1V6XA 3WO3A 3A23A 3C9ZA 1ISXA 4ZBVB 4I4XA 2DRYA 3FJCA 3FJIA 3IM5A 1W3AA 2RSTA 4QKSA 2F2FA 1V6UA 1R8OA 2WRYA 4H9WA 4IZXA 3UDAA 3BAOA 3FJJA 3HOMA 5GAQA 3UJ0A 1I1BA 3FJAA 3V0AA 4ZGRB 1T9FA 1QQKA 1G9BA 1DQGA 4LO1A 4I4QA 3CQAA 4Q9PA 1K5VA 3RTJB 2Q3NB 4OEGA 4LO1C 4JKQA 2D43A 4TLPA 4EFPA 3R4SA 1S0FA 4MZHA 5D62A 3ZC8A 4QO3A 3BX1C 4L4HA 3VT0A 2GZBA 4LO3A 1FV2A 1JT5A 1PWAA 4QBVA 1D0HA 5F90A 1M2TB 3T8SA 3HALA 4LO3C 5BQUA 1UPSA 1XG6A 1Z2VA 1FMZA 1JT7A 3HBWA 3IM6A 4USPA 2D22A 4H75A 4II0A 2BEAA 4QKRA 1WBCA 2ZR1B 2Q9XA 2ESUA 2LIEA 4X3AA 3K1XA 1PC8B 4P6AA 4ISQA 1XHBA 1JLYA 5I1BA 1WBAA 3CA1A 4H04A 5F8WA 1WD3A 3Q7WA 4GOYA 1DFCA 3BADA 4OEEA 2UUSA 1PUMB 1R8NA 3NBEA 2J3PA 1AF9A 1CE7B 1YF8B 4OUJA 3AKHA 4I96A 4ZLBB 4LO0A 2DRZA 3SNVA 2NP0A 1HWNB 3RTIB 3VWCA 4UY4A 1DZCA 4X37A 3BAHA 1BFGA 4Q91A 2I1BA 4IQPA 5F8SA 3UD7A 3O49A 3VT2A 1JQZA 4HR6C 4AN6A 2FGFA 3O4CA 5JMCA 5BOWA 1EV2A 5DZUA 2L5XA 1BLDA 1PZZA 2AFGA 1EYLA 4P0JA 3IIRA 2LIQA 1YBIA 3NJ5A 2D44A 1RMLA 1DZDA 3I2XA 1BFFA 3BTAA 4IYBA 4J2XA 5BXPA 1DJSB 2NS2A 1FN0A 3AH4A 3CU1B 3ZX7A 2MC2A 4FGFA 4YOLA 2KI6B 1G9CA 2MLLB 4EEEB 5DSSB 1ABRB 4G9NA 2D7RA 4ZA3B 3FJ9A 3FJEA 4J2KA 1FQ9A 3UD8A 4EB2B 3FJDA 1MC9A 1YYNA 4F34A 4IONA 2R9KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEQ A;  4EFQ A;  3OBT A;  8I1B A;  1V6W A;  4I4O A;  4P0K A;  3WIN A;  1IRA X;  1TOO A;  1VCL A;  3H6Q A;  4JPZ A;  4ZFY B;  3O3Q A;  3PHZ A;  1FWU A;  5BP5 C;  5DVH A;  4I4P A;  1AVW B;  5FZU A;  3WIN C;  4D8H A;  2VXR A;  3ZXD A;  1BA7 A;  4OWL A;  5FNX A;  2ZQN A;  3RSJ A;  3PUB A;  1ITB A;  1SZ6 B;  1Z0H A;  4KC3 A;  3H6R B;  3N0K A;  3H6S E;  1PUU B;  1ILR 1;  4QBC A;  3NBN A;  2AAI B;  1S0E A;  2DS0 A;  4I6I A;  1IJT A;  3AZV A;  1EPW A;  2M49 A;  1J0S A;  1NUN A;  3OJV A;  1TWE A;  3FJK A;  4J2Y A;  2VSA A;  2Y9X E;  3FGM A;  3VSF A;  4LO2 A;  3O4D A;  2VXT I;  3BA7 A;  3WO2 A;  4LO8 B;  1RG8 A;  1SR4 C;  4OWK A;  4LO2 C;  4LO7 B;  3V0A B;  2VLC A;  2FFU A;  2Y9W C;  3AJ5 A;  4AN7 B;  1JY0 A;  3HN1 A;  2KLL A;  3E8L C;  4DEP A;  3CA5 A;  2WBC A;  4GOV A;  3P6J A;  4G9M A;  4IHZ A;  2ERM A;  1S0C A;  4IY9 A;  3VUO A;  2FFV A;  2HWM A;  4QD2 C;  3CRI A;  5G00 A;  2NZ9 A;  3A22 A;  1OQL B;  1FGA A;  2K8R A;  3V79 C;  1II4 A;  1KNM A;  3AH1 A;  3BA5 A;  2HW9 A;  1BFC A;  4JRA A;  4I37 A;  2IHO A;  2KI4 A;  3FJB A;  2VSE A;  1FMM S;  3V0B B;  3JUT A;  3WMU A;  3BRD A;  4X38 