5BPVA

Crystal structure of zaire ebolavirus vp35 rna binding domain mutant i278a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
b'PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALAQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Crystal Structure of Zaire ebolavirus VP35 RNA binding domain mutant I278A
rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 39
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5bpvA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 5bpvA02
4GHAA 4IBBA 4IBKA 3FKEA 3KS4A 3L28A 4IBCA 3KS8A 3L27A 4IBGA 4GHLA 5BPVA 4GH9A 4IBDA 4LG2A 4IBFA 4IJEA 4IBIA 3L2AA 4IBJA 3L26A 4IBEA 3L29A 4IJFA 3L25A
chains in the Genus database with same CATH superfamily
1Z5BA 2L4EA 1SG9A 4AQYM 5IREB 2H5XA 2BWBA 5FTJA 3FUWA 3VKHA 1E6PA 1BVSA 1O6IA 1E94E 1VEGA 1ZQ9A 2CHQA 3U61A 2J7NA 2JWSA 7CATA 1G41A 3B89A 1QDTA 4M9ZA 3GLHE 1E9RA 2DAGA 3B7NA 1DO0A 2XLJA 1QUTA 1MN3A 4OW0A 3VDPA 5DYGA 1OIZA 2FS1A 4TUWA 4W5WA 1OIPA 2JZ1A 2D7GA 1TTEA 2Y2QA 1N32M 2WZJA 4ZPXA 4GEWA 4JV5M 4HMCA 1NNUC 2DENA 4M9SA 3GQ3A 3SYLA 2DHYA 3J2PB 2XD5A 2JE5A 2ZM6M 4FW9A 4QNLA 1IN5A 4IBKA 2LTUA 4LJ9A 4G4QA 2CV1A 2HHHM 4JI8M 1YU2A 4LFCM 1AIPC 2HL7A 5C18A 2FFFB 4NRVA 2RTSA 3DA1A 4DV5M 1YU4A 5EXTA 1QAQA 3N3FA 1E32A 2RGOA 3R9XB 3SMSA 3KVWA 1QO6A 3ZCBB 5FSWA 1AIWA 1XMQM 5KPZA 3SAVA 2HKJA 2DZNB 2KNAA 3A42A 4GITA 5EXSA 4R71A 3PVSA 4YY3M 1W5SA 1XWIA 2J7OA 3I51A 5JI3E 1KSFX 1JR3E 2C96A 5A2QS 1EFUB 1L1TA 3FTFA 3FYDA 1HQYE 4MGYE 3C58A 3RE8A 1IXSB 5FTNA 4DV6M 3SMPA 4HLQA 4ANRA 4NXNM 1HQCA 1NY6A 4FD2A 3QAUA 3PNVA 3LQQA 3ILKA 4LJ7A 3TWKA 4DR5M 2D7HA 4KODA 4MB3A 2B3TA 4DR4M 2RKOA 3KS4A 1DGFA 5BR8M 2O01F 4B7HA 3SBJA 1J09A 1IXRC 1GKIA 5EP4A 3VLFB 4CIZA 5ITRA 2DZOB 2VQEM 3K92A 1YU3A 4FVMA 1NO1A 3WHLA 3SASA 3A45A 3IHPA 4LZJA 4D82A 5KPTA 3EIEA 2CEAA 2D7EA 4L78A 1IXSA 2LVAA 4NSRA 1GOIA 3E4RA 2YQZA 1W1TA 3AOGA 2D49A 2EKFA 4G3OA 4PDGA 1Q3BA 4MGHA 1OGBA 1WGLA 4B7FA 2F5SA 2Q2EB 1HJPA 2Z7JA 4D81A 1HR0M 1TF0B 5ITTA 1E15A 1N78A 3E46A 1N36M 1W5TA 1Q3CA 2C5RA 2GQFA 1L6JA 1YSYA 2R18A 1QDRA 1SXJC 4G4OA 4AKIA 3KP0E 3GLIE 2LNHC 2MJ5B 3NWLA 2BJWA 1I4WA 4LRTA 8CATA 3JR5A 1PDCA 1MX0A 2ZANA 4RKUF 2V6ZM 2M60A 2VIIA 1VG5A 1SXJE 1T43A 5KPRA 1DV0A 4X64M 3LW5F 4A3VB 2Z8YM 4Z8XA 3W0FA 1IBKM 4F1IA 4PDIA 1XNQM 3GQ4A 1GPFA 2HWJA 3HKPA 1NJFA 1QAOA 5GKNA 1VEJA 3GLIB 3R8FA 4L6V6 1T3TA 3M6AA 3LVWA 3OTOM 2LVQD 2RRUA 1J5EM 4Z2LA 4Y28F 3FUUA 1JQJC 1XXHE 1DGGA 3B7ZA 3QYBA 3L29A 1IBLM 1P3QQ 2C98A 2OO9A 3PXGA 1PJQA 3MQLA 4MGIE 3UZUA 4X65M 3HSHA 3VK7A 3KOZE 1GO5A 3I4YA 4RF0A 1OQYA 2YNMD 1J7KA 4RF1A 3VKGA 3IG8A 4NL4H 4NYUA 3GO8A 2XSZA 3MMPA 4DV1M 3HY5A 5FTMA 3J7AS 1YUEA 4Z2HA 2V1UA 4KHPM 4L15A 1A5TA 1XXHB 4AKHA 2BG1A 5F3WA 1V34A 2JUJA 4BLCA 5BPVA 1TR8A 5E6JA 4S12A 3GLIA 3U6DA 2OOBA 2JNHA 4Z6YA 2A5YB 4G6ZA 4B08A 3U6QA 1ZMUA 3GRVA 1PM5A 1N77A 2LWXA 3RGSA 3SATA 1XNRM 1GXDA 1GJSA 4NZ1A 2Y0TA 4LJ4A 2DHRA 3GP1A 2QSFX 4XGIA 2X8AA 2K6BA 1PJSA 1KFVA 2LXEA 2N35A 3QYEA 1D2NA 2R4EA 2MGWA 1JB0F 1GL7A 4L16A 1FNNA 3M0EA 4GHAA 2EO2A 2R0IA 1T6OA 3KXEC 4P16A 2KW0A 2L4FA 2JY6B 1QQWA 2FN2A 2DWLA 5H37D 1XXHA 2FNAA 2G8LA 3HHWA 1S3SA 2QQ8A 3KOWE 1H6UA 2C99A 3UK6A 4MGKE 1Q39A 3GPPA 3KS8A 1GL6A 2DAIA 5EP1A 4OJ6A 3BBZA 1OKSA 2WSFF 3QWLA 2VQFM 4LJ5A 3NBIA 4I81A 3MJ5A 4EIWA 3WD4A 1V92A 4NOOB 4QNMA 4NZ5A 2VDBB 4DR7M 2C9OA 1Z5AA 3AJIB 4IBIA 4ITQA 1IQPA 4I8OA 2DAMA 3SFZA 3H4JA 2Y2JA 1IBMM 1HT2E 2EUCA 1FJGM 4M0WA 3U60B 2V1CA 2Y2KA 3TWMA 1PRBA 1WJ7A 3KOYE 4QHSA 3FRIA 4XK8F 3T15A 5FTLA 3GPYA 4QOZC 1KS0A 2HCBA 3CF0A 1V33A 3PNYA 1N33M 1NY5A 5ITQA 1XC8A 1XMOM 1VDLA 2UWXA 4DV4M 3W67A 2DI0A 2ZTCA 3SHGB 1ORYB 2LHGA 4CHTB 3B74A 3WD1A 3IECA 4IBGA 2LH0A 4DR6M 1VQ1A 4GH9A 3U6LA 4CISA 4JXJA 1N75A 2UUBM 4JI6M 2M5ZA 3GPXA 2XD1A 1AUAA 4HEOA 4LJ6A 1YU1A 2NQ8C 1R4GA 2LVPC 3U60A 2F5QA 2EKKA 3TQSA 4DR3M 2XFSA 5EP3A 1UFZA 5E26A 4LF7M 1IY1A 1D0KA 