5BPVA

Crystal structure of zaire ebolavirus vp35 rna binding domain mutant i278a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALAQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Crystal Structure of Zaire ebolavirus VP35 RNA binding domain mutant I278A
rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 39
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5bpvA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 5bpvA02
3FKEA 3L28A 5BPVA 3L26A 4GH9A 4LG2A 3L29A 4IBJA 4IBCA 4GHAA 4IBIA 3L27A 4IBFA 4IJFA 4IJEA 4IBKA 4IBGA 3L2AA 4IBEA 4IBBA 3L25A 4GHLA 3KS4A 4IBDA 3KS8A
chains in the Genus database with same CATH superfamily
1TR8A 2EUCA 5EP1A 5DNYA 1HNZM 1IBMM 1KS0A 3L28A 3U6OA 2L4FA 4G4NA 2CHQA 3UGJA 3J27B 4W5WA 4LG2A 3PVSA 3SMSA 3FD9A 1BVSA 1IY2A 2Y2GA 3GLHE 4DV4M 4D80A 4PDGA 4LF4M 4OUIA 3NBIA 4NXMM 4S12A 5GKNA 3U6PA 5C18A 1JQJC 3TPZA 2XFSA 2YR0A 2JWSA 1NHGC 1MN3A 1IY0A 1H6UA 1WHCA 2GNOA 2WZJA 1E6PA 4L6V6 1K3WA 2K9DA 2KDLA 3B9PA 1Q3CA 2LVOC 3FUWA 3C58A 1G8PA 5DYGA 4G4OA 2B3TA 4DV5M 2VIIA 3FKEA 4X62M 3K1JA 3GLGB 1TTEA 3ZQJA 1GL6A 4CJ6A 2QBYA 1E6RA 4L4UA 1YUBA 4YY3M 4MGHA 3SHGB 2H1RA 1QZEA 5E26A 3LCVB 4Z8XA 3B7QA 4LY6A 4PDIA 1NJGA 2QHOB 2F5QA 1QQWA 1XNRM 3C3EA 2DNAA 4IJEA 4LJ9A 4OVZA 3VDUA 3DA1A 1QDTA 1SXJA 3LW5F 3SMPA 1R4GA 3GLIA 2DVWB 1L1TA 4LFBM 4FWGA 2UXDM 4DR3M 1NY6A 3I4VA 1PGYA 1E94E 1ZMWA 2WSEF 3KS4A 4JI1M 1L8QA 2XSZA 3BOSA 2WSCF 1TH4A 1NHWC 1MU5A 2C5RA 2H5XA 3KFUG 2C98A 3HGIA 1Z5AA 2BJWA 4RF0A 1D0KA 4R3DA 1N33M 4GKJM 1T43A 1D2NA 3KXEC 3HSHA 3LVWA 4RNAA 2ZM6M 1E8BA 1YU3A 3EIEA 3L29A 3HJ8A 2LXEA 1G41A 3SFZA 2F5OA 2JUJA 2RGOA 2CP8A 4FD2A 1PDCA 4B08A 3FRHA 4TUWA 1UR8A 3FYDA 4LRTA 4A3VB 5KPTA 4HEOA 3AL0C 1IM2A 2ZTCA 1T6OA 4IBKA 4JI8M 2JE5A 1E9SA 2DAGA 3GLHA 1NSFA 4DR4M 4M9SA 2K6BA 1XNQM 1LTMA 5KPRA 3E4RA 3UMMA 3RGSA 3WD0A 1G3IA 1GKIA 2I7PA 1OAIA 1PRBA 1GPFA 2Y2MA 3A42A 1KSFX 2LH0A 4Z6YA 5ITRA 1GXDA 1GLNA 4QNLA 2LVAA 2MJ5B 3WHLA 1Q39A 3VK7A 4FW9A 1OJLA 4GITA 1HT1E 1NJFA 2R46A 3SHFA 5IZ7D 1QAMA 2D7EA 2EKKA 2VQEM 1L1ZA 1H0IA 2BG1A 1E88A 4DR5M 3I4YA 5FTJA 4NYUA 4I81A 3GRUA 4KO8A 4IJFA 4M9XA 4AW4A 3SASA 1OGBA 3GLFE 5EXSA 1FJGM 5FTLA 3CF2A 1VG5A 3PXGA 1JB0F 1DGHB 3LVVA 4JN6A 3SAUA 1Q02A 1IFYA 2V5OA 3MQLA 4REZA 4XBOA 3DFZA 5FLXS 3FUXA 2DAEA 3FTEA 4D82A 2O25A 4DR1M 1XB2B 3U61A 1EAKA 1OQYA 2LNHC 2A5YB 3SAVA 3KS8A 1ZV1A 1NO1A 4I8OA 4BLCA 4LJ6A 4KLNA 4WW0A 4GKKM 1NNUC 3UK6A 1EIJA 1QVRA 1Y8GA 1GOIA 3B7NA 3VLFB 1QANA 3UJNA 3HHZA 5FSWA 2RTSA 1J7MA 3TWMA 1OFIA 2ZAOA 3T1YM 2Z4SA 2DWNA 1CXWA 1VQ1A 2KW0A 4DR6M 2DZLA 1LV7A 1PJSA 2JP7A 2YQZA 1I4WA 3B7ZA 2CHVA 2KZSA 4Z2KA 2ZTDA 3W68A 2Y2KA 3L25A 4NSRA 4FCWA 4OX9M 4AQYM 4DBGB 2J7OA 4QNRA 4CHTB 1AIPC 1YE9A 1YLAA 3A98B 2KXEA 5H37D 2G5GX 3D8LA 3HX3A 3OTOM 4KT0F 4Z2JA 2LBCA 1NV8A 1R2ZA 1D0MA 3HWSA 3DOAA 4NOOB 4DUYM 4OJOA 2JA2A 5LMUM 3AJIB 1ORYB 2JCHA 2XD1A 2Y2NA 4NL4H 5FTNA 3TL4X 1FNNA 4Z2LA 4MH0E 2CEAA 3B89A 5EP2A 1IXSB 3W67A 2UUBM 4P16A 5IWAM 2HHHM 2UUCM 4ANRA 4CISA 3PNYA 4OVZB 2D7HA 5C1BA 3U60A 1HJPA 4G6ZA 3GLIB 1V33A 2JNHA 2LVQD 4BB9A 4DV6M 4YHHM 2C99A 3L2AA 2DKLA 3Q8XA 3HHYA 4DV1M 4DV7M 3JAMS 2UXCM 8CATA 4MB4A 4P17A 3C3DA 3TE6A 3GLGE 3HJQA 4LF6M 2JY8A 1OIPA 1MJGM 2KZUA 2XEPA 3NWLA 4L16A 4OJ6A 1UR9A 2M60A 4ZPXA 2Y2LA 