A;  2KH2 A;  2NM1 A;  4Q9G A;  3TC2 A;  2K43 A;  3CRG A;  1YXW A;  3POK A;  4EFR A;  1M16 A;  3S8K A;  4D0Z A;  3FJF A;  4I8M A;  3CRH A;  1JLX A;  2X2T A;  4A7Y A;  4I4Y A;  3KMV A;  1DLL A;  2Z48 A;  3FUO A;  2D23 A;  2YUG A;  5EHA A;  1XYF A;  4P0L A;  3AKI A;  3O5W B;  3OGF A;  41BI A;  1P63 A;  3OJ2 A;  3AJ6 A;  1Z4S A;  2VU9 A;  2VUA A;  1S0G A;  1DQO A;  7I1B A;  3O44 A;  4KEI A;  3D7W B;  2KKI A;  2RQ9 A;  4D0T A;  4I0Y A;  5BXR A;  3O4B A;  2NYY A;  4IZE A;  1DIW A;  2X2S A;  3A21 A;  4JKX B;  1YTO A;  3QYD A;  3CA3 A;  3PME A;  5D61 A;  1MD6 A;  4XFT A;  3RMX A;  1G9A A;  3FUQ A;  5EG6 C;  4XFS A;  2NVH A;  1ISW A;  4HA2 A;  4CJM A;  3PG0 A;  4G6M A;  4I2S A;  1TIE A;  4OWJ A;  4WBC A;  1HCE A;  4END A;  3UJ4 A;  3CA6 A;  1W3G A;  1IIL A;  1JTC A;  5BP5 A;  1Q1U A;  1S0L A;  4ZKT B;  4A7Z A;  31BI A;  4FVV A;  1BAS A;  1HCD A;  3CA0 A;  2GO2 A;  3IM7 A;  4L4I A;  4USO A;  2E4M C;  1RY7 A;  21BI A;  2NTD A;  4I4S A;  1TP0 A;  3NBD A;  3H6R A;  3ZC9 A;  1F31 A;  3BRF A;  3S8J A;  3WMV A;  4J2S A;  1IT0 A;  3AH2 A;  2Y9F A;  2HZ9 A;  2HWA A;  4Z9W B;  4XFU A;  4HJJ A;  1AXM A;  3BRG C;  4KEK A;  4I4V A;  1V6V A;  4I4U A;  3AZW A;  1SR4 A;  3I2A A;  3QR5 A;  5BXS A;  3P53 A;  4QAL A;  5JLV A;  1GGP B;  5D63 A;  1AVU A;  4OW4 A;  2AXM A;  2Z49 A;  4F83 A;  2F2F C;  1K5U A;  2BFH A;  4GAF A;  3ZXG A;  4I4R A;  2FDB M;  4JQ0 A;  2F8X C;  2MIB A;  2ZQO A;  3FJH A;  3W9T A;  2BEB A;  3N7J A;  4LO7 C;  1ONK B;  1S0B A;  4JAW A;  1TFM B;  4XKI A;  3HSM A;  1AVX B;  4EKX B;  3LTQ A;  3A07 A;  1CVS A;  1I1E A;  3IAG C;  1QQL A;  4G1R A;  1BLA A;  4IY8 A;  3R4U A;  3Q7Y A;  1A8D A;  1HIB A;  3WA1 A;  3V0B A;  3BAU A;  4G6J A;  3LLP A;  4GP0 A;  4QD2 B;  1IHK A;  1ISV A;  1NZK A;  5BQU C;  3P6I A;  9ILB A;  3BAV A;  1T4Q A;  3FFZ A;  3VSZ A;  3I29 B;  1TWM A;  3MAL A;  5FZY A;  3CA4 A;  2P23 A;  5HPZ A;  6I1B A;  2QYI B;  2AQZ A;  1Q04 A;  4Z8S B;  3O4A A;  5DUY A;  1BAR A;  1HWO B;  1JT4 A;  3AKF A;  3BAQ A;  4QC4 A;  1HKN A;  4JP0 A;  4PC4 A;  2DRE A;  3HMY A;  1L2H A;  1FWV A;  5FNW A;  1S0D A;  1XZZ A;  5F8Y A;  4ZFU B;  1BFB A;  1AFC A;  2RG9 B;  4R6U B;  3B9U A;  4KEJ A;  1WD4 A;  3WO4 A;  4ISR A;  3ILA A;  4I1E A;  4KBB A;  1Q03 A;  3JRR A;  4LO0 C;  4X39 A;  2K4A B;  2Y9G A;  3N7L A;  4J23 B;  1E0O A;  3NBC A;  1W3F A;  3F1R A;  3UD9 A;  1AVA C;  2QN4 A;  5BXT