2R65A 4M9XA 4I4LA 1E6RA 2AHMA 3EIHA 3THGA 3TE6A 4B7GA 3FKEA 5FLXS 4LGMA 4LJAA 2Y21A 1C7YA 1G8PA 4NSOB 1ZV1A 4OVZB 3I4VA 3SYKA 3AKZA 2XH9A 1CK7A 3E21A 4WP2A 2XZFA 1K82A 3GRRA 4MB4A 2Y2HA 1JR3D 3KW6A 2UXDM 2X49A 3KDSE 2X4AA 4GRIA 1Z59A 2Y2LA 1HNXM 1L2DA 3KSJA 2CV0A 1CUKA 4PT5A 4JI1M 2VF7A 2JY8A 2F5OA 1LV7A 2KNZA 1VDDA 4DV3M 2MH8A 4IBEA 3KOXE 4HMDA 2ZAOA 3UGJA 3LCUA 4AW4A 2BWEA 2L09A 4OVZA 2LBCA 2ZAMA 2KA6B 2UU9M 4QNRA 4LFAM 3B7QA 3W68A 4PCZA 2DVWB 4G4NA 1EAKA 1TH2A 3SC3A 3AOEC 2F5PA 4BB9A 4OJOA 2Y2PA 2QHOB 1E8BA 1NHGC 2C9CA 3WD2A 3CTWB 2BJVA 2HAKA 2JY7A 3CF2A 3HJQA 5ITUA 2FE8A 3GLFE 2E5LM 1NJGA 3I04M 2R46A 4B3SM 2ZBKB 4LFBM 2Y2OA 1YUBA 3SAWA 3TL4X 4GKKM 2KHHA 1Z6TA 2MR9A 4Z2IA 4DV7M 4LG2A 1Z5CA 1QANA 4DR2M 3DFZA 2QENA 1IM2A 4QHTA 3PFIA 5L8RF 2UXBM 4LY6A 4P17A 4NZ4A 3GLFB 3BXWA 4OUIA 3V76A 1NVMA 1ZMWA 2JCHA 3RGPA 3FUVA 3WD0A 2UUAM 1OAOC 2R44A 4Z2KA 1K3WA 1VEKA 2L7IA 1SXJD 2DNAA 3HONA 5EXXA 1IN7A 5ITXA 4LCBA 3AV0A 1ZMVA 4DV0M 3VFDA 4LF6M 5ITYA 1IY2A 1HNZM 2KEBA 1TGUA 2UXCM 2DXIA 4DR1M 3GLFA 3LVVA 1NV9A 4IBFA 3J80S 3FTEA 4AI6A 3AOEA 1W1VA 1E88A 2R45A 4F2LA 1E9SA 3ZC7B 4B3TM 4GC9A 4OJPA 4KT0F 1X37A 2DKLA 4FWGA 4K0KM 3J27B 1UR9A 2Y2NA 4FCVA 1IN4A 2V5OA 3VK8A 3A46A 2DWMA 1R2ZA 3WX7A 3TPZA 1TH4A 3HU3A 4GKJM 3LQRA 1QVRA 1K3XA 2YFQA 4CGYB 2H1RA 1OAIA 3T1YM 1PJIA 3HX3A 2QBYB 1YLAA 4I5SA 5IZ7D 2XZUA 2R4JA 2XFTA 5DFLA 3AFHA 3K9PA 3WD3A 1MU5A 1OJLA 3FE3A 4X66M 4X62M 1PJJA 1OGGA 3SAUA 2XEPA 1E6ZA 1DGHB 4BBAA 4GC5A 3KSXA 2CE7A 4FCTA 5C1BA 4REZA 1CXWA 1DO2A 4MM3B 3CGWA 3DOAA 3FYCA 3HHXA 2K9DA 4M0DA 4DUZM 1H8PA 3GLGB 4JI0M 4NXMM 3H4MA 3W0LB 1IXZA 2J5YA 3K2LA 1GLNA 3FRHA 4DUYM 1QZEA 2JP7A 4WW0A 3U6SA 3VDUA 2QBYA 1MJGM 1XHBA 4LF5M 2EA0A 3U5ZB 3J7BA 4OU7A 1J7MA 2L6OA 5JI2E 3HHZA 4LF4M 2L2DA 3FD9A 1G71A 2CUZA 5EXPA 5DYIA 2DZLA 1QUSA 1NV8A 3LMMA 1PJTA 1DGHA 2Z4RA 2QPAA 3CF6E 2JZ0A 1WGNA 1NHWC 2Y0QA 4DV2M 4HL4A 1R5LA 3GLHB 4II7A 3GLGA 1TDZA 5KO3A 3A98B 2CWBA 4OX9M 4MGZE 1E6NA 1GVNA 1Y8GA 2Z3XA 5IT9S 3K1JA 2FFJA 2K47A 3U5ZA 2APLA 3K9OA 2OOAA 1N34M 4YHHM 3C3EA 1EIJA 1GABA 3HU1A 4AG5A 1R2YA 1W1PA 1ED7A 3FTCA 1WXQA 3C3DA 4AG6A 4GHLA 2I7NA 3T6PA 4NZ3A 2ERCA 3GQ5A 2I7PA 1QYRA 4IBDA 4NYYA 4CJ6A 2QZ4A 3C9PA 3M7GA 4PD2A 2GNOA 2R62A 2JY5A 1QZMA 3GLHA 4RNAA 4L8RC 2KNVA 1R7RA 2FOIC 4LZZA 5EJCA 2XGNA 2XF3A 4Q7JA 4IBJA 5IWAM 1Q02A 3L26A 2DWNA 1HNWM 1WR1B 2LVNC 2Y2IA 3HHYA 2KZUA 3MK6A 4LRSA 4HMEA 1C1KA 1G59A 4NRWA 3I01M 4Z2GA 2UUCM 1L1ZA 2KDLA 1XB2B 1W1YA 5ITXE 1QAMA 2KRUA 3NBXX 2F4VM 3L28A 1UR8A 4AZFA 2QCUA 5LMUM 4FWDA 1I94M 3JR4A 4GIPA 2WSEF 3TWLA 3U6PA 3SARA 1LTMA 4FCWA 1IY0A 2KZSA 3L27A 3HGIA 4JI3M 4LF9M 2DAKA 2Y20A 1IFYA 4JN6A 3AL0C 3U6OA 3UJNA 4NC6A 3SHFA 4FWHA 1ZAEA 2JA2A 1GJTA 3J81S 4DBGB 4QOSA 2BNKA 2K0BX 3UMMA 3F92A 3K8ZA 4IJEA 3U6CA 1HT1E 1F4IA 3KFUG 2WSCF 1D0MA 2P5TA 2XSZD 1JR3A 3LCVB 3U6EA 4GMQA 5EP2A 2R6FA 1WHCA 3Q8GA 2CP8A 1D0LA 4L4UA 5FTKA 4R7GA 3HU2A 4LF8M 3GRYA 3HJ8A 4IBBA 4JI7M 1OTRA 1EE8A 5KQ8A 4B3RM 2VF8A 5KQDA 1H0IA 2Y2GA 2LHCA 3FUXA 1TH3A 2O5RA 1G4AE 1OFHA 1WIVA 2G3QA 4G4RA 4MB7A 3IG5A 2MROB 1H0GA 4JI5M 4TX8A 3HZJA 2CRUA 2KXEA 4KO8A 2OPFA 1L2BA 3JAMS 4D80A 2CHVA 3D8LA 4XBOA 2CHGA 1L8QA 3ZQJA 3M7PA 1PGYA 1YU0A 4B3MM 3B9PA 4NY2A 5DNYA 2ZTDA 2DAEA 3RFWA 2L7HA 2LVOC 3BOSA 2CV2A 4MB5A 3HJSA 1SXJB 4LGYA 2QNJA 3U6MA 2IOUA 4OJ5A 4KLNA 3L25A 4Z2JA 1L2CA 3T38A 2QP9X 1NSFA 3DZDA 2OQ4A 4JYAM 3KP1E 3FUTA 4JI2M 4MH0E 4LJ8A 5EQTA 2JXNA 4IBCA 2W82A 1RU3A 3T1HM 2KRKA 1R6BX 1G3IA 1IN8A 1UM8A 4WURA 3Q8XA 2FH0A 4UN2B 4AKGA 4IIWA 3ZH9B 2O25A 3U61B 1TDHA 1OFIA 3FTDA 1DGBA 3D8BA 2EJSA 4JI4M 3GLGE 4R3DA 1SXJA 3E9SA 1KYIA 2YR0A 2G5GX 3L2AA 2Z4SA 3MHVC 1YE9A 3WHKA 1NNJA 3GPUA 2CFOA 3HWSA 5LMNM 2Y2MA 4OJLA 2F5NA 2RGHA 3GRUA 4IJFA 1IN6A 2DWZB
chains in the Genus database with same CATH topology