1GL7A 3RGPA 1G59A 2V1CA 4QHTA 5L8RF 1N75A 3SATA 3U5ZA 4JI5M 2Y2PA 1XXHB 3A46A 2RRUA 2DHYA 3CF0A 1HQYE 3M7GA 4NXNM 3MK6A 4R71A 2DWMA 4B3RM 2YNMD 2D49A 1AIWA 5DFLA 1YSYA 1Z5BA 2KNVA 2G3QA 2DZNB 1ZMUA 2J5YA 3I51A 2Y0TA 3K8ZA 4IBCA 4LJ7A 4LF8M 2Y2OA 4GMQA 4Z2HA 2JZ1A 1V34A 4RKUF 1DV0A 2HCBA 5FTMA 3GQ3A 3KDSE 4NRVA 2DAMA 3K9PA 3DZDA 1L2DA 2DENA 1OGGA 1I94M 1E6ZA 1HQCA 4CGYB 3HJSA 4AKHA 5EXPA 3GQ5A 2APLA 4PCZA 1VEKA 2FNAA 3HZJA 3ZH9B 4G3OA 4QOZC 2DWZB 2R4JA 3HHWA 3IG8A 2G8LA 1E9RA 2QPAA 1IXRC 3RFWA 4Z2IA 2QCUA 1W5TA 3FUTA 1HNXM 1E15A 3KOWE 1L2CA 2BWBA 4LJ5A 2QSFX 5KPZA 2V1UA 2IOUA 3MHVC 1PM5A 3J7AS 3THGA 3FUUA 2N35A 1VEGA 4GH9A 1JR3D 2LWXA 4LJ4A 4QNMA 2VF7A 4GC5A 2UU9M 2L2DA 1IN5A 4X65M 3RE8A 2Z7JA 4NC6A 3T38A 1UM8A 3AOEA 3MMPA 7CATA 2Y21A 3GPXA 1PJQA 1KYIA 3D8BA 3KOXE 2FH0A 2C96A 4NZ5A 5E6JA 1XMOM 4LF9M 2EKFA 2GQFA 1OAOC 4AG6A 3E9SA 4M0DA 3K92A 2P5TA 5ITXE 1PJJA 4WP2A 2CWBA 1WJ7A 1RU3A 2MR9A 1SG9A 1OKSA 2ZANA 3QYBA 4JI6M 3WD3A 2W82A 3GLGA 4L78A 2Y2HA 2M5ZA 4GEWA 1E32A 2QZ4A 3L26A 1QDRA 1K82A 4JV5M 4GC9A 3KP0E 1GVNA 2DI0A 2R4EA 3W0FA 4FCTA 4PD2A 1J5EM 1NV9A 1WIVA 2RKOA 1L6JA 1QUTA 1YU1A 2DAIA 3E46A 1IY1A 2L7HA 4DR7M 4OJPA 1IN6A 2JY6B 5KQDA 1QO6A 2VDBB 1TGUA 4Z2GA 3GP1A 1S3SA 1TDHA 5KO3A 3HU2A 1VEJA 2KRKA 2LVPC 2Z3XA 4K0KM 1F4IA 1W1YA 2R18A 2R0IA 2LHGA 2R62A 1Z59A 3E21A 1OIZA 2KRUA 1WR1B 4I5SA 1GJSA 3A45A 1XWIA 4G4RA 2Y0QA 3WD2A 1YU4A 5FTKA 2XLJA 4DV3M 2FOIC 4QOSA 1OFHA 5F3WA 1GABA 4LZZA 2Z4RA 2OO9A 3GPPA 5ITTA 3GPUA 4MB5A 2JY5A 2Y2JA 4XK8F 1P3QQ 1WXQA 3F92A 3LQQA 3IHPA 4IBIA 2DWLA 2FFJA 1W1VA 3TQSA 3KSJA 4R7GA 1IN4A 3GQ4A 3EIHA 4LCBA 3HU3A 2HWJA 1R5LA 4IIWA 4FVMA 5JI2E 2XH9A 1TH2A 3K2LA 3QWLA 1TDZA 1O6IA 4HMCA 2Q2EB 1G4AE 2O5RA 3M0EA 1Q3BA 4DUZM 1HT2E 3U6EA 3GRRA 4MGIE 4NYYA 3U6LA 1Z5CA 4HLQA 5IREB 3PFIA 3U5ZB 4KHPM 1XMQM 4II7A 1UFZA 2NQ8C 3LQRA 3U6DA 1MX0A 3AFHA 3ZC7B 3U6SA 1N34M 2QBYB 4LFCM 5IT9S 1EE8A 3GLIE 4BBAA 2HKJA 3HKPA 2D7GA 5ITUA 1H0GA 1IN8A 4JI0M 3J7BA 1ZMVA 2L4EA 4LF5M 4I4LA 1SXJB 2C9CA 4DV2M 3H4MA 2Y2IA 3U6MA 4IBBA 2HL7A 1IXZA 4NZ1A 2F5NA 3SYLA 3VDPA 1G71A 3IECA 4MGZE 1XXHE 1C1KA 3GRYA 3GLFA 3CTWB 2C9OA 3R8FA 3FTFA 3WHKA 2MROB 2R45A 4UN2B 4QHSA 1IBLM 4JI3M 3TWLA 4NSOB 3T6PA 5ITQA 2FS1A 1SXJD 1ZAEA 1ZQ9A 2QNJA 1PJIA 2LTUA 3BXWA 1TF0B 4X66M 1DGBA 4NZ4A 1JR3E 2UXBM 3L27A 1OTRA 2XSZD 4Q7JA 1QZMA 2RGHA 3KW6A 2CE7A 3Q8GA 2KNZA 4RF1A 1E6NA 3IG5A 1EFUB 3GRVA 1QUSA 2AHMA 1D0LA 3FTDA 3UZUA 3W0LB 4B7HA 4F2LA 3GLHB 2OQ4A 4GHLA 1QAOA 4AI6A 2BJVA 2CHGA 1AUAA 5EXTA 2K47A 3K9OA 3FTCA 3QYEA 4IBDA 3SAWA 3C9PA 3N3FA 3TWKA 3QAUA 2J7NA 3BBZA 2EA0A 2R6FA 4NRWA 4D81A 2MGWA 5ITXA 2JY7A 2JXNA 2VF8A 3V76A 4AG5A 3U6CA 3AV0A 2L09A 3SARA 2CFOA 4HMDA 2F5SA 1A5TA 3T15A 2LHCA 1IXSA 5EQTA 4DR2M 1CUKA 4B3TM 2XF3A 4HMEA 1V92A 4WURA 4GIPA 2X8AA 2XGNA 3HHXA 3KOYE 5JI3E 3M6AA 1QYRA 1XHBA 5ITYA 3VFDA 5A2QS 3HU1A 2OPFA 1J7KA 1XC8A 1L2BA 3LCUA 1W1TA 3PNVA 3VK8A 4LF7M 4FWHA 4AZFA 3JR4A 3HONA 1VDLA 5EXXA 2DXIA 4B7FA 2I7NA 3U61B 2ERCA 2BNKA 1W5SA 2OOAA 2XZFA 1HR0M 4OJ5A 2X49A 4LJAA 3MJ5A 4JI7M 4M0WA 1DGFA 2CV1A 4G4QA 1XXHA 2KHHA 5DYIA 4EIWA 2HAKA 5BPVA 2DZOB 4MM3B 4F1IA 2Y2QA 1VDDA 1N36M 4IBJA 1IQPA 4LJ8A 3ILKA 4LGYA 1T3TA 1CK7A 1DO2A 3J81S 2L7IA 3T1HM 1NNJA 1GO5A 2YFQA 2E5LM 1R7RA 1SXJC 3AOGA 4NZ3A 