A;  4OEF A;  3BB2 A;  1IRP A;  2D24 A;  3MPP G;  1HWP B;  2IWT B;  3OJM A;  1IOB A;  1FV3 A;  1ISY A;  1RZO B;  3OBR A;  3VT1 A;  4I3N A;  3N7M A;  1QXM A;  2D20 A;  4GAI A;  4DCK C;  5EC5 A;  4A7K A;  3BAG A;  3CAH A;  2FO1 A;  4ZFW B;  5B2H A;  2P39 A;  4I7I A;  3RMY A;  5BVP I;  3F62 B;  4DEN A;  2E4M A;  1EVT A;  1TTU A;  1DFQ A;  4ZOT A;  2XOA A;  3AKG A;  1ISZ A;  3Q7X A;  5FZZ A;  1HWM B;  3O4O A;  4GP3 A;  3FJ8 A;  3BA4 A;  5E24 E;  2ET2 A;  1G82 A;  1JT3 A;  2D7I A;  4I1B A;  1N4K A;  1G9D A;  3EF2 A;  3N7K A;  2D1Z A;  3OGG A;  1V6X A;  3WO3 A;  3A23 A;  3C9Z A;  1ISX A;  4ZBV B;  4I4X A;  2DRY A;  3FJC A;  3FJI A;  3IM5 A;  1W3A A;  2RST A;  4QKS A;  2F2F A;  1V6U A;  1R8O A;  2WRY A;  4H9W A;  4IZX A;  3UDA A;  3BAO A;  3FJJ A;  3HOM A;  5GAQ A;  3UJ0 A;  1I1B A;  3FJA A;  3V0A A;  4ZGR B;  1T9F A;  1QQK A;  1G9B A;  1DQG A;  4LO1 A;  4I4Q A;  3CQA A;  4Q9P A;  1K5V A;  3RTJ B;  2Q3N B;  4OEG A;  4LO1 C;  4JKQ A;  2D43 A;  4TLP A;  4EFP A;  3R4S A;  1S0F A;  5D62 A;  3ZC8 A;  4QO3 A;  3BX1 C;  4L4H A;  3VT0 A;  2GZB A;  4LO3 A;  1FV2 A;  1JT5 A;  1PWA A;  4QBV A;  1D0H A;  5F90 A;  1M2T B;  3T8S A;  3HAL A;  4LO3 C;  5BQU A;  1UPS A;  1XG6 A;  1Z2V A;  1FMZ A;  1JT7 A;  3HBW A;  3IM6 A;  4USP A;  2D22 A;  4II0 A;  2BEA A;  4QKR A;  1WBC A;  2ZR1 B;  2Q9X A;  2ESU A;  2LIE A;  4X3A A;  3K1X A;  1PC8 B;  4P6A A;  4ISQ A;  1XHB A;  1JLY A;  5I1B A;  1WBA A;  3CA1 A;  4H04 A;  5F8W A;  1WD3 A;  3Q7W A;  4GOY A;  1DFC A;  3BAD A;  4OEE A;  2UUS A;  1PUM B;  1R8N A;  3NBE A;  2J3P A;  1AF9 A;  1CE7 B;  1YF8 B;  4OUJ A;  3AKH A;  4I96 A;  4ZLB B;  4LO0 A;  2DRZ A;  3SNV A;  2NP0 A;  1HWN B;  3RTI B;  3VWC A;  1DZC A;  4X37 A;  3BAH A;  1BFG A;  4Q91 A;  2I1B A;  4IQP A;  5F8S A;  3UD7 A;  3O49 A;  3VT2 A;  1JQZ A;  4HR6 C;  4AN6 A;  2FGF A;  3O4C A;  5JMC A;  5BOW A;  1EV2 A;  5DZU A;  2L5X A;  1BLD A;  1PZZ A;  2AFG A;  1EYL A;  4P0J A;  3IIR A;  2LIQ A;  1YBI A;  3NJ5 A;  2D44 A;  1RML A;  1DZD A;  3I2X A;  1BFF A;  3BTA A;  4IYB A;  4J2X A;  5BXP A;  1DJS B;  3AH4 A;  1FN0 A;  3CU1 B;  3ZX7 A;  2MC2 A;  4FGF A;  4YOL A;  2KI6 B;  1G9C A;  2MLL B;  4EEE B;  5DSS B;  1ABR B;  4G9N A;  2D7R A;  4ZA3 B;  3FJ9 A;  3FJE A;  4J2K A;  1FQ9 A;  3UD8 A;  4EB2 B;  3FJD A;  1MC9 A;  1YYN A;  4F34 A;  4ION A;  2R9K B; 
#chains in the Genus database with same CATH topology