1Z5BA 4AQYM 5IREB 5FTJA 3VKHA 3FUWA 1E94E 1ZQ9A 2CHQA 3U61A 2J7NA 7CATA 1G41A 2XLJA 4M9ZA 1E9RA 1DO0A 4OW0A 3VDPA 5DYGA 4TUWA 4W5WA 2D7GA 2Y2QA 1N32M 4ZPXA 4JV5M 1NNUC 4M9SA 3GQ3A 3SYLA 3J2PB 2XD5A 2JE5A 2ZM6M 4FW9A 4QNLA 1IN5A 4IBKA 4LJ9A 2CV1A 4G4QA 2HHHM 4JI8M 1YU2A 4OJOA 4LFCM 2HL7A 5C18A 2FFFB 4NRVA 3DA1A 1YU4A 5EXTA 1QAQA 3N3FA 1E32A 2RGOA 3R9XB 3SMSA 3KVWA 3ZCBB 5FSWA 1XMQM 5KPZA 3SAVA 2HKJA 2DZNB 1YUEA 3A42A 4GITA 5EXSA 3PVSA 4YY3M 1W5SA 1XWIA 2J7OA 3I51A 5JI3E 1KSFX 2C96A 5A2QS 1L1TA 3FTFA 3FYDA 1HQYE 4MGYE 3C58A 3RE8A 1IXSB 5FTNA 4DV6M 3SMPA 4HLQA 4NXNM 1HQCA 1NY6A 4FD2A 3QAUA 3PNVA 3LQQA 3ILKA 4LJ7A 3TWKA 4DR5M 2D7HA 4KODA 4DR4M 2RKOA 3KS4A 1DGFA 5BR8M 4B7HA 3SBJA 1J09A 1IXRC 1GKIA 5EP4A 3VLFB 5ITRA 2DZOB 2VQEM 3K92A 1YU3A 4FVMA 3WHLA 3SASA 3A45A 4LZJA 4D82A 5KPTA 3EIEA 2CEAA 2D7EA 4L78A 4NSRA 3E4RA 2YQZA 3AOGA 4PDGA 1Q3BA 4MGHA 4B7FA 2F5SA 2Q2EB 2Z7JA 4D81A 1HR0M 5ITTA 1N78A 1N36M 1W5TA 1Q3CA 2C5RA 1YSYA 2R18A 1SXJC 4G4OA 4AKIA 3KP0E 2LNHC 3NWLA 2BJWA 1I4WA 4LRTA 8CATA 3JR5A 1MX0A 2ZANA 4DV5M 2V6ZM 2M60A 2VIIA 5KPRA 1SXJE 4X64M 4A3VB 4Z8XA 3W0FA 1IBKM 4PDIA 1XNQM 3GQ4A 3HKPA 1NJFA 1QAOA 5GKNA 3GLIB 3R8FA 1T3TA 3M6AA 3LVWA 3OTOM 1J5EM 3FUUA 1JQJC 1DGGA 3L29A 2C98A 3PXGA 4MGIE 3UZUA 4X65M 3HSHA 3VK7A 3KOZE 3I4YA 4RF0A 2YNMD 1J7KA 4RF1A 3VKGA 3IG8A 4NL4H 4NYUA 3GO8A 2XSZA 4DV1M 3J7AS 5FTMA 2V1UA 4KHPM 4L15A 1XXHB 4AKHA 2BG1A 5F3WA 1IBLM 4BLCA 5BPVA 5E6JA 3GLIA 4S12A 3U6DA 4Z6YA 3U6QA 2A5YB 4G6ZA 4B08A 3SATA 3GRVA 1PM5A 1N77A 2LWXA 3RGSA 1XNRM 4NZ1A 2Y0TA 4LJ4A 2DHRA 3GP1A 4XGIA 2X8AA 1KFVA 2LXEA 1D2NA 2R4EA 4L16A 1GL7A 1FNNA 3M0EA 4GHAA 2EO2A 3KXEC 4P16A 2KW0A 1QQWA 2DWLA 5H37D 3KOWE 1XXHA 2FNAA 2G8LA 1S3SA 3HHWA 1H6UA 2C99A 3UK6A 4MGKE 1Q39A 3GPPA 3KS8A 1GL6A 5EP1A 4OJ6A 3QWLA 2VQFM 4LJ5A 3NBIA 4I81A 3MJ5A 4EIWA 4NOOB 4QNMA 4NZ5A 4DR7M 2C9OA 1Z5AA 3AJIB 4IBIA 4ITQA 1IQPA 4I8OA 3SFZA 2Y2JA 1IBMM 1HT2E 2EUCA 1FJGM 4M0WA 3U60B 2V1CA 2Y2KA 3TWMA 3KOYE 4QHSA 5FTLA 3T15A 3GPYA 4QOZC 2HCBA 3CF0A 3PNYA 1N33M 1NY5A 5ITQA 1XC8A 1XMOM 2UWXA 4DV4M 4CHTB 3SHGB 1ORYB 4IBGA 2LH0A 4DR6M 4GH9A 3U6LA 4CISA 4JXJA 1N75A 2UUBM 4JI6M 2M5ZA 3GPXA 2XD1A 4LJ6A 1YU1A 2NQ8C 3U60A 2F5QA 3TQSA 4DR3M 2XFSA 5EP3A 5E26A 4LF7M 1IY1A 2R65A 4M9XA 4I4LA 2AHMA 3EIHA 3THGA 3TE6A 4B7GA 3FKEA 5FLXS 4LGMA 4LJAA 2Y21A 1G8PA 4NSOB 4OVZB 3I4VA 3SYKA 3AKZA 2XH9A 2XZFA 1K82A 3GRRA 2Y2HA 1JR3D 3KW6A 2UXDM 2X49A 3KDSE 2X4AA 4GRIA 1Z59A 2Y2LA 1HNXM 1L2DA 3KSJA 2CV0A 4PT5A 4JI1M 2F5OA 1LV7A 1VDDA 4DV3M 4IBEA 3KOXE 3UGJA 4AW4A 2L09A 4OVZA 2ZAMA 2KA6B 2UU9M 4QNRA 4LFAM 4PCZA 2DVWB 4G4NA 1TH2A 3SC3A 3AOEC 2F5PA 4BB9A 2Y2PA 1NHGC 2C9CA 3CTWB 2BJVA 3HJQA 3CF2A 5ITUA 2FE8A 2E5LM 4B3SM 1NJGA 2R46A 4LFBM 2ZBKB 2Y2OA 1YUBA 3SAWA 3TL4X 4GKKM 1Z6TA 4DV7M 4LG2A 1Z5CA 1QANA 4DR2M 3DFZA 2QENA 1IM2A 4QHTA 3PFIA 2UXBM 4LY6A 4NZ4A 3GLFB 4OUIA 1NVMA 2JCHA 3RGPA 3FUVA 2UUAM 1K3WA 2L7IA 1SXJD 3HONA 5EXXA 1IN7A 5ITXA 4LCBA 3AV0A 4DV0M 3VFDA 4LF6M 5ITYA 1IY2A 1HNZM 2KEBA 1TGUA 2UXCM 2DXIA 4DR1M 3GLFA 3LVVA 4IBFA 3J80S 3FTEA 4AI6A 3AOEA 2R45A 1E9SA 3ZC7B 4B3TM 4GC9A 4OJPA 1X37A 2DWZB 4FWGA 4K0KM 3J27B 2Y2NA 4FCVA 1IN4A 3VK8A 3A46A 2DWMA 1R2ZA 3WX7A 3TPZA 1TH4A 3HU3A 4GKJM 3LQRA 1QVRA 1K3XA 2YFQA 4CGYB 2H1RA 3T1YM 1PJIA 2QBYB 5IZ7D 4I5SA 2XZUA 2R4JA 2XFTA 3AFHA 1MU5A 1OJLA 4X66M 4X62M 1PJJA 3SAUA 2XEPA 1DGHB 4BBAA 4GC5A 3KSXA 2CE7A 4FCTA 5C1BA 4REZA 1DO2A 4MM3B 3DOAA 3FYCA 3HHXA 4M0DA 4DUZM 3GLGB 4JI0M 4NXMM 3H4MA 3W0LB 1IXZA 3K2LA 1GLNA 4DUYM 4WW0A 3U6SA 3VDUA 2QBYA 4LF5M 1XHBA 2EA0A 3U5ZB 3J7BA 4OU7A 2L6OA 5JI2E 3HHZA 4LF4M 3FD9A 2CUZA 5EXPA 5DYIA 3LMMA 1DGHA 2Z4RA 2QPAA 3CF6E 2Y0QA 1NHWC 4DV2M 4HL4A 3GLHB 4II7A 3GLGA 1TDZA 5KO3A 3A98B 4OX9M 4MGZE 1GVNA 2Z3XA 5IT9S 3K1JA 2FFJA 2K47A 3U5ZA 1N34M 4YHHM 3HU1A 4AG5A 1R2YA 3FTCA 1WXQA 4AG6A 4GHLA 2I7NA 4NZ3A 2ERCA 3GQ5A 2I7PA 1QYRA 4IBDA 4NYYA 2QZ4A 3M7GA 4PD2A 2R62A 3GLHA 4RNAA 1QZMA 4L8RC 1R7RA 2FOIC 4LZZA 5EJCA 