5BOYA

X-ray co-structure of mmp-13 with ethyl 5-(1-methyl-1h-imidazol-5-yl)-1h-indole-2-carboxylate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
166
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Fragment-based discovery of indole inhibitors of matrix metalloproteinase-13.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 45
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5boyA00
3HDAP 1XURA 5I2ZA 1CK7A 3G5CA 1ZTQA 1EAKA 3K7NA 2EROA 4J4MA 3WV1A 1JK3A 1JIZA 2ERQA 2Y6DA 3LUNA 3HY7A 2X3AA 2X7MA 1I1IP 3F16A 2A8HA 5I4OA 3DWBA 5L7FA 1ZXVA 1UTTA 1SLMA 4I35A 2JT6A 1QICA 1H71P 1MMQA 1YCMA 4XCTA 4IN9A 5LABA 1BKCA 3I7GA 2RJQA 3Q2HA 5I0LA 1AYKA 5D2BA 4GR3A 5D1SA 2AYKA 4AUOA 1JIWP 3GBOA 4L63A 2OI0A 2POJA 1ASTA 3LKAA 3K7LA 4H76A 3KRYA 3EDZA 1GKDA 1OM8A 2E2DA 3KEKA 1IAEA 1GE7A 5B5PA 1DTHA 1QUAA 2K2GA 1YOUA 1S4BP 1HV5A 1C8TA 3LQ0A 1HTDA 4ILWD 3N2VA 5BOTA 2MLRA 2CKIA 2PJTA 2DW1A 3HBUP 1XFWA 3ZVSA 2CLTA 2OVXA 2K9CA 3L0TA 4WF6A 5CUHA 1GE6A 1MNCA 1J7NA 2YB9A 1K7QA 4PKVA 3LIKA 3WV2A 3LE9A 5D3CA 1KAPP 3F15A 1R1HA 2N8RA 1JKYA 4PKUA 4IUWA 5BOYA 1BUVM 1ND1A 4GUYA 1UEAA 456CA 2OY4A 1Q3AA 1USNA 4HMAA 5D7WA 3DNGA 4H1QA 1CGFA 1ZVXA 1KUGA 3B2ZA 4IJOA 4PKQA 4PKWA 4PKRA 1PWUA 2JIHA 3EDHA 1FLSA 1IABA 1BIWA 1JH1A 2OW2A 3DL1A 4EFSA 3LEAA 2OZRA 4I03A 3ZUKA 3F1AA 4A3WA 3TS4A 3EWJA 4WK7A 1JAOA 1C7KA 2XS3A 1XFVA 3F18A 1OO9A 4GQLA 4AIGA 1SATA 1AKLA 2E3XA 3F19A 1KUHA 4PKSA 1YQYA 1OS9A 2W12A 4GR0A 2JNPA 4AXQA 1HFCA 1CIZA 4G9LA 3EDIA 4DV8A 1G05A 3DPEA 3CKIA 1D8MA 3U1RA 2OW1A 3LMCA 2O36A 4H84A 3LK8A 4R3VA 2D1NA 1A85A 5CXAA 1CXVA 2FV5A 4XBHA 1HOVA 3LJTA 1BM6A 2KRJA 2L0RA 4H49A 1BUDA 1OM7A 3TSKA 1AF0A 2J83A 1CGLA 3KECA 1ZXCA 1K7GA 1KUFA 1SLNA 1MMPA 2OXUA 2XS4A 3KMEA 1EUBA 3RTSA 4CTHA 5D1UA 3NX7A 3UVCA 2OXWA 3USNA 3KEJA 3MA2A 5D1TA 1BKCI 2MZHA 1C3IA 1XFYA 1XFZA 2JT5A 3HYGA 3ELMA 1G12A 3DSLA 1UTZA 2W0DA 4JQGA 2MZEA 3HB2P 3RTTA 3Q2GA 2JSDA 1KUIA 1Z3JA 1R54A 2Y6CA 2OW9A 4FU4A 1GE5A 4WZVA 3V96B 1BQOA 1QIBA 3EDGA 3EHXA 1Y8JA 5JMYA 1B8YA 2AIGP 4FVLA 966CA 1R1JA 1SU3A 4GWMA 2W15A 4H82A 1PWQA 2OW0A 4L6TA 2FV9A 4WKEA 4DPEA 5I12A 1O0TA 3BA0A 1XUDA 4WKIA 2D1OA 3N2UA 1BQQM 2OY2A 3KWVC 1O0QA 3LJGA 1BKCE 1PWPA 2DDYA 1HFSA 1YP1A 4AYKA 1ZS0A 4JA1A 4PKTA 4JPAA 3OHLA 1FM1A 5I3MA 1FBLA 1ROSA 2TCLA 2ERPA 5I43A 3AYUA 3L0VA 5B5OA 5CZMA 5BPAA 2V4BA 1IAAA 4GR8A 1RMZA 2MZIA 1KBCA 2MLSA 1CGEA 3I7IA 4XM8A 1GKCA 830CA 4L19A 4G0DA 3KHIA 1G4KA 1G49A 2I47A 1L6JA 1JAPA 2DW0A 2O3EA 2W13A 1UMTA 1PWVA 1OM6A 4ZR5A 3HY9A 1CQRA 4H2EA 1SRPA 2DDFA 2HU6A 2WO8A 3O2XA 4H30A 1IAGA 3LILA 3WV3A 1JJ9A 1QJIA 1K7IA 4Q1LA 1BZSA 1GO8P 3TVCA 1EB6A 2WOAA 1JANA 3E8RA 1UMSA 5L79A 1R55A 2QPJA 4QKZA 2DW2A 1XFXA 1D7XA 3VTGA 1CAQA 4ON1A 3B92A 1IACA 1SMPA 1I73A 1ZP5A 3AIGA 3P24A 