3KVWA 2Y20A 3GO8A 2QP9X 3H4JA 1JR3A 2K0BX 2KA6B 2ZAMA 2VQFM 4IBEA 3VKGA 2BWEA 3JR5A 3KP1E 3SYKA 2CV0A 4TX8A 3FRIA 4L15A 1R2YA 1KFVA 1YU2A 1H8PA 1NVMA 1K3XA 2JZ0A 4KODA 3SC3A 5BR8M 2UWXA 1WGLA 4PT5A 5EP4A 3M7PA 1YUEA 3R9XB 3ZCBB 2CV2A 4M9ZA 1J09A 1GJTA 4FWDA 5KQ8A 4GHAA 2KNAA 4DV0M 4XGIA 4LZJA 4ITQA 2F4VM 2QENA 4IBFA 2XFTA 3KSXA 3AOEC 4MB7A 1DGGA 3AKZA 3U60B 3I04M 1YU0A 3I01M 1IBKM 2UUAM 4IBGA 3U6QA 4B3SM 3VKHA 1WGNA 2EJSA 1PJTA 2R65A 2ZBKB 4OU7A 3CGWA 1C7YA 3KOZE 2DHRA 2FE8A 4JYAM 3WD4A 2V6ZM 4LGMA 1QAQA 2OOBA 4B7GA 1R6BX 3GLFB 1TH3A 4GRIA 3SBJA 4B3MM 2EO2A 4AKIA 4OJLA 3NBXX 4HL4A 4JI2M 2R44A 2Z8YM 5LMNM 3LMMA 4MGKE 4AKGA 1IN7A 4FCVA 5EJCA 1N77A 1W1PA 2DAKA 2QQ8A 1N32M 2CRUA 4OW0A 3HY5A 1SXJE 3FUVA 4JXJA 3B74A 2FN2A 5EP3A 1Z6TA 2L6OA 3J2PB 1NY5A 4LFAM 3GPYA 3WX7A 3WD1A 1DO0A 4L8RC 2LVNC 3FE3A 4X64M 4LRSA 1X37A 1HNWM 3J80S 4Y28F 3FYCA 4NY2A 1ED7A 1DGHA 4MGYE 3CF6E 4CIZA 2O01F 2FFFB 2XZUA 4JI4M 2F5PA 2CUZA 2MH8A 2XD5A 4MB3A 1N78A 2KEBA 2WSFF 2X4AA
chains in the Genus database with same CATH topology
2EUCA 5EP1A 1HNZM 5DNYA 1IBMM 3L28A 3U6OA 4G4NA 2CHQA 3UGJA 3J27B 4W5WA 4LG2A 3PVSA 3SMSA 3FD9A 1IY2A 2Y2GA 4DV4M 4D80A 4PDGA 4LF4M 4OUIA 3NBIA 4S12A 5GKNA 3U6PA 5C18A 1JQJC 3TPZA 2XFSA 2YR0A 1NHGC 1IY0A 1H6UA 1K3WA 3B9PA 1Q3CA 3FUWA 3C58A 1G8PA 5DYGA 4G4OA 4DV5M 2VIIA 3FKEA 4X62M 3K1JA 3GLGB 1GL6A 2QBYA 4L4UA 1YUBA 4YY3M 4MGHA 3SHGB 2H1RA 5E26A 4Z8XA 4PDIA 4LY6A 2F5QA 1NJGA 1XNRM 1QQWA 4IJEA 4LJ9A 4OVZA 3VDUA 3DA1A 1SXJA 3SMPA 1L1TA 3GLIA 2DVWB 4LFBM 4FWGA 2UXDM 4DR3M 1NY6A 3I4VA 1E94E 4JI1M 3KS4A 1L8QA 2XSZA 3BOSA 1TH4A 1NHWC 1MU5A 2C5RA 3KFUG 2C98A 3HGIA 1Z5AA 2BJWA 4RF0A 4R3DA 1N33M 4GKJM 3KXEC 1D2NA 3HSHA 3LVWA 4RNAA 2ZM6M 1YU3A 3EIEA 3L29A 3HJ8A 2LXEA 1G41A 3SFZA 2F5OA 4FD2A 2RGOA 4B08A 4TUWA 3FYDA 4LRTA 4A3VB 5KPTA 3AL0C 1IM2A 4IBKA 4JI8M 2JE5A 1E9SA 3GLHA 1NSFA 4DR4M 4M9SA 1XNQM 5KPRA 3E4RA 3UMMA 3RGSA 1G3IA 1GKIA 2I7PA 2Y2MA 3A42A 1KSFX 2LH0A 4Z6YA 5ITRA 1GLNA 4QNLA 3WHLA 1Q39A 3VK7A 4FW9A 1OJLA 4GITA 1HT1E 1NJFA 2R46A 3SHFA 5IZ7D 1QAMA 2D7EA 2VQEM 1L1ZA 2BG1A 4DR5M 3I4YA 5FTJA 4NYUA 4I81A 3GRUA 4KO8A 4IJFA 4M9XA 4AW4A 3SASA 5EXSA 1FJGM 5FTLA 3CF2A 3PXGA 4JN6A 1DGHB 3LVVA 3SAUA 4REZA 4XBOA 3DFZA 5FLXS 3FUXA 3FTEA 4D82A 4DR1M 3U61A 2LNHC 2A5YB 3SAVA 3KS8A 4I8OA 4BLCA 4LJ6A 4KLNA 4WW0A 4GKKM 1NNUC 3UK6A 1QVRA 3VLFB 3HHZA 1QANA 3UJNA 5FSWA 3TWMA 1OFIA 2ZAOA 3T1YM 2Z4SA 2DWNA 2KW0A 4DR6M 1LV7A 2YQZA 1I4WA 2CHVA 2KZSA 2Y2KA 3L25A 4NSRA 4FCWA 4OX9M 4AQYM 2J7OA 4QNRA 4CHTB 5H37D 1YE9A 3A98B 5ITXE 2KXEA 3OTOM 2G5GX 3D8LA 2Y2NA 1R2ZA 3HWSA 3DOAA 4NOOB 4DUYM 4OJOA 2JA2A 5LMUM 3AJIB 1ORYB 2JCHA 2XD1A 4NL4H 5FTNA 3TL4X 1FNNA 4MH0E 2CEAA 5EP2A 1IXSB 2UUBM 4P16A 5IWAM 2HHHM 2UUCM 4CISA 3PNYA 4OVZB 2D7HA 5C1BA 3U60A 4G6ZA 3GLIB 4BB9A 4DV6M 4YHHM 2C99A 3L2AA 3Q8XA 3HHYA 4DV1M 4DV7M 3JAMS 2UXCM 8CATA 3TE6A 3HJQA 4LF6M 2KZUA 4L16A 2XEPA 4OJ6A 3NWLA 2M60A 4ZPXA 2Y2LA 1GL7A 3RGPA 1G59A 2V1CA 4QHTA 3SATA 1N75A 4JI5M 3U5ZA 2Y2PA 1XXHB 3A46A 3CF0A 3M7GA 1HQYE 4NXNM 3MK6A 2DWMA 4B3RM 2YNMD 1YSYA 1Z5BA 3I51A 4LJ7A 2DZNB 3K8ZA 4IBCA 4LF8M 2Y0TA 4NXMM 2Y2OA 4GMQA 2HCBA 5FTMA 3GQ3A 3KDSE 4NRVA 3DZDA 1L2DA 1I94M 1HQCA 4CGYB 3HJSA 4AKHA 5EXPA 3GQ5A 4PCZA 2FNAA 3ZH9B 4QOZC 2DWZB 2R4JA 3HHWA 