2XGNA 2XF3A 4IBJA 5IWAM 3L26A 1HNWM 2DWNA 2Y2IA 3HHYA 2KZUA 3MK6A 4LRSA 1C1KA 1G59A 4NRWA 2UUCM 1L1ZA 5ITXE 1QAMA 2KRUA 2F4VM 3L28A 4AZFA 2QCUA 5LMUM 4FWDA 1I94M 3JR4A 4GIPA 3TWLA 3U6PA 3SARA 4FCWA 4JI3M 1IY0A 2KZSA 3L27A 3HGIA 4LF9M 2Y20A 4JN6A 3AL0C 3U6OA 3UJNA 3SHFA 4FWHA 1ZAEA 2JA2A 3J81S 4QOSA 2BNKA 3UMMA 3K8ZA 4IJEA 3U6CA 1HT1E 3KFUG 2P5TA 2XSZD 1JR3A 3U6EA 4GMQA 5EP2A 4L4UA 5FTKA 4R7GA 3HU2A 4LF8M 3GRYA 3HJ8A 4IBBA 4JI7M 1EE8A 5KQ8A 4B3RM 5KQDA 2Y2GA 3FUXA 1TH3A 2O5RA 1G4AE 1OFHA 4G4RA 4MB7A 3IG5A 4JI5M 2KXEA 4KO8A 2OPFA 1L2BA 3JAMS 4D80A 2CHVA 3D8LA 4XBOA 2CHGA 1L8QA 4NY2A 1YU0A 4B3MM 3B9PA 5DNYA 3RFWA 2L7HA 2CV2A 3BOSA 3HJSA 1SXJB 4LGYA 3U6MA 2IOUA 4OJ5A 4KLNA 3L25A 1L2CA 3T38A 2QP9X 1NSFA 3DZDA 2OQ4A 4JYAM 3KP1E 3FUTA 4JI2M 4MH0E 4LJ8A 5EQTA 4IBCA 2W82A 3T1HM 2KRKA 1R6BX 1G3IA 1IN8A 1UM8A 4WURA 3Q8XA 4AKGA 4IIWA 3ZH9B 3U61B 1TDHA 1OFIA 3FTDA 1DGBA 3D8BA 4JI4M 4R3DA 1SXJA 3E9SA 1KYIA 2YR0A 2G5GX 3L2AA 2Z4SA 3MHVC 1YE9A 3WHKA 1NNJA 3GPUA 2CFOA 3HWSA 5LMNM 2Y2MA 4OJLA 2F5NA 2RGHA 3GRUA 4IJFA 1IN6A 2ZAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4IBB A;  4IBK A;  3FKE A;  3KS4 A;  3L28 A;  4IBC A;  3KS8 A;  3L27 A;  4IBG A;  4GHL A;  5BPV A;  4GH9 A;  4IBD A;  4LG2 A;  4IBF A;  4IJE A;  4IBI A;  3L2A A;  4IBJ A;  3L26 A;  4IBE A;  3L29 A;  4IJF A;  3L25 A; 
#chains in the Genus database with same CATH topology
 1Z5B A;  2L4E A;  1SG9 A;  4AQY M;  5IRE B;  2H5X A;  2BWB A;  5FTJ A;  3FUW A;  3VKH A;  1E6P A;  1BVS A;  1O6I A;  1E94 E;  1VEG A;  1ZQ9 A;  2CHQ A;  3U61 A;  2J7N A;  2JWS A;  7CAT A;  1G41 A;  3B89 A;  1QDT A;  4M9Z A;  3GLH E;  1E9R A;  2DAG A;  3B7N A;  1DO0 A;  2XLJ A;  1QUT A;  1MN3 A;  4OW0 A;  3VDP A;  5DYG A;  1OIZ A;  2FS1 A;  4TUW A;  4W5W A;  1OIP A;  2JZ1 A;  2D7G A;  1TTE A;  2Y2Q A;  1N32 M;  2WZJ A;  4ZPX A;  4GEW A;  4JV5 M;  4HMC A;  1NNU C;  2DEN A;  4M9S A;  3GQ3 A;  3SYL A;  2DHY A;  3J2P B;  2XD5 A;  2JE5 A;  2ZM6 M;  4FW9 A;  4QNL A;  1IN5 A;  4IBK A;  2LTU A;  4LJ9 A;  4G4Q A;  2CV1 A;  2HHH M;  4JI8 M;  1YU2 A;  4LFC M;  1AIP C;  2HL7 A;  5C18 A;  2FFF B;  4NRV A;  2RTS A;  3DA1 A;  4DV5 M;  1YU4 A;  5EXT A;  1QAQ A;  3N3F A;  1E32 A;  2RGO A;  3R9X B;  3SMS A;  3KVW A;  1QO6 A;  3ZCB B;  5FSW A;  1AIW A;  1XMQ M;  5KPZ A;  3SAV A;  2HKJ A;  2DZN B;  2KNA A;  3A42 A;  4GIT A;  5EXS A;  4R71 A;  3PVS A;  4YY3 M;  1W5S A;  1XWI A;  2J7O A;  3I51 A;  5JI3 E;  1KSF X;  1JR3 E;  2C96 A;  5A2Q S;  1EFU B;  1L1T A;  3FTF A;  3FYD A;  1HQY E;  4MGY E;  3C58 A;  3RE8 A;  1IXS B;  5FTN A;  4DV6 M;  3SMP A;  4HLQ A;  4ANR A;  4NXN M;  1HQC A;  1NY6 A;  4FD2 A;  3QAU A;  3PNV A;  3LQQ A;  3ILK A;  4LJ7 A;  3TWK A;  4DR5 M;  2D7H A;  4KOD A;  4MB3 A;  2B3T A;  4DR4 M;  2RKO A;  3KS4 A;  1DGF A;  5BR8 M;  2O01 F;  4B7H A;  3SBJ A;  1J09 A;  1IXR C;  1GKI A;  5EP4 A;  3VLF B;  4CIZ A;  5ITR A;  2DZO B;  2VQE M;  3K92 A;  1YU3 A;  4FVM A;  1NO1 A;  3WHL A;  3SAS A;  3A45 A;  3IHP A;  4LZJ A;  4D82 A;  5KPT A;  3EIE A;  2CEA A;  2D7E A;  4L78 A;  1IXS A;  2LVA A;  4NSR A;  1GOI A;  3E4R A;  2YQZ A;  1W1T A;  3AOG A;  2D49 A;  2EKF A;  4G3O A;  4PDG A;  1Q3B A;  4MGH A;  1OGB A;  1WGL A;  4B7F A;  2F5S A;  2Q2E B;  1HJP A;  2Z7J A;  4D81 A;  1HR0 M;  1TF0 B;  5ITT A;  1E15 A;  1N78 A;  3E46 A;  1N36 M;  1W5T A;  1Q3C A;  2C5R A;  2GQF A;  1L6J A;  1YSY A;  2R18 A;  1QDR A;  1SXJ C;  4G4O A;  4AKI A;  3KP0 E;  3GLI E;  2LNH C;  2MJ5 B;  3NWL A;  2BJW A;  1I4W A;  4LRT A;  8CAT A;  3JR5 A;  1PDC A;  1MX0 A;  2ZAN A;  4RKU F;  2V6Z M;  2M60 A;  2VII A;  1VG5 A;  1SXJ E;  1T43 A;  5KPR A;  1DV0 A;  4X64 M;  3LW5 F;  4A3V B;  2Z8Y M;  4Z8X A;  3W0F A;  1IBK M;  4F1I A;  4PDI A;  1XNQ M;  3GQ4 A;  1GPF A;  2HWJ A;  3HKP A;  1NJF A;  1QAO A;  5GKN A;  1VEJ A;  3GLI B;  3R8F A;  4L6V 6;  1T3T A;  3M6A A;  