1Y93A 4DD8A 3F17A 3G42A 3O64A 2Z2DA 1MMBA 1ATLA 3VI1A 2WO9A 1GO7P 3AYKA 1MMRA 2J0TA 1XFUA 1BSWA 4H3XA 2OXZA 1B3DA 5H8XA 2X3CA 3ZXHA 2USNA 3LQBA 3LGPA 3SHIA 3TT4A 3EHYA 2YIGA 1GXDA 3KMCA 2SRTA 3DPFA 3HDBA 2W14A 1A86A 4GF1A 3OHOA 1G9KA 1IADA 3LUMA 4XM7A 1WNIA 4FXQA 3B8ZA 2OVZA 1Y0VA 1OS2A 1OMJA 1QJJA 1XUCA 2X3BA 4JP4A 4DF9A 1PWWA 1DMTA 1KUKA 4JIJA 1D8FA 4HX3A 3HBVP 3LIRA 3P1VA 4GWNA 4XM6A 1I76A 1D5JA 1QIAA 1HY7A 4FXYP 1RM8A 4A7BA 1JAQA 2RJPA 3LJZA 1R1IA
chains in the Genus database with same CATH superfamily
3HDAP 1XURA 5I2ZA 1CK7A 3G5CA 1ZTQA 1EAKA 3K7NA 2EROA 4J4MA 3WV1A 1JK3A 3DTKA 1JIZA 2ERQA 2Y6DA 3LUNA 3HY7A 2X3AA 2X7MA 1I1IP 3F16A 2A8HA 5I4OA 3DWBA 5L7FA 1ZXVA 1UTTA 1SLMA 4I35A 2JT6A 1QICA 1H71P 1MMQA 1YCMA 4XCTA 4IN9A 5LABA 1BKCA 3I7GA 2RJQA 3Q2HA 5I0LA 1AYKA 5D2BA 4GR3A 5D1SA 2AYKA 4AUOA 1JIWP 3GBOA 4L63A 2OI0A 2POJA 1ASTA 3LKAA 3K7LA 4H76A 3KRYA 3EDZA 1GKDA 1OM8A 2E2DA 3KEKA 1IAEA 1GE7A 5B5PA 1DTHA 1QUAA 2K2GA 1YOUA 1S4BP 1HV5A 1C8TA 3LQ0A 1HTDA 4ILWD 3N2VA 5BOTA 2MLRA 2CKIA 2PJTA 2DW1A 3HBUP 1XFWA 3ZVSA 2CLTA 2OVXA 2K9CA 3L0TA 4WF6A 5CUHA 1GE6A 1MNCA 1J7NA 2YB9A 1K7QA 4PKVA 3LIKA 3WV2A 3LE9A 5D3CA 1KAPP 3F15A 1R1HA 2N8RA 1JKYA 4PKUA 4IUWA 5BOYA 1BUVM 1ND1A 4GUYA 1UEAA 456CA 2OY4A 1Q3AA 1USNA 4HMAA 5D7WA 3DNGA 4H1QA 1CGFA 1ZVXA 1KUGA 3B2ZA 4IJOA 4PKQA 4PKWA 4PKRA 1PWUA 2JIHA 3EDHA 1FLSA 1IABA 1BIWA 1JH1A 2OW2A 3DL1A 4EFSA 3LEAA 2OZRA 4I03A 3ZUKA 3F1AA 4A3WA 3TS4A 3EWJA 4WK7A 1JAOA 1C7KA 2XS3A 1XFVA 3F18A 1OO9A 4GQLA 4AIGA 1SATA 1AKLA 2E3XA 3F19A 1KUHA 4PKSA 4L7AA 1YQYA 1OS9A 2W12A 4GR0A 2JNPA 4AXQA 1HFCA 1XM5A 1CIZA 4G9LA 3EDIA 4DV8A 1G05A 3DPEA 3CKIA 1D8MA 3U1RA 2OW1A 3LMCA 2O36A 4H84A 3LK8A 4R3VA 2D1NA 1A85A 5CXAA 1CXVA 2FV5A 4XBHA 1HOVA 3LJTA 1BM6A 2KRJA 2L0RA 4H49A 1BUDA 1OM7A 3TSKA 1AF0A 2J83A 1CGLA 3KECA 1ZXCA 1K7GA 1KUFA 1SLNA 1MMPA 2OXUA 2XS4A 3KMEA 1EUBA 3RTSA 4CTHA 5D1UA 3NX7A 3UVCA 2OXWA 3USNA 3KEJA 3MA2A 5D1TA 1BKCI 2MZHA 1C3IA 1XFYA 1XFZA 2JT5A 3HYGA 3ELMA 1G12A 3DSLA 1UTZA 2W0DA 4JQGA 2MZEA 3HB2P 3RTTA 3Q2GA 2JSDA 1KUIA 1Z3JA 1R54A 2Y6CA 2OW9A 4FU4A 1GE5A 4WZVA 3V96B 1BQOA 1QIBA 3EDGA 3EHXA 1Y8JA 5JMYA 1B8YA 2AIGP 4FVLA 966CA 1R1JA 1SU3A 4GWMA 2W15A 4H82A 1PWQA 2OW0A 4L6TA 2FV9A 4WKEA 4DPEA 5I12A 1O0TA 3BA0A 1XUDA 4WKIA 2D1OA 1TVIA 3N2UA 1BQQM 2OY2A 3KWVC 1O0QA 1OZ9A 3LJGA 1BKCE 1PWPA 2DDYA 1HFSA 1YP1A 4AYKA 1ZS0A 4JA1A 4PKTA 4JPAA 3OHLA 1FM1A 5I3MA 1FBLA 1ROSA 2TCLA 3DTIA 2ERPA 5I43A 3AYUA 3L0VA 5B5OA 2YUFA 5CZMA 5BPAA 2V4BA 1IAAA 4GR8A 1RMZA 2MZIA 1KBCA 2MLSA 1CGEA 3I7IA 4XM8A 1GKCA 830CA 4L19A 4G0DA 3KHIA 1G4KA 1G49A 2I47A 1L6JA 1JAPA 2DW0A 2O3EA 2W13A 1UMTA 1PWVA 1OM6A 4ZR5A 3HY9A 1CQRA 4H2EA 1SRPA 2DDFA 2HU6A 2WO8A 3O2XA 4H30A 1IAGA 3LILA 3WV3A 1JJ9A 1QJIA 1K7IA 4Q1LA 