 3VEQ A;  4EFQ A;  3OBT A;  8I1B A;  1V6W A;  4I4O A;  4P0K A;  3WIN A;  1IRA X;  1TOO A;  1VCL A;  3H6Q A;  4JPZ A;  4ZFY B;  3O3Q A;  3PHZ A;  1FWU A;  5BP5 C;  5DVH A;  4I4P A;  1AVW B;  5FZU A;  3WIN C;  4D8H A;  2VXR A;  3ZXD A;  1BA7 A;  4OWL A;  5FNX A;  2ZQN A;  3RSJ A;  3PUB A;  1ITB A;  1SZ6 B;  1Z0H A;  4KC3 A;  3H6R B;  3N0K A;  3H6S E;  1PUU B;  1ILR 1;  4QBC A;  3NBN A;  2AAI B;  1S0E A;  2DS0 A;  4I6I A;  1IJT A;  3AZV A;  1EPW A;  2M49 A;  1J0S A;  1NUN A;  3OJV A;  1TWE A;  3FJK A;  4J2Y A;  2VSA A;  2Y9X E;  3FGM A;  3VSF A;  4LO2 A;  3O4D A;  2VXT I;  3BA7 A;  3WO2 A;  4LO8 B;  1RG8 A;  1SR4 C;  4OWK A;  4LO2 C;  4LO7 B;  3V0A B;  2VLC A;  2FFU A;  2Y9W C;  3AJ5 A;  4AN7 B;  1JY0 A;  3HN1 A;  2KLL A;  3E8L C;  4DEP A;  3CA5 A;  2WBC A;  4GOV A;  3P6J A;  4G9M A;  4IHZ A;  2ERM A;  1S0C A;  4IY9 A;  3VUO A;  2FFV A;  2HWM A;  4QD2 C;  3CRI A;  5G00 A;  2NZ9 A;  3A22 A;  1OQL B;  1FGA A;  2K8R A;  3V79 C;  1II4 A;  1KNM A;  3AH1 A;  3BA5 A;  2HW9 A;  1BFC A;  4JRA A;  4I37 A;  2IHO A;  2KI4 A;  3FJB A;  2VSE A;  1FMM S;  3V0B B;  3JUT A;  3WMU A;  3BRD A;  4X38 A;  2KH2 A;  2NM1 A;  4Q9G A;  3TC2 A;  2K43 A;  3CRG A;  1YXW A;  3POK A;  4EFR A;  1M16 A;  3S8K A;  4D0Z A;  3FJF A;  4I8M A;  3CRH A;  1JLX A;  2X2T A;  4A7Y A;  4I4Y A;  3KMV A;  1DLL A;  2Z48 A;  3FUO A;  2D23 A;  2YUG A;  5EHA A;  1XYF A;  4P0L A;  3AKI A;  3O5W B;  3OGF A;  41BI A;  1P63 A;  3OJ2 A;  3AJ6 A;  1Z4S A;  2VU9 A;  2VUA A;  1S0G A;  1DQO A;  7I1B A;  3O44 A;  4KEI A;  3D7W B;  2KKI A;  2RQ9 A;  4D0T A;  4I0Y A;  5BXR A;  3O4B A;  2NYY A;  4IZE A;  1DIW A;  2X2S A;  3A21 A;  4JKX B;  1YTO A;  3QYD A;  3CA3 A;  3PME A;  5D61 A;  1MD6 A;  4XFT A;  3RMX A;  1G9A A;  3FUQ A;  5EG6 C;  4XFS A;  2NVH A;  1ISW A;  4HA2 A;  4CJM A;  3PG0 A;  4G6M A;  4I2S A;  1TIE A;  4OWJ A;  4WBC A;  1HCE A;  4END A;  3UJ4 A;  3CA6 A;  1W3G A;  1IIL A;  1JTC A;  5BP5 A;  1Q1U A;  1S0L A;  4ZKT B;  4A7Z A;  31BI A;  4FVV A;  1BAS A;  1HCD A;  3CA0 A;  2GO2 A;  3IM7 A;  4L4I A;  4USO A;  2E4M C;  1RY7 A;  21BI A;  2NTD A;  4I4S A;  1TP0 A;  3NBD A;  4MZG B;  3H6R A;  3ZC9 A;  1F31 A;  3BRF A;  3S8J A;  3WMV A;  4J2S A;  1IT0 A;  3AH2 A;  2Y9F A;  2HZ9 A;  2HWA A;  4Z9W B;  4XFU A;  4HJJ A;  1AXM A;  3BRG C;  4KEK A;  4I4V A;  1V6V A;  4I4U A;  3AZW A;  1SR4 A;  3I2A A;  3QR5 A;  5BXS A;  3P53 