3LVW A;  3OTO M;  2LVQ D;  2RRU A;  1J5E M;  4Z2L A;  4Y28 F;  3FUU A;  1JQJ C;  1XXH E;  1DGG A;  3B7Z A;  3QYB A;  3L29 A;  1IBL M;  1P3Q Q;  2C98 A;  2OO9 A;  3PXG A;  1PJQ A;  3MQL A;  4MGI E;  3UZU A;  4X65 M;  3HSH A;  3VK7 A;  3KOZ E;  1GO5 A;  3I4Y A;  4RF0 A;  1OQY A;  2YNM D;  1J7K A;  4RF1 A;  3VKG A;  3IG8 A;  4NL4 H;  4NYU A;  3GO8 A;  2XSZ A;  3MMP A;  4DV1 M;  3HY5 A;  5FTM A;  3J7A S;  1YUE A;  4Z2H A;  2V1U A;  4KHP M;  4L15 A;  1A5T A;  1XXH B;  4AKH A;  2BG1 A;  5F3W A;  1V34 A;  2JUJ A;  4BLC A;  5BPV A;  1TR8 A;  5E6J A;  4S12 A;  3GLI A;  3U6D A;  2OOB A;  2JNH A;  4Z6Y A;  2A5Y B;  4G6Z A;  4B08 A;  3U6Q A;  1ZMU A;  3GRV A;  1PM5 A;  1N77 A;  2LWX A;  3RGS A;  3SAT A;  1XNR M;  1GXD A;  1GJS A;  4NZ1 A;  2Y0T A;  4LJ4 A;  2DHR A;  3GP1 A;  2QSF X;  4XGI A;  2X8A A;  2K6B A;  1PJS A;  1KFV A;  2LXE A;  2N35 A;  3QYE A;  1D2N A;  2R4E A;  2MGW A;  1JB0 F;  1GL7 A;  4L16 A;  1FNN A;  3M0E A;  4GHA A;  2EO2 A;  2R0I A;  1T6O A;  3KXE C;  4P16 A;  2KW0 A;  2L4F A;  2JY6 B;  1QQW A;  2FN2 A;  2DWL A;  5H37 D;  1XXH A;  2FNA A;  2G8L A;  3HHW A;  1S3S A;  2QQ8 A;  3KOW E;  1H6U A;  2C99 A;  3UK6 A;  4MGK E;  1Q39 A;  3GPP A;  3KS8 A;  1GL6 A;  2DAI A;  5EP1 A;  4OJ6 A;  3BBZ A;  1OKS A;  2WSF F;  3QWL A;  2VQF M;  4LJ5 A;  3NBI A;  4I81 A;  3MJ5 A;  4EIW A;  3WD4 A;  1V92 A;  4NOO B;  4QNM A;  4NZ5 A;  2VDB B;  4DR7 M;  2C9O A;  1Z5A A;  3AJI B;  4IBI A;  4ITQ A;  1IQP A;  4I8O A;  2DAM A;  3SFZ A;  3H4J A;  2Y2J A;  1IBM M;  1HT2 E;  2EUC A;  1FJG M;  4M0W A;  3U60 B;  2V1C A;  2Y2K A;  3TWM A;  1PRB A;  1WJ7 A;  3KOY E;  4QHS A;  3FRI A;  4XK8 F;  3T15 A;  5FTL A;  3GPY A;  4QOZ C;  1KS0 A;  2HCB A;  3CF0 A;  1V33 A;  3PNY A;  1N33 M;  1NY5 A;  5ITQ A;  1XC8 A;  1XMO M;  1VDL A;  2UWX A;  4DV4 M;  3W67 A;  2DI0 A;  2ZTC A;  3SHG B;  1ORY B;  2LHG A;  4CHT B;  3B74 A;  3WD1 A;  3IEC A;  4IBG A;  2LH0 A;  4DR6 M;  1VQ1 A;  4GH9 A;  3U6L A;  4CIS A;  4JXJ A;  1N75 A;  2UUB M;  4JI6 M;  2M5Z A;  3GPX A;  2XD1 A;  1AUA A;  4HEO A;  4LJ6 A;  1YU1 A;  2NQ8 C;  1R4G A;  2LVP C;  3U60 A;  2F5Q A;  2EKK A;  3TQS A;  4DR3 M;  2XFS A;  5EP3 A;  1UFZ A;  5E26 A;  4LF7 M;  1IY1 A;  1D0K A;  2R65 A;  4M9X A;  4I4L A;  1E6R A;  2AHM A;  3EIH A;  3THG A;  3TE6 A;  4B7G A;  3FKE A;  5FLX S;  4LGM A;  4LJA A;  2Y21 A;  1C7Y A;  1G8P A;  4NSO B;  1ZV1 A;  4OVZ B;  3I4V A;  3SYK A;  3AKZ A;  2XH9 A;  1CK7 A;  3E21 A;  4WP2 A;  2XZF A;  1K82 A;  3GRR A;  4MB4 A;  2Y2H A;  1JR3 D;  3KW6 A;  2UXD M;  2X49 A;  3KDS E;  2X4A A;  4GRI A;  1Z59 A;  2Y2L A;  1HNX M;  1L2D A;  3KSJ A;  2CV0 A;  1CUK A;  4PT5 A;  4JI1 M;  2VF7 A;  2JY8 A;  2F5O A;  1LV7 A;  2KNZ A;  1VDD A;  4DV3 M;  2MH8 A;  4IBE A;  3KOX E;  4HMD A;  2ZAO A;  3UGJ A;  3LCU A;  4AW4 A;  2BWE A;  2L09 A;  4OVZ A;  2LBC A;  2ZAM A;  2KA6 B;  2UU9 M;  4QNR A;  4LFA M;  3B7Q A;  3W68 A;  4PCZ A;  2DVW B;  4G4N A;  1EAK A;  1TH2 A;  3SC3 A;  3AOE C;  2F5P A;  4BB9 A;  4OJO A;  2Y2P A;  2QHO B;  1E8B A;  1NHG C;  2C9C A;  3WD2 A;  3CTW B;  2BJV A;  2HAK A;  2JY7 A;  3CF2 A;  3HJQ A;  5ITU A;  2FE8 A;  3GLF E;  2E5L M;  1NJG A;  3I04 M;  2R46 A;  4B3S M;  2ZBK B;  4LFB M;  2Y2O A;  1YUB A;  3SAW A;  3TL4 X;  4GKK M;  2KHH A;  1Z6T A;  2MR9 A;  4Z2I A;  4DV7 M;  4LG2 A;  1Z5C A;  1QAN A;  4DR2 M;  3DFZ A;  2QEN A;  1IM2 A;  4QHT A;  3PFI A;  5L8R F;  2UXB M;  4LY6 A;  4P17 A;  4NZ4 A;  3GLF B;  3BXW A;  4OUI A;  3V76 A;  1NVM A;  1ZMW A;  2JCH A;  3RGP A;  3FUV A;  3WD0 A;  2UUA M;  1OAO C;  2R44 A;  4Z2K A;  1K3W A;  1VEK A;  2L7I A;  1SXJ D;  2DNA A;  3HON A;  5EXX A;  1IN7 A;  5ITX A;  4LCB A;  3AV0 A;  1ZMV A;  4DV0 M;  3VFD A;  4LF6 M;  5ITY A;  1IY2 A;  1HNZ M;  2KEB A;  1TGU A;  2UXC M;  2DXI A;  4DR1 M;  3GLF A;  3LVV A;  1NV9 A;  4IBF A;  3J80 S;  3FTE A;  4AI6 A;  3AOE