1BZSA 1GO8P 3TVCA 1EB6A 2WOAA 3DTEA 1JANA 3E8RA 1UMSA 5L79A 1R55A 2QPJA 4QKZA 2DW2A 1XFXA 1D7XA 3VTGA 1CAQA 4ON1A 3B92A 1IACA 1SMPA 1I73A 1ZP5A 3AIGA 3P24A 1Y93A 4DD8A 3F17A 3G42A 3O64A 2Z2DA 1MMBA 1ATLA 3VI1A 2WO9A 1GO7P 3AYKA 1MMRA 1XAXA 2J0TA 1XFUA 1BSWA 4H3XA 2OXZA 1B3DA 5H8XA 2X3CA 3ZXHA 2USNA 3LQBA 3LGPA 3SHIA 3TT4A 3EHYA 2YIGA 1GXDA 3KMCA 2SRTA 3DPFA 3HDBA 2W14A 1A86A 4GF1A 3OHOA 1G9KA 1IADA 3LUMA 4XM7A 1WNIA 4FXQA 3B8ZA 2OVZA 1Y0VA 1OS2A 1OMJA 1QJJA 1XUCA 2X3BA 4JP4A 4DF9A 1PWWA 1DMTA 1KUKA 4JIJA 1D8FA 4HX3A 3HBVP 3LIRA 3P1VA 4GWNA 4XM6A 1I76A 1D5JA 1QIAA 1HY7A 4FXYP 1RM8A 4A7BA 1JAQA 2RJPA 3LJZA 1R1IA
chains in the Genus database with same CATH topology
3HDAP 1XURA 5I2ZA 1CK7A 3G5CA 1ZTQA 1EAKA 3K7NA 2EROA 4J4MA 3WV1A 1JK3A 3DTKA 1JIZA 2ERQA 2Y6DA 3LUNA 3HY7A 2X3AA 2X7MA 1I1IP 3F16A 2A8HA 5I4OA 3DWBA 5L7FA 1ZXVA 1UTTA 1SLMA 4I35A 2JT6A 1QICA 1H71P 1MMQA 1YCMA 4XCTA 4IN9A 5LABA 1BKCA 3I7GA 2RJQA 3Q2HA 5I0LA 1AYKA 5D2BA 4GR3A 5D1SA 2AYKA 4AUOA 1JIWP 3GBOA 4L63A 2OI0A 2POJA 1ASTA 3LKAA 3K7LA 4H76A 3KRYA 3EDZA 1GKDA 1OM8A 2E2DA 3KEKA 1IAEA 1GE7A 5B5PA 1DTHA 1QUAA 2K2GA 1YOUA 1S4BP 1HV5A 1C8TA 3LQ0A 1HTDA 4ILWD 3N2VA 5BOTA 2MLRA 2CKIA 2PJTA 2DW1A 3HBUP 1XFWA 3ZVSA 2CLTA 2OVXA 2K9CA 3L0TA 4WF6A 5CUHA 1GE6A 1MNCA 1J7NA 2YB9A 1K7QA 4PKVA 3LIKA 3WV2A 3LE9A 5D3CA 1KAPP 3F15A 1R1HA 2N8RA 1JKYA 4PKUA 4IUWA 5BOYA 1BUVM 1ND1A 4GUYA 1UEAA 456CA 2OY4A 1Q3AA 1USNA 4HMAA 5D7WA 3DNGA 4H1QA 1CGFA 1ZVXA 1KUGA 3B2ZA 4IJOA 4PKQA 4PKWA 4PKRA 1PWUA 2JIHA 3EDHA 1FLSA 1IABA 1BIWA 1JH1A 2OW2A 3DL1A 4EFSA 3LEAA 2OZRA 4I03A 3ZUKA 3F1AA 4A3WA 3TS4A 3EWJA 4WK7A 1JAOA 1C7KA 2XS3A 1XFVA 3F18A 1OO9A 4GQLA 4AIGA 1SATA 1AKLA 2E3XA 3F19A 1KUHA 4PKSA 4L7AA 1YQYA 1OS9A 2W12A 4GR0A 2JNPA 4AXQA 1HFCA 1CIZA 4G9LA 3EDIA 4DV8A 1G05A 3DPEA 3CKIA 1D8MA 3U1RA 2OW1A 3LMCA 2O36A 4H84A 3LK8A 4R3VA 2D1NA 1A85A 5CXAA 1CXVA 2FV5A 4XBHA 1HOVA 3LJTA 1BM6A 2KRJA 2L0RA 4H49A 1BUDA 1OM7A 3TSKA 1AF0A 2J83A 1CGLA 3KECA 1ZXCA 1K7GA 1KUFA 1SLNA 1MMPA 2OXUA 2XS4A 3KMEA 1EUBA 3RTSA 4CTHA 5D1UA 3NX7A 3UVCA 2OXWA 3USNA 3KEJA 3MA2A 5D1TA 1BKCI 2MZHA 1C3IA 1XFYA 1XFZA 2JT5A 3HYGA 3ELMA 1G12A 3DSLA 1UTZA 2W0DA 4JQGA 2MZEA 3HB2P 3RTTA 3Q2GA 2JSDA 1KUIA 1Z3JA 1R54A 2Y6CA 2OW9A 4FU4A 1GE5A 4WZVA 3V96B 1BQOA 1QIBA 3EDGA 3EHXA 1Y8JA 5JMYA 1B8YA 2AIGP 4FVLA 966CA 1R1JA 1SU3A 4GWMA 2W15A 4H82A 1PWQA 2OW0A 4L6TA 2FV9A 4WKEA 4DPEA 5I12A 1O0TA 3BA0A 1XUDA 4WKIA 2D1OA 3N2UA 1BQQM 2OY2A 3KWVC 1O0QA 3LJGA 1BKCE 1PWPA 2DDYA 1HFSA 1YP1A 4AYKA 1ZS0A 4JA1A 4PKTA 4JPAA 3OHLA 1FM1A 5I3MA 1FBLA 1ROSA 2TCLA 3DTIA 2ERPA 5I43A 3AYUA 3L0VA 5B5OA 2YUFA 5CZMA 5BPAA 2V4BA 1IAAA 4GR8A 1RMZA 2MZIA 1KBCA 2MLSA 1CGEA 3I7IA 4XM8A 1GKCA 830CA 4L19A 4G0DA 3KHIA 1G4KA 1G49A 2I47A 1L6JA 