3IG8A 2G8LA 1E9RA 2QPAA 1IXRC 3RFWA 2QCUA 1W5TA 3FUTA 1HNXM 3KOWE 1L2CA 4LJ5A 5KPZA 2V1UA 2IOUA 3MHVC 1PM5A 3J7AS 3THGA 3FUUA 4GH9A 1JR3D 2LWXA 4LJ4A 4QNMA 4GC5A 2UU9M 1IN5A 4X65M 3RE8A 2Z7JA 3T38A 1UM8A 3AOEA 7CATA 3GPXA 2Y21A 1KYIA 3D8BA 3KOXE 2C96A 4NZ5A 5E6JA 1XMOM 4LF9M 4AG6A 3E9SA 4M0DA 3K92A 2P5TA 1PJJA 2ZANA 4JI6M 2W82A 3GLGA 4L78A 2Y2HA 2M5ZA 4JV5M 1E32A 2QZ4A 3L26A 1K82A 4GC9A 3KP0E 1GVNA 2R4EA 3W0FA 4FCTA 4PD2A 1J5EM 2RKOA 1YU1A 1IY1A 2L7HA 4DR7M 4OJPA 1IN6A 5KQDA 1TGUA 3GP1A 1S3SA 1TDHA 5KO3A 3HU2A 2Z3XA 2KRKA 4K0KM 2R18A 2R62A 1Z59A 2KRUA 4I5SA 3A45A 1XWIA 4G4RA 2Y0QA 1YU4A 5FTKA 2XLJA 4DV3M 2FOIC 4QOSA 1OFHA 5F3WA 4LZZA 2Z4RA 3GPPA 5ITTA 3GPUA 2Y2JA 1WXQA 3LQQA 4IBIA 2DWLA 2FFJA 3TQSA 3KSJA 4R7GA 1IN4A 3GQ4A 3EIHA 4LCBA 3HU3A 4IIWA 4FVMA 5JI2E 2XH9A 1TH2A 3K2LA 3QWLA 1TDZA 2Q2EB 1G4AE 2O5RA 3M0EA 1Q3BA 4DUZM 1HT2E 3U6EA 3GRRA 4MGIE 4NYYA 3U6LA 1Z5CA 4HLQA 5IREB 3PFIA 3U5ZB 4KHPM 1XMQM 4II7A 2NQ8C 3LQRA 3U6DA 1MX0A 3AFHA 3ZC7B 3U6SA 1N34M 2QBYB 4LFCM 5IT9S 1EE8A 4BBAA 2HKJA 3HKPA 2D7GA 5ITUA 1IN8A 4JI0M 3J7BA 4LF5M 4I4LA 1SXJB 2C9CA 4DV2M 3H4MA 2Y2IA 3U6MA 4IBBA 2HL7A 1IXZA 4NZ1A 2F5NA 3SYLA 3VDPA 4MGZE 1C1KA 3GRYA 3GLFA 3CTWB 2C9OA 3R8FA 3FTFA 3WHKA 2R45A 4QHSA 1IBLM 4JI3M 3TWLA 4NSOB 5ITQA 1SXJD 1ZAEA 1ZQ9A 4NZ4A 4X66M 1DGBA 2UXBM 3L27A 2XSZD 1QZMA 2RGHA 3KW6A 2CE7A 4RF1A 3IG5A 3GRVA 2AHMA 1PJIA 3FTDA 3UZUA 3W0LB 4B7HA 2OQ4A 4AI6A 3GLHB 4GHLA 1QAOA 2BJVA 2CHGA 5EXTA 2K47A 3FTCA 3SAWA 4IBDA 3N3FA 3TWKA 3QAUA 2J7NA 2EA0A 4NRWA 4D81A 5ITXA 3U6CA 3SARA 4AG5A 3AV0A 2L09A 2CFOA 2F5SA 3T15A 5EQTA 4DR2M 4B3TM 2XF3A 4WURA 4GIPA 2X8AA 2XGNA 3HHXA 3KOYE 5JI3E 3M6AA 1QYRA 1XHBA 5ITYA 3VFDA 5A2QS 3HU1A 2OPFA 1J7KA 1XC8A 1L2BA 3PNVA 3VK8A 4LF7M 4FWHA 4AZFA 3JR4A 3HONA 2DXIA 5EXXA 4B7FA 2I7NA 3U61B 2ERCA 2BNKA 1W5SA 2XZFA 1HR0M 4OJ5A 2X49A 4LJAA 3MJ5A 4JI7M 4M0WA 1DGFA 2CV1A 4G4QA 1XXHA 5DYIA 4EIWA 5BPVA 2DZOB 4MM3B 2Y2QA 1VDDA 1N36M 4IBJA 1IQPA 4LJ8A 3ILKA 4LGYA 1T3TA 1DO2A 3J81S 2L7IA 3T1HM 1NNJA 2YFQA 2E5LM 1R7RA 1SXJC 3AOGA 4NZ3A 3KVWA 2Y20A 3GO8A 2QP9X 1JR3A 2KA6B 2ZAMA 2VQFM 4IBEA 3VKGA 3JR5A 3KP1E 3SYKA 2CV0A 4L15A 1R2YA 1KFVA 1YU2A 1NVMA 1K3XA 4KODA 3SC3A 5BR8M 2UWXA 4PT5A 5EP4A 1YUEA 3R9XB 3ZCBB 2CV2A 4M9ZA 1J09A 4FWDA 5KQ8A 4GHAA 4DV0M 4XGIA 4LZJA 4ITQA 2F4VM 2QENA 4IBFA 2XFTA 3KSXA 3AOEC 4MB7A 1DGGA 3AKZA 3U60B 1YU0A 1IBKM 2UUAM 4IBGA 3U6QA 4B3SM 3VKHA 2ZBKB 2R65A 4OU7A 4JYAM 3KOZE 2DHRA 2FE8A 2V6ZM 4LGMA 1QAQA 4B7GA 1R6BX 3GLFB 1TH3A 4GRIA 3SBJA 4B3MM 2EO2A 4AKIA 4OJLA 4JI2M 4HL4A 5LMNM 3LMMA 4MGKE 4AKGA 1IN7A 4FCVA 5EJCA 1N77A 1N32M 4OW0A 4JXJA 1SXJE 3FUVA 5EP3A 1Z6TA 2L6OA 3J2PB 1NY5A 4LFAM 3GPYA 3WX7A 1DO0A 4L8RC 4X64M 4LRSA 1X37A 1HNWM 3J80S 3FYCA 4NY2A 1DGHA 4MGYE 3CF6E 2FFFB 2XZUA 4JI4M 2F5PA 2CUZA 2XD5A 1N78A 2KEBA 2X4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKE A;  3L28 A;  5BPV A;  3L26 A;  4GH9 A;  4LG2 A;  3L29 A;  4IBJ A;  4IBC A;  4GHA A;  4IBI A;  3L27 A;  4IBF A;  4IJF A;  4IJE A;  4IBK A;  4IBG A;  3L2A A;  4IBE A;  4IBB A;  3L25 A;  4GHL A;  3KS4 A;  4IBD A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 1TR8 A;  2EUC A;  5EP1 A;  5DNY A;  1HNZ M;  1IBM M;  1KS0 A;  3L28 A;  3U6O A;  2L4F A;  4G4N A;  2CHQ A;  3UGJ A;  3J27 