A;  1W1V A;  1E88 A;  2R45 A;  4F2L A;  1E9S A;  3ZC7 B;  4B3T M;  4GC9 A;  4OJP A;  4KT0 F;  1X37 A;  2DKL A;  4FWG A;  4K0K M;  3J27 B;  1UR9 A;  2Y2N A;  4FCV A;  1IN4 A;  2V5O A;  3VK8 A;  3A46 A;  2DWM A;  1R2Z A;  3WX7 A;  3TPZ A;  1TH4 A;  3HU3 A;  4GKJ M;  3LQR A;  1QVR A;  1K3X A;  2YFQ A;  4CGY B;  2H1R A;  1OAI A;  3T1Y M;  1PJI A;  3HX3 A;  2QBY B;  1YLA A;  4I5S A;  5IZ7 D;  2XZU A;  2R4J A;  2XFT A;  5DFL A;  3AFH A;  3K9P A;  3WD3 A;  1MU5 A;  1OJL A;  3FE3 A;  4X66 M;  4X62 M;  1PJJ A;  1OGG A;  3SAU A;  2XEP A;  1E6Z A;  1DGH B;  4BBA A;  4GC5 A;  3KSX A;  2CE7 A;  4FCT A;  5C1B A;  4REZ A;  1CXW A;  1DO2 A;  4MM3 B;  3CGW A;  3DOA A;  3FYC A;  3HHX A;  2K9D A;  4M0D A;  4DUZ M;  1H8P A;  3GLG B;  4JI0 M;  4NXM M;  3H4M A;  3W0L B;  1IXZ A;  2J5Y A;  3K2L A;  1GLN A;  3FRH A;  4DUY M;  1QZE A;  2JP7 A;  4WW0 A;  3U6S A;  3VDU A;  2QBY A;  1MJG M;  1XHB A;  4LF5 M;  2EA0 A;  3U5Z B;  3J7B A;  4OU7 A;  1J7M A;  2L6O A;  5JI2 E;  3HHZ A;  4LF4 M;  2L2D A;  3FD9 A;  1G71 A;  2CUZ A;  5EXP A;  5DYI A;  2DZL A;  1QUS A;  1NV8 A;  3LMM A;  1PJT A;  1DGH A;  2Z4R A;  2QPA A;  3CF6 E;  2JZ0 A;  1WGN A;  1NHW C;  2Y0Q A;  4DV2 M;  4HL4 A;  1R5L A;  3GLH B;  4II7 A;  3GLG A;  1TDZ A;  5KO3 A;  3A98 B;  2CWB A;  4OX9 M;  4MGZ E;  1E6N A;  1GVN A;  1Y8G A;  2Z3X A;  5IT9 S;  3K1J A;  2FFJ A;  2K47 A;  3U5Z A;  2APL A;  3K9O A;  2OOA A;  1N34 M;  4YHH M;  3C3E A;  1EIJ A;  1GAB A;  3HU1 A;  4AG5 A;  1R2Y A;  1W1P A;  1ED7 A;  3FTC A;  1WXQ A;  3C3D A;  4AG6 A;  4GHL A;  2I7N A;  3T6P A;  4NZ3 A;  2ERC A;  3GQ5 A;  2I7P A;  1QYR A;  4IBD A;  4NYY A;  4CJ6 A;  2QZ4 A;  3C9P A;  3M7G A;  4PD2 A;  2GNO A;  2R62 A;  2JY5 A;  1QZM A;  3GLH A;  4RNA A;  4L8R C;  2KNV A;  1R7R A;  2FOI C;  4LZZ A;  5EJC A;  2XGN A;  2XF3 A;  4Q7J A;  4IBJ A;  5IWA M;  1Q02 A;  3L26 A;  2DWN A;  1HNW M;  1WR1 B;  2LVN C;  2Y2I A;  3HHY A;  2KZU A;  3MK6 A;  4LRS A;  4HME A;  1C1K A;  1G59 A;  4NRW A;  3I01 M;  4Z2G A;  2UUC M;  1L1Z A;  2KDL A;  1XB2 B;  1W1Y A;  5ITX E;  1QAM A;  2KRU A;  3NBX X;  2F4V M;  3L28 A;  1UR8 A;  4AZF A;  2QCU A;  5LMU M;  4FWD A;  1I94 M;  3JR4 A;  4GIP A;  2WSE F;  3TWL A;  3U6P A;  3SAR A;  1LTM A;  4FCW A;  1IY0 A;  2KZS A;  3L27 A;  3HGI A;  4JI3 M;  4LF9 M;  2DAK A;  2Y20 A;  1IFY A;  4JN6 A;  3AL0 C;  3U6O A;  3UJN A;  4NC6 A;  3SHF A;  4FWH A;  1ZAE A;  2JA2 A;  1GJT A;  3J81 S;  4DBG B;  4QOS A;  2BNK A;  2K0B X;  3UMM A;  3F92 A;  3K8Z A;  4IJE A;  3U6C A;  1HT1 E;  1F4I A;  3KFU G;  2WSC F;  1D0M A;  2P5T A;  2XSZ D;  1JR3 A;  3LCV B;  3U6E A;  4GMQ A;  5EP2 A;  2R6F A;  1WHC A;  3Q8G A;  2CP8 A;  1D0L A;  4L4U A;  5FTK A;  4R7G A;  3HU2 A;  4LF8 M;  3GRY A;  3HJ8 A;  4IBB A;  4JI7 M;  1OTR A;  1EE8 A;  5KQ8 A;  4B3R M;  2VF8 A;  5KQD A;  1H0I A;  2Y2G A;  2LHC A;  3FUX A;  1TH3 A;  2O5R A;  1G4A E;  1OFH A;  1WIV A;  2G3Q A;  4G4R A;  4MB7 A;  3IG5 A;  2MRO B;  1H0G A;  4JI5 M;  4TX8 A;  3HZJ A;  2CRU A;  2KXE A;  4KO8 A;  2OPF A;  1L2B A;  3JAM S;  4D80 A;  2CHV A;  3D8L A;  4XBO A;  2CHG A;  1L8Q A;  3ZQJ A;  3M7P A;  1PGY A;  1YU0 A;  4B3M M;  3B9P A;  4NY2 A;  5DNY A;  2ZTD A;  2DAE A;  3RFW A;  2L7H A;  2LVO C;  3BOS A;  2CV2 A;  4MB5 A;  3HJS A;  1SXJ B;  4LGY A;  2QNJ A;  3U6M A;  2IOU A;  4OJ5 A;  4KLN A;  3L25 A;  4Z2J A;  1L2C A;  3T38 A;  2QP9 X;  1NSF A;  3DZD A;  2OQ4 A;  4JYA M;  3KP1 E;  3FUT A;  4JI2 M;  4MH0 E;  4LJ8 A;  5EQT A;  2JXN A;  4IBC A;  2W82 A;  1RU3 A;  3T1H M;  2KRK A;  1R6B X;  1G3I A;  1IN8 A;  1UM8 A;  4WUR A;  3Q8X A;  2FH0 A;  4UN2 B;  4AKG A;  4IIW A;  3ZH9 B;  2O25 A;  3U61 B;  1TDH A;  1OFI A;  3FTD A;  1DGB A;  3D8B A;  2EJS A;  4JI4 M;  3GLG E;  4R3D A;  1SXJ A;  3E9S A;  1KYI A;  2YR0 A;  2G5G X;  3L2A A;  2Z4S A;  3MHV C;  1YE9 A;  3WHK A;  1NNJ A;  3GPU A;  2CFO A;  3HWS A;  5LMN M;  2Y2M A;  4OJL A;  2F5N A;  2RGH A;  3GRU A;  4IJF A;  1IN6 A;  2DWZ B; 