1JAPA 2DW0A 2O3EA 2W13A 1UMTA 1PWVA 1OM6A 4ZR5A 3HY9A 1CQRA 4H2EA 1SRPA 2DDFA 2HU6A 2WO8A 3O2XA 4H30A 1IAGA 3LILA 3WV3A 1JJ9A 1QJIA 1K7IA 4Q1LA 1BZSA 1GO8P 3TVCA 1EB6A 2WOAA 3DTEA 1JANA 3E8RA 1UMSA 5L79A 1R55A 2QPJA 4QKZA 2DW2A 1XFXA 1D7XA 3VTGA 1CAQA 4ON1A 3B92A 1IACA 1SMPA 1I73A 1ZP5A 3AIGA 3P24A 1Y93A 4DD8A 3F17A 3G42A 3O64A 2Z2DA 1MMBA 1ATLA 3VI1A 2WO9A 1GO7P 3AYKA 1MMRA 2J0TA 1XFUA 1BSWA 4H3XA 2OXZA 1B3DA 5H8XA 2X3CA 3ZXHA 2USNA 3LQBA 3LGPA 3SHIA 3TT4A 3EHYA 2YIGA 1GXDA 3KMCA 2SRTA 3DPFA 3HDBA 2W14A 1A86A 4GF1A 3OHOA 1G9KA 1IADA 3LUMA 4XM7A 1WNIA 4FXQA 3B8ZA 2OVZA 1Y0VA 1OS2A 1OMJA 1QJJA 1XUCA 2X3BA 4JP4A 4DF9A 1PWWA 1DMTA 1KUKA 4JIJA 1D8FA 4HX3A 3HBVP 3LIRA 3P1VA 4GWNA 4XM6A 1I76A 1D5JA 1QIAA 1HY7A 4FXYP 1RM8A 4A7BA 1JAQA 2RJPA 3LJZA 1R1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HDA P;  1XUR A;  5I2Z A;  1CK7 A;  3G5C A;  1ZTQ A;  1EAK A;  3K7N A;  2ERO A;  4J4M A;  3WV1 A;  1JK3 A;  1JIZ A;  2ERQ A;  2Y6D A;  3LUN A;  3HY7 A;  2X3A A;  2X7M A;  1I1I P;  3F16 A;  2A8H A;  5I4O A;  3DWB A;  5L7F A;  1ZXV A;  1UTT A;  1SLM A;  4I35 A;  2JT6 A;  1QIC A;  1H71 P;  1MMQ A;  1YCM A;  4XCT A;  4IN9 A;  5LAB A;  1BKC A;  3I7G A;  2RJQ A;  3Q2H A;  5I0L A;  1AYK A;  5D2B A;  4GR3 A;  5D1S A;  2AYK A;  4AUO A;  1JIW P;  3GBO A;  4L63 A;  2OI0 A;  2POJ A;  1AST A;  3LKA A;  3K7L A;  4H76 A;  3KRY A;  3EDZ A;  1GKD A;  1OM8 A;  2E2D A;  3KEK A;  1IAE A;  1GE7 A;  5B5P A;  1DTH A;  1QUA A;  2K2G A;  1YOU A;  1S4B P;  1HV5 A;  1C8T A;  3LQ0 A;  1HTD A;  4ILW D;  3N2V A;  5BOT A;  2MLR A;  2CKI A;  2PJT A;  2DW1 A;  3HBU P;  1XFW A;  3ZVS A;  2CLT A;  2OVX A;  2K9C A;  3L0T A;  4WF6 A;  5CUH A;  1GE6 A;  1MNC A;  1J7N A;  2YB9 A;  1K7Q A;  4PKV A;  3LIK A;  3WV2 A;  3LE9 A;  5D3C A;  1KAP P;  3F15 A;  1R1H A;  2N8R A;  1JKY A;  4PKU A;  4IUW A;  5BOY A;  1BUV M;  1ND1 A;  4GUY A;  1UEA A;  456C A;  2OY4 A;  1Q3A A;  1USN A;  4HMA A;  5D7W A;  3DNG A;  4H1Q A;  1CGF A;  1ZVX A;  1KUG A;  3B2Z A;  4IJO A;  4PKQ A;  4PKW A;  4PKR A;  1PWU A;  2JIH A;  3EDH A;  1FLS A;  1IAB A;  1BIW A;  1JH1 A;  2OW2 A;  3DL1 A;  4EFS A;  3LEA A;  2OZR A;  4I03 A;  3ZUK A;  3F1A A;  4A3W A;  3TS4 A;  3EWJ A;  4WK7 A;  1JAO A;  1C7K A;  2XS3 A;  1XFV A;  3F18 A;  1OO9 A;  4GQL A;  4AIG A;  1SAT A;  1AKL A;  2E3X A;  3F19 A;  1KUH A;  4PKS A;  1YQY A;  1OS9 A;  2W12 A;  4GR0 A;  2JNP A;  4AXQ A;  1HFC A;  1CIZ A;  4G9L A;  3EDI A;  4DV8 A;  1G05 A;  3DPE A;  3CKI A;  1D8M A;  3U1R A;  2OW1 A;  3LMC A;  2O36 A;  4H84 A;  3LK8 A;  4R3V A;  2D1N A;  1A85 A;  5CXA A;  1CXV A;  2FV5 A;  4XBH A;  1HOV A;  3LJT A;  1BM6 A;  2KRJ A;  2L0R A;  4H49 A;  1BUD A;  1OM7 A;  3TSK A;  1AF0 A;  2J83 A;  1CGL A;  3KEC A;  1ZXC A;  1K7G