B;  4W5W A;  4LG2 A;  3PVS A;  3SMS A;  3FD9 A;  1BVS A;  1IY2 A;  2Y2G A;  3GLH E;  4DV4 M;  4D80 A;  4PDG A;  4LF4 M;  4OUI A;  3NBI A;  4NXM M;  4S12 A;  5GKN A;  3U6P A;  5C18 A;  1JQJ C;  3TPZ A;  2XFS A;  2YR0 A;  2JWS A;  1NHG C;  1MN3 A;  1IY0 A;  1H6U A;  1WHC A;  2GNO A;  2WZJ A;  1E6P A;  4L6V 6;  1K3W A;  2K9D A;  2KDL A;  3B9P A;  1Q3C A;  2LVO C;  3FUW A;  3C58 A;  1G8P A;  5DYG A;  4G4O A;  2B3T A;  4DV5 M;  2VII A;  3FKE A;  4X62 M;  3K1J A;  3GLG B;  1TTE A;  3ZQJ A;  1GL6 A;  4CJ6 A;  2QBY A;  1E6R A;  4L4U A;  1YUB A;  4YY3 M;  4MGH A;  3SHG B;  2H1R A;  1QZE A;  5E26 A;  3LCV B;  4Z8X A;  3B7Q A;  4LY6 A;  4PDI A;  1NJG A;  2QHO B;  2F5Q A;  1QQW A;  1XNR M;  3C3E A;  2DNA A;  4IJE A;  4LJ9 A;  4OVZ A;  3VDU A;  3DA1 A;  1QDT A;  1SXJ A;  3LW5 F;  3SMP A;  1R4G A;  3GLI A;  2DVW B;  1L1T A;  4LFB M;  4FWG A;  2UXD M;  4DR3 M;  1NY6 A;  3I4V A;  1PGY A;  1E94 E;  1ZMW A;  2WSE F;  3KS4 A;  4JI1 M;  1L8Q A;  2XSZ A;  3BOS A;  2WSC F;  1TH4 A;  1NHW C;  1MU5 A;  2C5R A;  2H5X A;  3KFU G;  2C98 A;  3HGI A;  1Z5A A;  2BJW A;  4RF0 A;  1D0K A;  4R3D A;  1N33 M;  4GKJ M;  1T43 A;  1D2N A;  3KXE C;  3HSH A;  3LVW A;  4RNA A;  2ZM6 M;  1E8B A;  1YU3 A;  3EIE A;  3L29 A;  3HJ8 A;  2LXE A;  1G41 A;  3SFZ A;  2F5O A;  2JUJ A;  2RGO A;  2CP8 A;  4FD2 A;  1PDC A;  4B08 A;  3FRH A;  4TUW A;  1UR8 A;  3FYD A;  4LRT A;  4A3V B;  5KPT A;  4HEO A;  3AL0 C;  1IM2 A;  2ZTC A;  1T6O A;  4IBK A;  4JI8 M;  2JE5 A;  1E9S A;  2DAG A;  3GLH A;  1NSF A;  4DR4 M;  4M9S A;  2K6B A;  1XNQ M;  1LTM A;  5KPR A;  3E4R A;  3UMM A;  3RGS A;  3WD0 A;  1G3I A;  1GKI A;  2I7P A;  1OAI A;  1PRB A;  1GPF A;  2Y2M A;  3A42 A;  1KSF X;  2LH0 A;  4Z6Y A;  5ITR A;  1GXD A;  1GLN A;  4QNL A;  2LVA A;  2MJ5 B;  3WHL A;  1Q39 A;  3VK7 A;  4FW9 A;  1OJL A;  4GIT A;  1HT1 E;  1NJF A;  2R46 A;  3SHF A;  5IZ7 D;  1QAM A;  2D7E A;  2EKK A;  2VQE M;  1L1Z A;  1H0I A;  2BG1 A;  1E88 A;  4DR5 M;  3I4Y A;  5FTJ A;  4NYU A;  4I81 A;  3GRU A;  4KO8 A;  4IJF A;  4M9X A;  4AW4 A;  3SAS A;  1OGB A;  3GLF E;  5EXS A;  1FJG M;  5FTL A;  3CF2 A;  1VG5 A;  3PXG A;  1JB0 F;  1DGH B;  3LVV A;  4JN6 A;  3SAU A;  1Q02 A;  1IFY A;  2V5O A;  3MQL A;  4REZ A;  4XBO A;  3DFZ A;  5FLX S;  3FUX A;  2DAE A;  3FTE A;  4D82 A;  2O25 A;  4DR1 M;  1XB2 B;  3U61 A;  1EAK A;  1OQY A;  2LNH C;  2A5Y B;  3SAV A;  3KS8 A;  1ZV1 A;  1NO1 A;  4I8O A;  4BLC A;  4LJ6 A;  4KLN A;  4WW0 A;  4GKK M;  1NNU C;  3UK6 A;  1EIJ A;  1QVR A;  1Y8G A;  1GOI A;  3B7N A;  3VLF B;  1QAN A;  3UJN A;  3HHZ A;  5FSW A;  2RTS A;  1J7M A;  3TWM A;  1OFI A;  2ZAO A;  3T1Y M;  2Z4S A;  2DWN A;  1CXW A;  1VQ1 A;  2KW0 A;  4DR6 M;  2DZL A;  1LV7 A;  1PJS A;  2JP7 A;  2YQZ A;  1I4W A;  3B7Z A;  2CHV A;  2KZS A;  4Z2K A;  2ZTD A;  3W68 A;  2Y2K A;  3L25 A;  4NSR A;  4FCW A;  4OX9 M;  4AQY M;  4DBG B;  2J7O A;  4QNR A;  4CHT B;  1AIP C;  1YE9 A;  1YLA A;  3A98 B;  2KXE A;  5H37 D;  2G5G X;  3D8L A;  3HX3 A;  3OTO M;  4KT0 F;  4Z2J A;  2LBC A;  1NV8 A;  1R2Z A;  1D0M A;  3HWS A;  3DOA A;  4NOO B;  4DUY M;  4OJO A;  2JA2 A;  5LMU M;  3AJI B;  1ORY B;  2JCH A;  2XD1 A;  2Y2N A;  4NL4 H;  5FTN A;  3TL4 X;  1FNN A;  4Z2L A;  4MH0 E;  2CEA A;  3B89 A;  5EP2 A;  