#chains in the Genus database with same CATH homology
 1Z5B A;  4AQY M;  5IRE B;  5FTJ A;  3VKH A;  3FUW A;  1E94 E;  1ZQ9 A;  2CHQ A;  3U61 A;  2J7N A;  7CAT A;  1G41 A;  2XLJ A;  4M9Z A;  1E9R A;  1DO0 A;  4OW0 A;  3VDP A;  5DYG A;  4TUW A;  4W5W A;  2D7G A;  2Y2Q A;  1N32 M;  4ZPX A;  4JV5 M;  1NNU C;  4M9S A;  3GQ3 A;  3SYL A;  3J2P B;  2XD5 A;  2JE5 A;  2ZM6 M;  4FW9 A;  4QNL A;  1IN5 A;  4IBK A;  4LJ9 A;  2CV1 A;  4G4Q A;  2HHH M;  4JI8 M;  1YU2 A;  4OJO A;  4LFC M;  2HL7 A;  5C18 A;  2FFF B;  4NRV A;  3DA1 A;  1YU4 A;  5EXT A;  1QAQ A;  3N3F A;  1E32 A;  2RGO A;  3R9X B;  3SMS A;  3KVW A;  3ZCB B;  5FSW A;  1XMQ M;  5KPZ A;  3SAV A;  2HKJ A;  2DZN B;  1YUE A;  3A42 A;  4GIT A;  5EXS A;  3PVS A;  4YY3 M;  1W5S A;  1XWI A;  2J7O A;  3I51 A;  5JI3 E;  1KSF X;  2C96 A;  5A2Q S;  1L1T A;  3FTF A;  3FYD A;  1HQY E;  4MGY E;  3C58 A;  3RE8 A;  1IXS B;  5FTN A;  4DV6 M;  3SMP A;  4HLQ A;  4NXN M;  1HQC A;  1NY6 A;  4FD2 A;  3QAU A;  3PNV A;  3LQQ A;  3ILK A;  4LJ7 A;  3TWK A;  4DR5 M;  2D7H A;  4KOD A;  4DR4 M;  2RKO A;  3KS4 A;  1DGF A;  5BR8 M;  4B7H A;  3SBJ A;  1J09 A;  1IXR C;  1GKI A;  5EP4 A;  3VLF B;  5ITR A;  2DZO B;  2VQE M;  3K92 A;  1YU3 A;  4FVM A;  3WHL A;  3SAS A;  3A45 A;  4LZJ A;  4D82 A;  5KPT A;  3EIE A;  2CEA A;  2D7E A;  4L78 A;  4NSR A;  3E4R A;  2YQZ A;  3AOG A;  4PDG A;  1Q3B A;  4MGH A;  4B7F A;  2F5S A;  2Q2E B;  2Z7J A;  4D81 A;  1HR0 M;  5ITT A;  1N78 A;  1N36 M;  1W5T A;  1Q3C A;  2C5R A;  1YSY A;  2R18 A;  1SXJ C;  4G4O A;  4AKI A;  3KP0 E;  2LNH C;  3NWL A;  2BJW A;  1I4W A;  4LRT A;  8CAT A;  3JR5 A;  1MX0 A;  2ZAN A;  4DV5 M;  2V6Z M;  2M60 A;  2VII A;  5KPR A;  1SXJ E;  4X64 M;  4A3V B;  4Z8X A;  3W0F A;  1IBK M;  4PDI A;  1XNQ M;  3GQ4 A;  3HKP A;  1NJF A;  1QAO A;  5GKN A;  3GLI B;  3R8F A;  1T3T A;  3M6A A;  3LVW A;  3OTO M;  1J5E M;  3FUU A;  1JQJ C;  1DGG A;  3L29 A;  2C98 A;  3PXG A;  4MGI E;  3UZU A;  4X65 M;  3HSH A;  3VK7 A;  3KOZ E;  3I4Y A;  4RF0 A;  2YNM D;  1J7K A;  4RF1 A;  3VKG A;  3IG8 A;  4NL4 H;  4NYU A;  3GO8 A;  2XSZ A;  4DV1 M;  3J7A S;  5FTM A;  2V1U A;  4KHP M;  4L15 A;  1XXH B;  4AKH A;  2BG1 A;  5F3W A;  1IBL M;  4BLC A;  5BPV A;  5E6J A;  3GLI A;  4S12 A;  3U6D A;  4Z6Y A;  3U6Q A;  2A5Y B;  4G6Z A;  4B08 A;  3SAT A;  3GRV A;  1PM5 A;  1N77 A;  2LWX A;  3RGS A;  1XNR M;  4NZ1 A;  2Y0T A;  4LJ4 A;  2DHR A;  3GP1 A;  4XGI A;  2X8A A;  1KFV A;  2LXE A;  1D2N A;  2R4E A;  4L16 A;  1GL7 A;  1FNN A;  3M0E A;  4GHA A;  2EO2 A;  3KXE C;  4P16 A;  2KW0 A;  1QQW A;  2DWL A;  5H37 D;  3KOW E;  1XXH A;  2FNA A;  2G8L A;  1S3S A;  3HHW A;  1H6U A;  2C99 A;  3UK6 A;  4MGK E;  1Q39 A;  3GPP A;  3KS8 A;  1GL6 A;  5EP1 A;  4OJ6 A;  3QWL A;  2VQF M;  4LJ5 A;  3NBI A;  4I81 A;  3MJ5 A;  4EIW A;  4NOO B;  4QNM A;  4NZ5 A;  4DR7 M;  2C9O A;  1Z5A A;  3AJI B;  4IBI A;  4ITQ A;  1IQP A;  4I8O A;  3SFZ A;  2Y2J A;  1IBM M;  1HT2 E;  2EUC A;  1FJG M;  4M0W A;  3U60 B;  2V1C A;  2Y2K A;  3TWM A;  3KOY E;  4QHS A;  5FTL A;  3T15 A;  3GPY A;  4QOZ C;  2HCB A;  3CF0 A;  3PNY A;  1N33 M;  1NY5 A;  5ITQ A;  1XC8 A;  1XMO M;  2UWX A;  4DV4 M;  4CHT B;  3SHG B;  1ORY B;  4IBG A;  2LH0 A;  4DR6 M;  4GH9 A;  3U6L A;  4CIS A;  4JXJ A;  1N75 A;  2UUB M;  4JI6 M;  2M5Z A;  3GPX A;  2XD1 A;  4LJ6 A;  1YU1 A;  2NQ8 C;  3U60 A;  2F5Q A;  3TQS A;  4DR3 M;  2XFS A;  5EP3 A;  5E26 A;  4LF7 M;  1IY1 A;  2R65 A;  4M9X A;  4I4L A;  2AHM A;  3EIH A;  3THG A;  3TE6 A;  4B7G A;  3FKE A;  5FLX S;  4LGM A;  4LJA A;  2Y21 A;  1G8P A;  4NSO B;  4OVZ B;  3I4V A;  3SYK A;  3AKZ A;  2XH9 A;  2XZF A;  1K82 A;  3GRR A;  2Y2H A;  1JR3 D;  3KW6 A;  2UXD M;  2X49 A;  3KDS E;  2X4A A;  4GRI A;  1Z59 A;  2Y2L A;  1HNX M;  1L2D A;  3KSJ A;  