A;  1KUF A;  1SLN A;  1MMP A;  2OXU A;  2XS4 A;  3KME A;  1EUB A;  3RTS A;  4CTH A;  5D1U A;  3NX7 A;  3UVC A;  2OXW A;  3USN A;  3KEJ A;  3MA2 A;  5D1T A;  1BKC I;  2MZH A;  1C3I A;  1XFY A;  1XFZ A;  2JT5 A;  3HYG A;  3ELM A;  1G12 A;  3DSL A;  1UTZ A;  2W0D A;  4JQG A;  2MZE A;  3HB2 P;  3RTT A;  3Q2G A;  2JSD A;  1KUI A;  1Z3J A;  1R54 A;  2Y6C A;  2OW9 A;  4FU4 A;  1GE5 A;  4WZV A;  3V96 B;  1BQO A;  1QIB A;  3EDG A;  3EHX A;  1Y8J A;  5JMY A;  1B8Y A;  2AIG P;  4FVL A;  966C A;  1R1J A;  1SU3 A;  4GWM A;  2W15 A;  4H82 A;  1PWQ A;  2OW0 A;  4L6T A;  2FV9 A;  4WKE A;  4DPE A;  5I12 A;  1O0T A;  3BA0 A;  1XUD A;  4WKI A;  2D1O A;  3N2U A;  1BQQ M;  2OY2 A;  3KWV C;  1O0Q A;  3LJG A;  1BKC E;  1PWP A;  2DDY A;  1HFS A;  1YP1 A;  4AYK A;  1ZS0 A;  4JA1 A;  4PKT A;  4JPA A;  3OHL A;  1FM1 A;  5I3M A;  1FBL A;  1ROS A;  2TCL A;  2ERP A;  5I43 A;  3AYU A;  3L0V A;  5B5O A;  5CZM A;  5BPA A;  2V4B A;  1IAA A;  4GR8 A;  1RMZ A;  2MZI A;  1KBC A;  2MLS A;  1CGE A;  3I7I A;  4XM8 A;  1GKC A;  830C A;  4L19 A;  4G0D A;  3KHI A;  1G4K A;  1G49 A;  2I47 A;  1L6J A;  1JAP A;  2DW0 A;  2O3E A;  2W13 A;  1UMT A;  1PWV A;  1OM6 A;  4ZR5 A;  3HY9 A;  1CQR A;  4H2E A;  1SRP A;  2DDF A;  2HU6 A;  2WO8 A;  3O2X A;  4H30 A;  1IAG A;  3LIL A;  3WV3 A;  1JJ9 A;  1QJI A;  1K7I A;  4Q1L A;  1BZS A;  1GO8 P;  3TVC A;  1EB6 A;  2WOA A;  1JAN A;  3E8R A;  1UMS A;  5L79 A;  1R55 A;  2QPJ A;  4QKZ A;  2DW2 A;  1XFX A;  1D7X A;  3VTG A;  1CAQ A;  4ON1 A;  3B92 A;  1IAC A;  1SMP A;  1I73 A;  1ZP5 A;  3AIG A;  3P24 A;  1Y93 A;  4DD8 A;  3F17 A;  3G42 A;  3O64 A;  2Z2D A;  1MMB A;  1ATL A;  3VI1 A;  2WO9 A;  1GO7 P;  3AYK A;  1MMR A;  2J0T A;  1XFU A;  1BSW A;  4H3X A;  2OXZ A;  1B3D A;  5H8X A;  2X3C A;  3ZXH A;  2USN A;  3LQB A;  3LGP A;  3SHI A;  3TT4 A;  3EHY A;  2YIG A;  1GXD A;  3KMC A;  2SRT A;  3DPF A;  3HDB A;  2W14 A;  1A86 A;  4GF1 A;  3OHO A;  1G9K A;  1IAD A;  3LUM A;  4XM7 A;  1WNI A;  4FXQ A;  3B8Z A;  2OVZ A;  1Y0V A;  1OS2 A;  1OMJ A;  1QJJ A;  1XUC A;  2X3B A;  4JP4 A;  4DF9 A;  1PWW A;  1DMT A;  1KUK A;  4JIJ A;  1D8F A;  4HX3 A;  3HBV P;  3LIR A;  3P1V A;  4GWN A;  4XM6 A;  1I76 A;  1D5J A;  1QIA A;  1HY7 A;  4FXY P;  1RM8 A;  4A7B A;  1JAQ A;  2RJP A;  3LJZ A;  1R1I A; 
#chains in the Genus database with same CATH topology