1IXS B;  3W67 A;  2UUB M;  4P16 A;  5IWA M;  2HHH M;  2UUC M;  4ANR A;  4CIS A;  3PNY A;  4OVZ B;  2D7H A;  5C1B A;  3U60 A;  1HJP A;  4G6Z A;  3GLI B;  1V33 A;  2JNH A;  2LVQ D;  4BB9 A;  4DV6 M;  4YHH M;  2C99 A;  3L2A A;  2DKL A;  3Q8X A;  3HHY A;  4DV1 M;  4DV7 M;  3JAM S;  2UXC M;  8CAT A;  4MB4 A;  4P17 A;  3C3D A;  3TE6 A;  3GLG E;  3HJQ A;  4LF6 M;  2JY8 A;  1OIP A;  1MJG M;  2KZU A;  2XEP A;  3NWL A;  4L16 A;  4OJ6 A;  1UR9 A;  2M60 A;  4ZPX A;  2Y2L A;  1GL7 A;  3RGP A;  1G59 A;  2V1C A;  4QHT A;  5L8R F;  1N75 A;  3SAT A;  3U5Z A;  4JI5 M;  2Y2P A;  1XXH B;  3A46 A;  2RRU A;  2DHY A;  3CF0 A;  1HQY E;  3M7G A;  4NXN M;  3MK6 A;  4R71 A;  2DWM A;  4B3R M;  2YNM D;  2D49 A;  1AIW A;  5DFL A;  1YSY A;  1Z5B A;  2KNV A;  2G3Q A;  2DZN B;  1ZMU A;  2J5Y A;  3I51 A;  2Y0T A;  3K8Z A;  4IBC A;  4LJ7 A;  4LF8 M;  2Y2O A;  4GMQ A;  4Z2H A;  2JZ1 A;  1V34 A;  4RKU F;  1DV0 A;  2HCB A;  5FTM A;  3GQ3 A;  3KDS E;  4NRV A;  2DAM A;  3K9P A;  3DZD A;  1L2D A;  2DEN A;  1OGG A;  1I94 M;  1E6Z A;  1HQC A;  4CGY B;  3HJS A;  4AKH A;  5EXP A;  3GQ5 A;  2APL A;  4PCZ A;  1VEK A;  2FNA A;  3HZJ A;  3ZH9 B;  4G3O A;  4QOZ C;  2DWZ B;  2R4J A;  3HHW A;  3IG8 A;  2G8L A;  1E9R A;  2QPA A;  1IXR C;  3RFW A;  4Z2I A;  2QCU A;  1W5T A;  3FUT A;  1HNX M;  1E15 A;  3KOW E;  1L2C A;  2BWB A;  4LJ5 A;  2QSF X;  5KPZ A;  2V1U A;  2IOU A;  3MHV C;  1PM5 A;  3J7A S;  3THG A;  3FUU A;  2N35 A;  1VEG A;  4GH9 A;  1JR3 D;  2LWX A;  4LJ4 A;  4QNM A;  2VF7 A;  4GC5 A;  2UU9 M;  2L2D A;  1IN5 A;  4X65 M;  3RE8 A;  2Z7J A;  4NC6 A;  3T38 A;  1UM8 A;  3AOE A;  3MMP A;  7CAT A;  2Y21 A;  3GPX A;  1PJQ A;  1KYI A;  3D8B A;  3KOX E;  2FH0 A;  2C96 A;  4NZ5 A;  5E6J A;  1XMO M;  4LF9 M;  2EKF A;  2GQF A;  1OAO C;  4AG6 A;  3E9S A;  4M0D A;  3K92 A;  2P5T A;  5ITX E;  1PJJ A;  4WP2 A;  2CWB A;  1WJ7 A;  1RU3 A;  2MR9 A;  1SG9 A;  1OKS A;  2ZAN A;  3QYB A;  4JI6 M;  3WD3 A;  2W82 A;  3GLG A;  4L78 A;  2Y2H A;  2M5Z A;  4GEW A;  1E32 A;  2QZ4 A;  3L26 A;  1QDR A;  1K82 A;  4JV5 M;  4GC9 A;  3KP0 E;  1GVN A;  2DI0 A;  2R4E A;  3W0F A;  4FCT A;  4PD2 A;  1J5E M;  1NV9 A;  1WIV A;  2RKO A;  1L6J A;  1QUT A;  1YU1 A;  2DAI A;  3E46 A;  1IY1 A;  2L7H A;  4DR7 M;  4OJP A;  1IN6 A;  2JY6 B;  5KQD A;  1QO6 A;  2VDB B;  1TGU A;  4Z2G A;  3GP1 A;  1S3S A;  1TDH A;  5KO3 A;  3HU2 A;  1VEJ A;  2KRK A;  2LVP C;  2Z3X A;  4K0K M;  1F4I A;  1W1Y A;  2R18 A;  2R0I A;  2LHG A;  2R62 A;  1Z59 A;  3E21 A;  1OIZ A;  2KRU A;  1WR1 B;  4I5S A;  1GJS A;  3A45 A;  1XWI A;  4G4R A;  2Y0Q A;  3WD2 A;  1YU4 A;  5FTK A;  2XLJ A;  4DV3 M;  2FOI C;  4QOS A;  1OFH A;  5F3W A;  1GAB A;  4LZZ A;  2Z4R A;  2OO9 A;  3GPP A;  5ITT A;  3GPU A;  4MB5 A;  2JY5 A;  2Y2J A;  4XK8 F;  1P3Q Q;  1WXQ A;  3F92 A;  3LQQ A;  3IHP A;  4IBI A;  2DWL A;  2FFJ A;  1W1V A;  3TQS A;  3KSJ A;  4R7G A;  1IN4 A;  3GQ4 A;  3EIH A;  4LCB A;  3HU3 A;  2HWJ A;  1R5L A;  4IIW A;  4FVM A;  5JI2 E;  2XH9 A;  1TH2 A;  3K2L A;  3QWL A;  1TDZ A;  1O6I A;  4HMC A;  2Q2E B;  1G4A E;  2O5R A;  3M0E A;  1Q3B A;  4DUZ M;  1HT2 E;  3U6E A;  3GRR A;  4MGI E;  4NYY A;  3U6L A;  1Z5C A;  4HLQ A;  5IRE B;  3PFI A;  3U5Z B;  4KHP M;  1XMQ M;  4II7 A;  1UFZ A;  2NQ8 C;  3LQR A;  