A;  4QAL A;  5JLV A;  1GGP B;  5D63 A;  1AVU A;  4OW4 A;  2AXM A;  2Z49 A;  4F83 A;  2F2F C;  1K5U A;  2BFH A;  4GAF A;  3ZXG A;  4I4R A;  2FDB M;  4JQ0 A;  2F8X C;  2MIB A;  2ZQO A;  3FJH A;  3W9T A;  2BEB A;  3N7J A;  4LO7 C;  1ONK B;  1S0B A;  4JAW A;  1TFM B;  4XKI A;  3HSM A;  1AVX B;  4EKX B;  3LTQ A;  3A07 A;  1CVS A;  1I1E A;  3IAG C;  1QQL A;  4G1R A;  1BLA A;  4IY8 A;  3R4U A;  3Q7Y A;  1A8D A;  1HIB A;  3WA1 A;  3V0B A;  3BAU A;  4G6J A;  3LLP A;  4GP0 A;  4QD2 B;  1IHK A;  1ISV A;  1NZK A;  5BQU C;  3P6I A;  9ILB A;  3BAV A;  1T4Q A;  3FFZ A;  3VSZ A;  3I29 B;  1TWM A;  3MAL A;  5FZY A;  3CA4 A;  2P23 A;  5HPZ A;  6I1B A;  2QYI B;  2AQZ A;  1Q04 A;  4Z8S B;  3O4A A;  5DUY A;  1BAR A;  1HWO B;  1JT4 A;  3AKF A;  3BAQ A;  4QC4 A;  1HKN A;  4JP0 A;  4PC4 A;  2DRE A;  3HMY A;  1L2H A;  1FWV A;  5FNW A;  1S0D A;  1XZZ A;  5F8Y A;  4ZFU B;  1BFB A;  1AFC A;  2RG9 B;  4R6U B;  3B9U A;  4KEJ A;  1WD4 A;  3WO4 A;  4ISR A;  3ILA A;  4I1E A;  4KBB A;  1Q03 A;  3JRR A;  4LO0 C;  4X39 A;  2K4A B;  2Y9G A;  4MZF B;  3N7L A;  4J23 B;  1E0O A;  3NBC A;  1W3F A;  3F1R A;  3UD9 A;  1AVA C;  2QN4 A;  5BXT A;  4OEF A;  3BB2 A;  1IRP A;  2D24 A;  3MPP G;  1HWP B;  2IWT B;  3OJM A;  1IOB A;  1FV3 A;  1ISY A;  1RZO B;  3OBR A;  3VT1 A;  4I3N A;  3N7M A;  1QXM A;  2D20 A;  4GAI A;  4DCK C;  5EC5 A;  4A7K A;  3BAG A;  3CAH A;  2FO1 A;  4ZFW B;  5B2H A;  2P39 A;  4I7I A;  3RMY A;  5BVP I;  3F62 B;  4DEN A;  2E4M A;  1EVT A;  1TTU A;  1DFQ A;  4ZOT A;  2XOA A;  3AKG A;  1ISZ A;  3Q7X A;  5FZZ A;  1HWM B;  3O4O A;  4GP3 A;  3FJ8 A;  3BA4 A;  5E24 E;  2ET2 A;  1G82 A;  1JT3 A;  2D7I A;  4I1B A;  1N4K A;  1G9D A;  3EF2 A;  3N7K A;  2D1Z A;  3OGG A;  1V6X A;  3WO3 A;  3A23 A;  3C9Z A;  1ISX A;  4ZBV B;  4I4X A;  2DRY A;  3FJC A;  3FJI A;  3IM5 A;  1W3A A;  2RST A;  4QKS A;  2F2F A;  1V6U A;  1R8O A;  2WRY A;  4H9W A;  4IZX A;  3UDA A;  3BAO A;  3FJJ A;  3HOM A;  5GAQ A;  3UJ0 A;  1I1B A;  3FJA A;  3V0A A;  4ZGR B;  1T9F A;  1QQK A;  1G9B A;  1DQG A;  4LO1 A;  4I4Q A;  3CQA A;  4Q9P A;  1K5V A;  3RTJ B;  2Q3N B;  4OEG A;  4LO1 C;  4JKQ A;  2D43 A;  4TLP A;  4EFP A;  3R4S A;  1S0F A;  4MZH A;  5D62 A;  3ZC8 A;  4QO3 A;  3BX1 C;  4L4H A;  3VT0 A;  2GZB A;  4LO3 A;  1FV2 A;  1JT5 A;  1PWA A;  4QBV A;  1D0H A;  5F90 A;  1M2T B;  3T8S A;  3HAL A;  4LO3 C;  5BQU A;  1UPS A;  1XG6 A;  1Z2V