 3HDA P;  1XUR A;  5I2Z A;  1CK7 A;  3G5C A;  1ZTQ A;  1EAK A;  3K7N A;  2ERO A;  4J4M A;  3WV1 A;  1JK3 A;  3DTK A;  1JIZ A;  2ERQ A;  2Y6D A;  3LUN A;  3HY7 A;  2X3A A;  2X7M A;  1I1I P;  3F16 A;  2A8H A;  5I4O A;  3DWB A;  5L7F A;  1ZXV A;  1UTT A;  1SLM A;  4I35 A;  2JT6 A;  1QIC A;  1H71 P;  1MMQ A;  1YCM A;  4XCT A;  4IN9 A;  5LAB A;  1BKC A;  3I7G A;  2RJQ A;  3Q2H A;  5I0L A;  1AYK A;  5D2B A;  4GR3 A;  5D1S A;  2AYK A;  4AUO A;  1JIW P;  3GBO A;  4L63 A;  2OI0 A;  2POJ A;  1AST A;  3LKA A;  3K7L A;  4H76 A;  3KRY A;  3EDZ A;  1GKD A;  1OM8 A;  2E2D A;  3KEK A;  1IAE A;  1GE7 A;  5B5P A;  1DTH A;  1QUA A;  2K2G A;  1YOU A;  1S4B P;  1HV5 A;  1C8T A;  3LQ0 A;  1HTD A;  4ILW D;  3N2V A;  5BOT A;  2MLR A;  2CKI A;  2PJT A;  2DW1 A;  3HBU P;  1XFW A;  3ZVS A;  2CLT A;  2OVX A;  2K9C A;  3L0T A;  4WF6 A;  5CUH A;  1GE6 A;  1MNC A;  1J7N A;  2YB9 A;  1K7Q A;  4PKV A;  3LIK A;  3WV2 A;  3LE9 A;  5D3C A;  1KAP P;  3F15 A;  1R1H A;  2N8R A;  1JKY A;  4PKU A;  4IUW A;  5BOY A;  1BUV M;  1ND1 A;  4GUY A;  1UEA A;  456C A;  2OY4 A;  1Q3A A;  1USN A;  4HMA A;  5D7W A;  3DNG A;  4H1Q A;  1CGF A;  1ZVX A;  1KUG A;  3B2Z A;  4IJO A;  4PKQ A;  4PKW A;  4PKR A;  1PWU A;  2JIH A;  3EDH A;  1FLS A;  1IAB A;  1BIW A;  1JH1 A;  2OW2 A;  3DL1 A;  4EFS A;  3LEA A;  2OZR A;  4I03 A;  3ZUK A;  3F1A A;  4A3W A;  3TS4 A;  3EWJ A;  4WK7 A;  1JAO A;  1C7K A;  2XS3 A;  1XFV A;  3F18 A;  1OO9 A;  4GQL A;  4AIG A;  1SAT A;  1AKL A;  2E3X A;  3F19 A;  1KUH A;  4PKS A;  4L7A A;  1YQY A;  1OS9 A;  2W12 A;  4GR0 A;  2JNP A;  4AXQ A;  1HFC A;  1XM5 A;  1CIZ A;  4G9L A;  3EDI A;  4DV8 A;  1G05 A;  3DPE A;  3CKI A;  1D8M A;  3U1R A;  2OW1 A;  3LMC A;  2O36 A;  4H84 A;  3LK8 A;  4R3V A;  2D1N A;  1A85 A;  5CXA A;  1CXV A;  2FV5 A;  4XBH A;  1HOV A;  3LJT A;  1BM6 A;  2KRJ A;  2L0R A;  4H49 A;  1BUD A;  1OM7 A;  3TSK A;  1AF0 A;  2J83 A;  1CGL A;  3KEC A;  1ZXC A;  1K7G A;  1KUF A;  1SLN A;  1MMP A;  2OXU A;  2XS4 A;  3KME A;  1EUB A;  3RTS A;  4CTH A;  5D1U A;  3NX7 A;  3UVC A;  2OXW A;  3USN A;  3KEJ A;  3MA2 A;  5D1T A;  1BKC I;  2MZH A;  1C3I A;  1XFY A;  1XFZ A;  2JT5 A;  3HYG A;  3ELM A;  1G12 A;  3DSL A;  1UTZ A;  2W0D A;  4JQG A;  2MZE A;  3HB2 P;  3RTT A;  3Q2G A;  2JSD A;  1KUI A;  1Z3J A;  1R54 A;  2Y6C A;  2OW9 A;  4FU4 A;  1GE5 A;  4WZV A;  3V96 B;  1BQO A;  1QIB A;  3EDG A;  3EHX A;  1Y8J A;  5JMY A;  1B8Y A;  2AIG P;  4FVL A;  966C A;  1R1J A;  1SU3 A;  4GWM A;  2W15 A;  4H82 A;  1PWQ A;  2OW0 A;  4L6T A;  2FV9 A;  4WKE A;  4DPE A;  5I12 A;  1O0T A;  3BA0 A;  1XUD A;  4WKI A;  2D1O A;  1TVI A;  3N2U A;  1BQQ M;  2OY2 A;  3KWV C;  1O0Q A;  1OZ9 A;  3LJG A;  1BKC E;  1PWP A;  2DDY A;  1HFS A;  1YP1 A;  4AYK A;  1ZS0 A;  4JA1 A;  4PKT A;  4JPA A;  3OHL A;  1FM1 A;  5I3M A;  1FBL A;  1ROS A;  2TCL A;  3DTI A;  2ERP A;  5I43 A;  3AYU A;  3L0V A;  5B5O A;  2YUF A;  5CZM A;  5BPA A;  2V4B A;  1IAA A;  4GR8 A;  1RMZ A;  2MZI A;  1KBC A;  2MLS A;  1CGE A;  3I7I A;  4XM8 A;  1GKC A;  830C A;  4L19 A;  4G0D A;  3KHI A;  1G4K A;  1G49 A;  2I47 A;  1L6J A;  1JAP A;  2DW0 A;  2O3E A;  2W13 A;  1UMT A;  1PWV