3U6D A;  1MX0 A;  3AFH A;  3ZC7 B;  3U6S A;  1N34 M;  2QBY B;  4LFC M;  5IT9 S;  1EE8 A;  3GLI E;  4BBA A;  2HKJ A;  3HKP A;  2D7G A;  5ITU A;  1H0G A;  1IN8 A;  4JI0 M;  3J7B A;  1ZMV A;  2L4E A;  4LF5 M;  4I4L A;  1SXJ B;  2C9C A;  4DV2 M;  3H4M A;  2Y2I A;  3U6M A;  4IBB A;  2HL7 A;  1IXZ A;  4NZ1 A;  2F5N A;  3SYL A;  3VDP A;  1G71 A;  3IEC A;  4MGZ E;  1XXH E;  1C1K A;  3GRY A;  3GLF A;  3CTW B;  2C9O A;  3R8F A;  3FTF A;  3WHK A;  2MRO B;  2R45 A;  4UN2 B;  4QHS A;  1IBL M;  4JI3 M;  3TWL A;  4NSO B;  3T6P A;  5ITQ A;  2FS1 A;  1SXJ D;  1ZAE A;  1ZQ9 A;  2QNJ A;  1PJI A;  2LTU A;  3BXW A;  1TF0 B;  4X66 M;  1DGB A;  4NZ4 A;  1JR3 E;  2UXB M;  3L27 A;  1OTR A;  2XSZ D;  4Q7J A;  1QZM A;  2RGH A;  3KW6 A;  2CE7 A;  3Q8G A;  2KNZ A;  4RF1 A;  1E6N A;  3IG5 A;  1EFU B;  3GRV A;  1QUS A;  2AHM A;  1D0L A;  3FTD A;  3UZU A;  3W0L B;  4B7H A;  4F2L A;  3GLH B;  2OQ4 A;  4GHL A;  1QAO A;  4AI6 A;  2BJV A;  2CHG A;  1AUA A;  5EXT A;  2K47 A;  3K9O A;  3FTC A;  3QYE A;  4IBD A;  3SAW A;  3C9P A;  3N3F A;  3TWK A;  3QAU A;  2J7N A;  3BBZ A;  2EA0 A;  2R6F A;  4NRW A;  4D81 A;  2MGW A;  5ITX A;  2JY7 A;  2JXN A;  2VF8 A;  3V76 A;  4AG5 A;  3U6C A;  3AV0 A;  2L09 A;  3SAR A;  2CFO A;  4HMD A;  2F5S A;  1A5T A;  3T15 A;  2LHC A;  1IXS A;  5EQT A;  4DR2 M;  1CUK A;  4B3T M;  2XF3 A;  4HME A;  1V92 A;  4WUR A;  4GIP A;  2X8A A;  2XGN A;  3HHX A;  3KOY E;  5JI3 E;  3M6A A;  1QYR A;  1XHB A;  5ITY A;  3VFD A;  5A2Q S;  3HU1 A;  2OPF A;  1J7K A;  1XC8 A;  1L2B A;  3LCU A;  1W1T A;  3PNV A;  3VK8 A;  4LF7 M;  4FWH A;  4AZF A;  3JR4 A;  3HON A;  1VDL A;  5EXX A;  2DXI A;  4B7F A;  2I7N A;  3U61 B;  2ERC A;  2BNK A;  1W5S A;  2OOA A;  2XZF A;  1HR0 M;  4OJ5 A;  2X49 A;  4LJA A;  3MJ5 A;  4JI7 M;  4M0W A;  1DGF A;  2CV1 A;  4G4Q A;  1XXH A;  2KHH A;  5DYI A;  4EIW A;  2HAK A;  5BPV A;  2DZO B;  4MM3 B;  4F1I A;  2Y2Q A;  1VDD A;  1N36 M;  4IBJ A;  1IQP A;  4LJ8 A;  3ILK A;  4LGY A;  1T3T A;  1CK7 A;  1DO2 A;  3J81 S;  2L7I A;  3T1H M;  1NNJ A;  1GO5 A;  2YFQ A;  2E5L M;  1R7R A;  1SXJ C;  3AOG A;  4NZ3 A;  3KVW A;  2Y20 A;  3GO8 A;  2QP9 X;  3H4J A;  1JR3 A;  2K0B X;  2KA6 B;  2ZAM A;  2VQF M;  4IBE A;  3VKG A;  2BWE A;  3JR5 A;  3KP1 E;  3SYK A;  2CV0 A;  4TX8 A;  3FRI A;  4L15 A;  1R2Y A;  1KFV A;  1YU2 A;  1H8P A;  1NVM A;  1K3X A;  2JZ0 A;  4KOD A;  3SC3 A;  5BR8 M;  2UWX A;  1WGL A;  4PT5 A;  5EP4 A;  3M7P A;  1YUE A;  3R9X B;  3ZCB B;  2CV2 A;  4M9Z A;  1J09 A;  1GJT A;  4FWD A;  5KQ8 A;  4GHA A;  2KNA A;  4DV0 M;  4XGI A;  4LZJ A;  4ITQ A;  2F4V M;  2QEN A;  4IBF A;  2XFT A;  3KSX A;  3AOE C;  4MB7 A;  1DGG A;  3AKZ A;  3U60 B;  3I04 M;  1YU0 A;  3I01 M;  1IBK M;  2UUA M;  4IBG A;  3U6Q A;  4B3S M;  3VKH A;  1WGN A;  2EJS A;  1PJT A;  2R65 A;  2ZBK B;  4OU7 A;  3CGW A;  1C7Y A;  3KOZ E;  2DHR A;  2FE8 A;  4JYA M;  3WD4 A;  2V6Z M;  4LGM A;  1QAQ A;  2OOB A;  4B7G A;  1R6B X;  3GLF B;  1TH3 A;  4GRI A;  3SBJ A;  4B3M M;  2EO2 A;  4AKI A;  4OJL A;  3NBX X;  4HL4 A;  4JI2 M;  2R44 A;  2Z8Y M;  5LMN M;  3LMM A;  4MGK E;  4AKG A;  1IN7 A;  4FCV A;  5EJC A;  1N77 A;  1W1P A;  2DAK A;  2QQ8 A;  1N32 M;  2CRU A;  4OW0 A;  3HY5 A;  1SXJ E;  3FUV A;  4JXJ A;  3B74 A;  2FN2 A;  5EP3 A;  1Z6T A;  2L6O A;  3J2P B;  1NY5 A;  4LFA M;  3GPY A;  3WX7 A;  3WD1 A;  1DO0 A;  4L8R C;  2LVN C;  3FE3 A;  4X64 M;  4LRS A;  1X37 A;  1HNW M;  3J80 S;  4Y28 F;  3FYC A;  4NY2 A;  1ED7 A;  1DGH A;  4MGY E;  3CF6 E;  4CIZ A;  2O01 F;  2FFF B;  2XZU A;  4JI4 M;  2F5P A;  2CUZ A;  2MH8 A;  2XD5 A;  4MB3 A;  1N78 A;  2KEB A;  2WSF F;  2X4A A; 