2CV0 A;  4PT5 A;  4JI1 M;  2F5O A;  1LV7 A;  1VDD A;  4DV3 M;  4IBE A;  3KOX E;  3UGJ A;  4AW4 A;  2L09 A;  4OVZ A;  2ZAM A;  2KA6 B;  2UU9 M;  4QNR A;  4LFA M;  4PCZ A;  2DVW B;  4G4N A;  1TH2 A;  3SC3 A;  3AOE C;  2F5P A;  4BB9 A;  2Y2P A;  1NHG C;  2C9C A;  3CTW B;  2BJV A;  3HJQ A;  3CF2 A;  5ITU A;  2FE8 A;  2E5L M;  4B3S M;  1NJG A;  2R46 A;  4LFB M;  2ZBK B;  2Y2O A;  1YUB A;  3SAW A;  3TL4 X;  4GKK M;  1Z6T A;  4DV7 M;  4LG2 A;  1Z5C A;  1QAN A;  4DR2 M;  3DFZ A;  2QEN A;  1IM2 A;  4QHT A;  3PFI A;  2UXB M;  4LY6 A;  4NZ4 A;  3GLF B;  4OUI A;  1NVM A;  2JCH A;  3RGP A;  3FUV A;  2UUA M;  1K3W A;  2L7I A;  1SXJ D;  3HON A;  5EXX A;  1IN7 A;  5ITX A;  4LCB A;  3AV0 A;  4DV0 M;  3VFD A;  4LF6 M;  5ITY A;  1IY2 A;  1HNZ M;  2KEB A;  1TGU A;  2UXC M;  2DXI A;  4DR1 M;  3GLF A;  3LVV A;  4IBF A;  3J80 S;  3FTE A;  4AI6 A;  3AOE A;  2R45 A;  1E9S A;  3ZC7 B;  4B3T M;  4GC9 A;  4OJP A;  1X37 A;  2DWZ B;  4FWG A;  4K0K M;  3J27 B;  2Y2N A;  4FCV A;  1IN4 A;  3VK8 A;  3A46 A;  2DWM A;  1R2Z A;  3WX7 A;  3TPZ A;  1TH4 A;  3HU3 A;  4GKJ M;  3LQR A;  1QVR A;  1K3X A;  2YFQ A;  4CGY B;  2H1R A;  3T1Y M;  1PJI A;  2QBY B;  5IZ7 D;  4I5S A;  2XZU A;  2R4J A;  2XFT A;  3AFH A;  1MU5 A;  1OJL A;  4X66 M;  4X62 M;  1PJJ A;  3SAU A;  2XEP A;  1DGH B;  4BBA A;  4GC5 A;  3KSX A;  2CE7 A;  4FCT A;  5C1B A;  4REZ A;  1DO2 A;  4MM3 B;  3DOA A;  3FYC A;  3HHX A;  4M0D A;  4DUZ M;  3GLG B;  4JI0 M;  4NXM M;  3H4M A;  3W0L B;  1IXZ A;  3K2L A;  1GLN A;  4DUY M;  4WW0 A;  3U6S A;  3VDU A;  2QBY A;  4LF5 M;  1XHB A;  2EA0 A;  3U5Z B;  3J7B A;  4OU7 A;  2L6O A;  5JI2 E;  3HHZ A;  4LF4 M;  3FD9 A;  2CUZ A;  5EXP A;  5DYI A;  3LMM A;  1DGH A;  2Z4R A;  2QPA A;  3CF6 E;  2Y0Q A;  1NHW C;  4DV2 M;  4HL4 A;  3GLH B;  4II7 A;  3GLG A;  1TDZ A;  5KO3 A;  3A98 B;  4OX9 M;  4MGZ E;  1GVN A;  2Z3X A;  5IT9 S;  3K1J A;  2FFJ A;  2K47 A;  3U5Z A;  1N34 M;  4YHH M;  3HU1 A;  4AG5 A;  1R2Y A;  3FTC A;  1WXQ A;  4AG6 A;  4GHL A;  2I7N A;  4NZ3 A;  2ERC A;  3GQ5 A;  2I7P A;  1QYR A;  4IBD A;  4NYY A;  2QZ4 A;  3M7G A;  4PD2 A;  2R62 A;  3GLH A;  4RNA A;  1QZM A;  4L8R C;  1R7R A;  2FOI C;  4LZZ A;  5EJC A;  2XGN A;  2XF3 A;  4IBJ A;  5IWA M;  3L26 A;  1HNW M;  2DWN A;  2Y2I A;  3HHY A;  2KZU A;  3MK6 A;  4LRS A;  1C1K A;  1G59 A;  4NRW A;  2UUC M;  1L1Z A;  5ITX E;  1QAM A;  2KRU A;  2F4V M;  3L28 A;  4AZF A;  2QCU A;  5LMU M;  4FWD A;  1I94 M;  3JR4 A;  4GIP A;  3TWL A;  3U6P A;  3SAR A;  4FCW A;  4JI3 M;  1IY0 A;  2KZS A;  3L27 A;  3HGI A;  4LF9 M;  2Y20 A;  4JN6 A;  3AL0 C;  3U6O A;  3UJN A;  3SHF A;  4FWH A;  1ZAE A;  2JA2 A;  3J81 S;  4QOS A;  2BNK A;  3UMM A;  3K8Z A;  4IJE A;  3U6C A;  1HT1 E;  3KFU G;  2P5T A;  2XSZ D;  1JR3 A;  3U6E A;  4GMQ A;  5EP2 A;  4L4U A;  5FTK A;  4R7G A;  3HU2 A;  4LF8 M;  3GRY A;  3HJ8 A;  4IBB A;  4JI7 M;  1EE8 A;  5KQ8 A;  4B3R M;  5KQD A;  2Y2G A;  3FUX A;  1TH3 A;  2O5R A;  1G4A E;  1OFH A;  4G4R A;  4MB7 A;  3IG5 A;  4JI5 M;  2KXE A;  4KO8 A;  2OPF A;  1L2B A;  3JAM S;  4D80 A;  2CHV A;  3D8L A;  4XBO A;  2CHG A;  1L8Q A;  4NY2 A;  1YU0 A;  4B3M M;  3B9P A;  5DNY A;  3RFW A;  2L7H A;  2CV2 A;  3BOS A;  3HJS A;  1SXJ B;  4LGY A;  3U6M A;  2IOU A;  4OJ5 A;  4KLN A;  3L25 A;  1L2C A;  3T38 A;  2QP9 X;  1NSF A;  3DZD A;  2OQ4 A;  4JYA M;  3KP1 E;  3FUT A;  4JI2 M;  4MH0 E;  4LJ8 A;  5EQT A;  4IBC A;  2W82 A;  3T1H M;  2KRK A;  1R6B X;  1G3I A;  1IN8 A;  1UM8 A;  4WUR A;  3Q8X A;  4AKG A;  4IIW A;  3ZH9 B;  3U61 B;  1TDH A;  1OFI A;  3FTD A;  1DGB A;  3D8B A;  4JI4 M;  4R3D A;  1SXJ A;  3E9S A;  1KYI A;  2YR0 A;  2G5G X;  3L2A A;  2Z4S A;  3MHV C;  1YE9 A;  3WHK A;  1NNJ A;  3GPU A;  2CFO A;  3HWS A;  5LMN M;  2Y2M A;  4OJL A;  2F5N A;  2RGH A;  3GRU A;  4IJF A;  1IN6 A;  2ZAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...