A;  1OM6 A;  4ZR5 A;  3HY9 A;  1CQR A;  4H2E A;  1SRP A;  2DDF A;  2HU6 A;  2WO8 A;  3O2X A;  4H30 A;  1IAG A;  3LIL A;  3WV3 A;  1JJ9 A;  1QJI A;  1K7I A;  4Q1L A;  1BZS A;  1GO8 P;  3TVC A;  1EB6 A;  2WOA A;  3DTE A;  1JAN A;  3E8R A;  1UMS A;  5L79 A;  1R55 A;  2QPJ A;  4QKZ A;  2DW2 A;  1XFX A;  1D7X A;  3VTG A;  1CAQ A;  4ON1 A;  3B92 A;  1IAC A;  1SMP A;  1I73 A;  1ZP5 A;  3AIG A;  3P24 A;  1Y93 A;  4DD8 A;  3F17 A;  3G42 A;  3O64 A;  2Z2D A;  1MMB A;  1ATL A;  3VI1 A;  2WO9 A;  1GO7 P;  3AYK A;  1MMR A;  1XAX A;  2J0T A;  1XFU A;  1BSW A;  4H3X A;  2OXZ A;  1B3D A;  5H8X A;  2X3C A;  3ZXH A;  2USN A;  3LQB A;  3LGP A;  3SHI A;  3TT4 A;  3EHY A;  2YIG A;  1GXD A;  3KMC A;  2SRT A;  3DPF A;  3HDB A;  2W14 A;  1A86 A;  4GF1 A;  3OHO A;  1G9K A;  1IAD A;  3LUM A;  4XM7 A;  1WNI A;  4FXQ A;  3B8Z A;  2OVZ A;  1Y0V A;  1OS2 A;  1OMJ A;  1QJJ A;  1XUC A;  2X3B A;  4JP4 A;  4DF9 A;  1PWW A;  1DMT A;  1KUK A;  4JIJ A;  1D8F A;  4HX3 A;  3HBV P;  3LIR A;  3P1V A;  4GWN A;  4XM6 A;  1I76 A;  1D5J A;  1QIA A;  1HY7 A;  4FXY P;  1RM8 A;  4A7B A;  1JAQ A;  2RJP A;  3LJZ A;  1R1I A; 
#chains in the Genus database with same CATH homology
 3HDA P;  1XUR A;  5I2Z A;  1CK7 A;  3G5C A;  1ZTQ A;  1EAK A;  3K7N A;  2ERO A;  4J4M A;  3WV1 A;  1JK3 A;  3DTK A;  1JIZ A;  2ERQ A;  2Y6D A;  3LUN A;  3HY7 A;  2X3A A;  2X7M A;  1I1I P;  3F16 A;  2A8H A;  5I4O A;  3DWB A;  5L7F A;  1ZXV A;  1UTT A;  1SLM A;  4I35 A;  2JT6 A;  1QIC A;  1H71 P;  1MMQ A;  1YCM A;  4XCT A;  4IN9 A;  5LAB A;  1BKC A;  3I7G A;  2RJQ A;  3Q2H A;  5I0L A;  1AYK A;  5D2B A;  4GR3 A;  5D1S A;  2AYK A;  4AUO A;  1JIW P;  3GBO A;  4L63 A;  2OI0 A;  2POJ A;  1AST A;  3LKA A;  3K7L A;  4H76 A;  3KRY A;  3EDZ A;  1GKD A;  1OM8 A;  2E2D A;  3KEK A;  1IAE A;  1GE7 A;  5B5P A;  1DTH A;  1QUA A;  2K2G A;  1YOU A;  1S4B P;  1HV5 A;  1C8T A;  3LQ0 A;  1HTD A;  4ILW D;  3N2V A;  5BOT A;  2MLR A;  2CKI A;  2PJT A;  2DW1 A;  3HBU P;  1XFW A;  3ZVS A;  2CLT A;  2OVX A;  2K9C A;  3L0T A;  4WF6 A;  5CUH A;  1GE6 A;  1MNC A;  1J7N A;  2YB9 A;  1K7Q A;  4PKV A;  3LIK A;  3WV2 A;  3LE9 A;  5D3C A;  1KAP P;  3F15 A;  1R1H A;  2N8R A;  1JKY A;  4PKU A;  4IUW A;  5BOY A;  1BUV M;  1ND1 A;  4GUY A;  1UEA A;  456C A;  2OY4 A;  1Q3A A;  1USN A;  4HMA A;  5D7W A;  3DNG A;  4H1Q A;  1CGF A;  1ZVX A;  1KUG A;  3B2Z A;  4IJO A;  4PKQ A;  4PKW A;  4PKR A;  1PWU A;  2JIH A;  3EDH A;  1FLS A;  1IAB A;  1BIW A;  1JH1 A;  2OW2 A;  3DL1 A;  4EFS A;  3LEA A;  2OZR A;  4I03 A;  3ZUK A;  3F1A A;  4A3W A;  3TS4 A;  3EWJ A;  4WK7 A;  1JAO A;  1C7K A;  2XS3 A;  1XFV A;  3F18 A;  1OO9 A;  4GQL A;  4AIG A;  1SAT A;  1AKL A;  2E3X A;  3F19 A;  1KUH A;  4PKS A;  4L7A A;  1YQY A;  1OS9 A;  