A;  1FMZ A;  1JT7 A;  3HBW A;  3IM6 A;  4USP A;  2D22 A;  4H75 A;  4II0 A;  2BEA A;  4QKR A;  1WBC A;  2ZR1 B;  2Q9X A;  2ESU A;  2LIE A;  4X3A A;  3K1X A;  1PC8 B;  4P6A A;  4ISQ A;  1XHB A;  1JLY A;  5I1B A;  1WBA A;  3CA1 A;  4H04 A;  5F8W A;  1WD3 A;  3Q7W A;  4GOY A;  1DFC A;  3BAD A;  4OEE A;  2UUS A;  1PUM B;  1R8N A;  3NBE A;  2J3P A;  1AF9 A;  1CE7 B;  1YF8 B;  4OUJ A;  3AKH A;  4I96 A;  4ZLB B;  4LO0 A;  2DRZ A;  3SNV A;  2NP0 A;  1HWN B;  3RTI B;  3VWC A;  4UY4 A;  1DZC A;  4X37 A;  3BAH A;  1BFG A;  4Q91 A;  2I1B A;  4IQP A;  5F8S A;  3UD7 A;  3O49 A;  3VT2 A;  1JQZ A;  4HR6 C;  4AN6 A;  2FGF A;  3O4C A;  5JMC A;  5BOW A;  1EV2 A;  5DZU A;  2L5X A;  1BLD A;  1PZZ A;  2AFG A;  1EYL A;  4P0J A;  3IIR A;  2LIQ A;  1YBI A;  3NJ5 A;  2D44 A;  1RML A;  1DZD A;  3I2X A;  1BFF A;  3BTA A;  4IYB A;  4J2X A;  5BXP A;  1DJS B;  2NS2 A;  1FN0 A;  3AH4 A;  3CU1 B;  3ZX7 A;  2MC2 A;  4FGF A;  4YOL A;  2KI6 B;  1G9C A;  2MLL B;  4EEE B;  5DSS B;  1ABR B;  4G9N A;  2D7R A;  4ZA3 B;  3FJ9 A;  3FJE A;  4J2K A;  1FQ9 A;  3UD8 A;  4EB2 B;  3FJD A;  1MC9 A;  1YYN A;  4F34 A;  4ION A;  2R9K B; 
#chains in the Genus database with same CATH homology
 3VEQ A;  4EFQ A;  3OBT A;  8I1B A;  1V6W A;  4I4O A;  4P0K A;  3WIN A;  1IRA X;  1TOO A;  1VCL A;  3H6Q A;  4JPZ A;  4ZFY B;  3O3Q A;  3PHZ A;  1FWU A;  5BP5 C;  5DVH A;  4I4P A;  1AVW B;  5FZU A;  3WIN C;  4D8H A;  2VXR A;  3ZXD A;  1BA7 A;  4OWL A;  5FNX A;  2ZQN A;  3RSJ A;  3PUB A;  1ITB A;  1SZ6 B;  1Z0H A;  4KC3 A;  3H6R B;  3N0K A;  3H6S E;  1PUU B;  1ILR 1;  4QBC A;  3NBN A;  2AAI B;  1S0E A;  2DS0 A;  4I6I A;  1IJT A;  3AZV A;  1EPW A;  2M49 A;  1J0S A;  1NUN A;  3OJV A;  1TWE A;  3FJK A;  4J2Y A;  2VSA A;  2Y9X E;  3FGM A;  3VSF A;  4LO2 A;  3O4D A;  2VXT I;  3BA7 A;  3WO2 A;  4LO8 B;  1RG8 A;  1SR4 C;  4OWK A;  4LO2 C;  4LO7 B;  3V0A B;  2VLC A;  2FFU A;  2Y9W C;  3AJ5 A;  4AN7 B;  1JY0 A;  3HN1 A;  2KLL A;  3E8L C;  4DEP A;  3CA5 A;  2WBC A;  4GOV A;  3P6J A;  4G9M A;  4IHZ A;  2ERM A;  1S0C A;  4IY9 A;  3VUO A;  2FFV A;  2HWM A;  4QD2 C;  3CRI A;  5G00 A;  2NZ9 A;  3A22 A;  1OQL B;  1FGA A;  2K8R A;  3V79 C;  1II4 A;  1KNM A;  3AH1 A;  3BA5 A;  2HW9 A;  1BFC A;  4JRA A;  4I37 A;  2IHO A;  2KI4 A;  3FJB A;  2VSE A;  1FMM S;  3V0B B;  3JUT A;  3WMU A;  3BRD A;  4X38 A;  2KH2 A;  2NM1 A;  4Q9G A;  3TC2 A;  2K43 A;  3CRG