2W12 A;  4GR0 A;  2JNP A;  4AXQ A;  1HFC A;  1CIZ A;  4G9L A;  3EDI A;  4DV8 A;  1G05 A;  3DPE A;  3CKI A;  1D8M A;  3U1R A;  2OW1 A;  3LMC A;  2O36 A;  4H84 A;  3LK8 A;  4R3V A;  2D1N A;  1A85 A;  5CXA A;  1CXV A;  2FV5 A;  4XBH A;  1HOV A;  3LJT A;  1BM6 A;  2KRJ A;  2L0R A;  4H49 A;  1BUD A;  1OM7 A;  3TSK A;  1AF0 A;  2J83 A;  1CGL A;  3KEC A;  1ZXC A;  1K7G A;  1KUF A;  1SLN A;  1MMP A;  2OXU A;  2XS4 A;  3KME A;  1EUB A;  3RTS A;  4CTH A;  5D1U A;  3NX7 A;  3UVC A;  2OXW A;  3USN A;  3KEJ A;  3MA2 A;  5D1T A;  1BKC I;  2MZH A;  1C3I A;  1XFY A;  1XFZ A;  2JT5 A;  3HYG A;  3ELM A;  1G12 A;  3DSL A;  1UTZ A;  2W0D A;  4JQG A;  2MZE A;  3HB2 P;  3RTT A;  3Q2G A;  2JSD A;  1KUI A;  1Z3J A;  1R54 A;  2Y6C A;  2OW9 A;  4FU4 A;  1GE5 A;  4WZV A;  3V96 B;  1BQO A;  1QIB A;  3EDG A;  3EHX A;  1Y8J A;  5JMY A;  1B8Y A;  2AIG P;  4FVL A;  966C A;  1R1J A;  1SU3 A;  4GWM A;  2W15 A;  4H82 A;  1PWQ A;  2OW0 A;  4L6T A;  2FV9 A;  4WKE A;  4DPE A;  5I12 A;  1O0T A;  3BA0 A;  1XUD A;  4WKI A;  2D1O A;  3N2U A;  1BQQ M;  2OY2 A;  3KWV C;  1O0Q A;  3LJG A;  1BKC E;  1PWP A;  2DDY A;  1HFS A;  1YP1 A;  4AYK A;  1ZS0 A;  4JA1 A;  4PKT A;  4JPA A;  3OHL A;  1FM1 A;  5I3M A;  1FBL A;  1ROS A;  2TCL A;  3DTI A;  2ERP A;  5I43 A;  3AYU A;  3L0V A;  5B5O A;  2YUF A;  5CZM A;  5BPA A;  2V4B A;  1IAA A;  4GR8 A;  1RMZ A;  2MZI A;  1KBC A;  2MLS A;  1CGE A;  3I7I A;  4XM8 A;  1GKC A;  830C A;  4L19 A;  4G0D A;  3KHI A;  1G4K A;  1G49 A;  2I47 A;  1L6J A;  1JAP A;  2DW0 A;  2O3E A;  2W13 A;  1UMT A;  1PWV A;  1OM6 A;  4ZR5 A;  3HY9 A;  1CQR A;  4H2E A;  1SRP A;  2DDF A;  2HU6 A;  2WO8 A;  3O2X A;  4H30 A;  1IAG A;  3LIL A;  3WV3 A;  1JJ9 A;  1QJI A;  1K7I A;  4Q1L A;  1BZS A;  1GO8 P;  3TVC A;  1EB6 A;  2WOA A;  3DTE A;  1JAN A;  3E8R A;  1UMS A;  5L79 A;  1R55 A;  2QPJ A;  4QKZ A;  2DW2 A;  1XFX A;  1D7X A;  3VTG A;  1CAQ A;  4ON1 A;  3B92 A;  1IAC A;  1SMP A;  1I73 A;  1ZP5 A;  3AIG A;  3P24 A;  1Y93 A;  4DD8 A;  3F17 A;  3G42 A;  3O64 A;  2Z2D A;  1MMB A;  1ATL A;  3VI1 A;  2WO9 A;  1GO7 P;  3AYK A;  1MMR A;  2J0T A;  1XFU A;  1BSW A;  4H3X A;  2OXZ A;  1B3D A;  5H8X A;  2X3C A;  3ZXH A;  2USN A;  3LQB A;  3LGP A;  3SHI A;  3TT4 A;  3EHY A;  2YIG A;  1GXD A;  3KMC A;  2SRT A;  3DPF A;  3HDB A;  2W14 A;  1A86 A;  4GF1 A;  3OHO A;  1G9K A;  1IAD A;  3LUM A;  4XM7 A;  1WNI A;  4FXQ A;  3B8Z A;  2OVZ A;  1Y0V A;  1OS2 A;  1OMJ A;  1QJJ A;  1XUC A;  2X3B A;  4JP4 A;  4DF9 A;  1PWW A;  1DMT A;  1KUK A;  4JIJ A;  1D8F A;  4HX3 A;  3HBV P;  3LIR A;  3P1V A;  4GWN A;  4XM6 A;  1I76 A;  1D5J A;  1QIA A;  1HY7 A;  4FXY P;  1RM8 A;  4A7B A;  1JAQ A;  2RJP A;  3LJZ A;  1R1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...