A;  1YXW A;  3POK A;  4EFR A;  1M16 A;  3S8K A;  4D0Z A;  3FJF A;  4I8M A;  3CRH A;  1JLX A;  2X2T A;  4A7Y A;  4I4Y A;  3KMV A;  1DLL A;  2Z48 A;  3FUO A;  2D23 A;  2YUG A;  5EHA A;  1XYF A;  4P0L A;  3AKI A;  3O5W B;  3OGF A;  41BI A;  1P63 A;  3OJ2 A;  3AJ6 A;  1Z4S A;  2VU9 A;  2VUA A;  1S0G A;  1DQO A;  7I1B A;  3O44 A;  4KEI A;  3D7W B;  2KKI A;  2RQ9 A;  4D0T A;  4I0Y A;  5BXR A;  3O4B A;  2NYY A;  4IZE A;  1DIW A;  2X2S A;  3A21 A;  4JKX B;  1YTO A;  3QYD A;  3CA3 A;  3PME A;  5D61 A;  1MD6 A;  4XFT A;  3RMX A;  1G9A A;  3FUQ A;  5EG6 C;  4XFS A;  2NVH A;  1ISW A;  4HA2 A;  4CJM A;  3PG0 A;  4G6M A;  4I2S A;  1TIE A;  4OWJ A;  4WBC A;  1HCE A;  4END A;  3UJ4 A;  3CA6 A;  1W3G A;  1IIL A;  1JTC A;  5BP5 A;  1Q1U A;  1S0L A;  4ZKT B;  4A7Z A;  31BI A;  4FVV A;  1BAS A;  1HCD A;  3CA0 A;  2GO2 A;  3IM7 A;  4L4I A;  4USO A;  2E4M C;  1RY7 A;  21BI A;  2NTD A;  4I4S A;  1TP0 A;  3NBD A;  4MZG B;  3H6R A;  3ZC9 A;  1F31 A;  3BRF A;  3S8J A;  3WMV A;  4J2S A;  1IT0 A;  3AH2 A;  2Y9F A;  2HZ9 A;  2HWA A;  4Z9W B;  4XFU A;  4HJJ A;  1AXM A;  3BRG C;  4KEK A;  4I4V A;  1V6V A;  4I4U A;  3AZW A;  1SR4 A;  3I2A A;  3QR5 A;  5BXS A;  3P53 A;  4QAL A;  5JLV A;  1GGP B;  5D63 A;  1AVU A;  4OW4 A;  2AXM A;  2Z49 A;  4F83 A;  2F2F C;  1K5U A;  2BFH A;  4GAF A;  3ZXG A;  4I4R A;  2FDB M;  4JQ0 A;  2F8X C;  2MIB A;  2ZQO A;  3FJH A;  3W9T A;  2BEB A;  3N7J A;  4LO7 C;  1ONK B;  1S0B A;  4JAW A;  1TFM B;  4XKI A;  3HSM A;  1AVX B;  4EKX B;  3LTQ A;  3A07 A;  1CVS A;  1I1E A;  3IAG C;  1QQL A;  4G1R A;  1BLA A;  4IY8 A;  3R4U A;  3Q7Y A;  1A8D A;  1HIB A;  3WA1 A;  3V0B A;  3BAU A;  4G6J A;  3LLP A;  4GP0 A;  4QD2 B;  1IHK A;  1ISV A;  1NZK A;  5BQU C;  3P6I A;  9ILB A;  3BAV A;  1T4Q A;  3FFZ A;  3VSZ A;  3I29 B;  1TWM A;  3MAL A;  5FZY A;  3CA4 A;  2P23 A;  5HPZ A;  6I1B A;  2QYI B;  2AQZ A;  1Q04 A;  4Z8S B;  3O4A A;  5DUY A;  1BAR A;  1HWO B;  1JT4 A;  3AKF A;  3BAQ A;  4QC4 A;  1HKN A;  4JP0 A;  4PC4 A;  2DRE A;  3HMY A;  1L2H A;  1FWV A;  5FNW A;  1S0D A;  1XZZ A;  5F8Y A;  4ZFU B;  1BFB A;  1AFC A;  2RG9 B;  4R6U B;  3B9U A;  4KEJ A;  1WD4 A;  3WO4 A;  4ISR A;  3ILA A;  4I1E A;  4KBB A;  1Q03 A;  3JRR A;  4LO0 C;  4X39 A;  2K4A B;  2Y9G A;  4MZF B;  3N7L A;  4J23 B;  1E0O A;  3NBC A;  1W3F A;  3F1R A;  3UD9 A;  1AVA C;  2QN4 A;  5BXT A;  4OEF A;  3BB2 A;  1IRP A;  2D24 A;  3MPP G;  1HWP B;  2IWT B;  3OJM A;  1IOB A;  1FV3 A;  1ISY A;  1RZO B;  3OBR A;  3VT1 A;  4I3N A;  3N7M A;  1QXM A;  2D20 A;  4GAI A;  4DCK C;  5EC5 A;  4A7K A;  3BAG A;  3CAH A;  2FO1 A;  4ZFW B;  5B2H A;  2P39 A;  4I7I A;  3RMY A;  5BVP I;  3F62 B;  4DEN A;  2E4M A;  1EVT A;  1TTU A;  1DFQ A;  4ZOT A;  2XOA A;  3AKG A;  1ISZ A;  3Q7X A;  5FZZ A;  1HWM B;  3O4O A;  4GP3 A;  3FJ8 A;  3BA4 A;  5E24 E;  2ET2 A;  1G82 A;  1JT3 A;  2D7I A;  4I1B A;  1N4K A;  1G9D A;  3EF2 A;  3N7K A;  2D1Z A;  3OGG A;  1V6X A;  3WO3 A;  3A23 A;  3C9Z A;  1ISX A;  4ZBV B;  4I4X A;  2DRY A;  3FJC A;  3FJI A;  3IM5 A;  1W3A A;  2RST A;  4QKS A;  2F2F A;  1V6U A;  1R8O A;  2WRY A;  4H9W A;  4IZX A;  3UDA A;  3BAO A;  3FJJ A;  3HOM A;  5GAQ A;  3UJ0 A;  1I1B A;  3FJA A;  3V0A A;  4ZGR B;  1T9F A;  1QQK A;  1G9B A;  1DQG A;  4LO1 A;  4I4Q A;  3CQA A;  4Q9P A;  1K5V A;  3RTJ B;  2Q3N B;  4OEG A;  4LO1 C;  4JKQ A;  2D43 A;  4TLP A;  4EFP A;  3R4S A;  1S0F A;  4MZH A;  5D62 A;  3ZC8 A;  4QO3 A;  3BX1 C;  4L4H A;  3VT0 A;  2GZB A;  4LO3 A;  1FV2 A;  1JT5 A;  1PWA A;  4QBV A;  1D0H A;  5F90 A;  1M2T B;  3T8S A;  3HAL A;  4LO3 C;  5BQU A;  1UPS A;  1XG6 A;  1Z2V A;  1FMZ A;  1JT7 A;  3HBW A;  3IM6 A;  4USP A;  2D22 A;  4H75 A;  4II0 A;  2BEA A;  4QKR A;  1WBC A;  2ZR1 B;  2Q9X A;  2ESU A;  2LIE A;  4X3A A;  3K1X A;  1PC8 B;  4P6A A;  4ISQ A;  1XHB A;  1JLY A;  5I1B A;  1WBA A;  3CA1 A;  4H04 A;  5F8W A;  1WD3 A;  3Q7W A;  4GOY A;  1DFC A;  3BAD A;  4OEE A;  2UUS A;  1PUM B;  1R8N A;  3NBE A;  2J3P A;  1AF9 A;  1CE7 B;  1YF8 B;  4OUJ A;  3AKH A;  4I96 A;  4ZLB B;  4LO0 A;  2DRZ A;  3SNV A;  2NP0 A;  1HWN B;  3RTI B;  3VWC A;  4UY4 A;  1DZC A;  4X37 A;  3BAH A;  1BFG A;  4Q91 A;  2I1B A;  4IQP A;  5F8S A;  3UD7 A;  3O49 A;  3VT2 A;  1JQZ A;  4HR6 C;  4AN6 A;  2FGF A;  3O4C A;  5JMC A;  5BOW A;  1EV2 A;  5DZU A;  2L5X A;  1BLD A;  1PZZ A;  2AFG A;  1EYL A;  4P0J A;  3IIR A;  2LIQ A;  1YBI A;  3NJ5 A;  2D44 A;  1RML A;  1DZD A;  3I2X A;  1BFF A;  3BTA A;  4IYB A;  4J2X A;  5BXP A;  1DJS B;  2NS2 A;  1FN0 A;  3AH4 A;  3CU1 B;  3ZX7 A;  2MC2 A;  4FGF A;  4YOL A;  2KI6 B;  1G9C A;  2MLL B;  4EEE B;  5DSS B;  1ABR B;  4G9N A;  2D7R A;  4ZA3 B;  3FJ9 A;  3FJE A;  4J2K A;  1FQ9 A;  3UD8 A;  4EB2 B;  3FJD A;  1MC9 A;  1YYN A;  4F34 A;  4ION A;  2R9K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...