#chains in the Genus database with same CATH homology
 2EUC A;  5EP1 A;  1HNZ M;  5DNY A;  1IBM M;  3L28 A;  3U6O A;  4G4N A;  2CHQ A;  3UGJ A;  3J27 B;  4W5W A;  4LG2 A;  3PVS A;  3SMS A;  3FD9 A;  1IY2 A;  2Y2G A;  4DV4 M;  4D80 A;  4PDG A;  4LF4 M;  4OUI A;  3NBI A;  4S12 A;  5GKN A;  3U6P A;  5C18 A;  1JQJ C;  3TPZ A;  2XFS A;  2YR0 A;  1NHG C;  1IY0 A;  1H6U A;  1K3W A;  3B9P A;  1Q3C A;  3FUW A;  3C58 A;  1G8P A;  5DYG A;  4G4O A;  4DV5 M;  2VII A;  3FKE A;  4X62 M;  3K1J A;  3GLG B;  1GL6 A;  2QBY A;  4L4U A;  1YUB A;  4YY3 M;  4MGH A;  3SHG B;  2H1R A;  5E26 A;  4Z8X A;  4PDI A;  4LY6 A;  2F5Q A;  1NJG A;  1XNR M;  1QQW A;  4IJE A;  4LJ9 A;  4OVZ A;  3VDU A;  3DA1 A;  1SXJ A;  3SMP A;  1L1T A;  3GLI A;  2DVW B;  4LFB M;  4FWG A;  2UXD M;  4DR3 M;  1NY6 A;  3I4V A;  1E94 E;  4JI1 M;  3KS4 A;  1L8Q A;  2XSZ A;  3BOS A;  1TH4 A;  1NHW C;  1MU5 A;  2C5R A;  3KFU G;  2C98 A;  3HGI A;  1Z5A A;  2BJW A;  4RF0 A;  4R3D A;  1N33 M;  4GKJ M;  3KXE C;  1D2N A;  3HSH A;  3LVW A;  4RNA A;  2ZM6 M;  1YU3 A;  3EIE A;  3L29 A;  3HJ8 A;  2LXE A;  1G41 A;  3SFZ A;  2F5O A;  4FD2 A;  2RGO A;  4B08 A;  4TUW A;  3FYD A;  4LRT A;  4A3V B;  5KPT A;  3AL0 C;  1IM2 A;  4IBK A;  4JI8 M;  2JE5 A;  1E9S A;  3GLH A;  1NSF A;  4DR4 M;  4M9S A;  1XNQ M;  5KPR A;  3E4R A;  3UMM A;  3RGS A;  1G3I A;  1GKI A;  2I7P A;  2Y2M A;  3A42 A;  1KSF X;  2LH0 A;  4Z6Y A;  5ITR A;  1GLN A;  4QNL A;  3WHL A;  1Q39 A;  3VK7 A;  4FW9 A;  1OJL A;  4GIT A;  1HT1 E;  1NJF A;  2R46 A;  3SHF A;  5IZ7 D;  1QAM A;  2D7E A;  2VQE M;  1L1Z A;  2BG1 A;  4DR5 M;  3I4Y A;  5FTJ A;  4NYU A;  4I81 A;  3GRU A;  4KO8 A;  4IJF A;  4M9X A;  4AW4 A;  3SAS A;  5EXS A;  1FJG M;  5FTL A;  3CF2 A;  3PXG A;  4JN6 A;  1DGH B;  3LVV A;  3SAU A;  4REZ A;  4XBO A;  3DFZ A;  5FLX S;  3FUX A;  3FTE A;  4D82 A;  4DR1 M;  3U61 A;  2LNH C;  2A5Y B;  3SAV A;  3KS8 A;  4I8O A;  4BLC A;  4LJ6 A;  4KLN A;  4WW0 A;  4GKK M;  1NNU C;  3UK6 A;  1QVR A;  3VLF B;  3HHZ A;  1QAN A;  3UJN A;  5FSW A;  3TWM A;  1OFI A;  2ZAO A;  3T1Y M;  2Z4S A;  2DWN A;  2KW0 A;  4DR6 M;  1LV7 A;  2YQZ A;  1I4W A;  2CHV A;  2KZS A;  2Y2K A;  3L25 A;  4NSR A;  4FCW A;  4OX9 M;  4AQY M;  2J7O A;  4QNR A;  4CHT B;  5H37 D;  1YE9 A;  3A98 B;  5ITX E;  2KXE A;  3OTO M;  2G5G X;  3D8L A;  2Y2N A;  1R2Z A;  3HWS A;  3DOA A;  4NOO B;  4DUY M;  4OJO A;  2JA2 A;  5LMU M;  3AJI B;  1ORY B;  2JCH A;  2XD1 A;  4NL4 H;  5FTN A;  3TL4 X;  1FNN A;  4MH0 E;  2CEA A;  5EP2 A;  1IXS B;  2UUB M;  4P16 A;  5IWA M;  2HHH M;  2UUC M;  4CIS A;  3PNY A;  4OVZ B;  2D7H A;  5C1B A;  3U60 A;  4G6Z A;  3GLI B;  4BB9 A;  4DV6 M;  4YHH M;  2C99 A;  3L2A A;  3Q8X A;  3HHY A;  4DV1 M;  4DV7 M;  3JAM S;  2UXC M;  8CAT A;  3TE6 A;  3HJQ A;  4LF6 M;  2KZU A;  4L16 A;  2XEP A;  4OJ6 A;  3NWL A;  2M60 A;  4ZPX A;  2Y2L A;  1GL7 A;  3RGP A;  1G59 A;  2V1C A;  4QHT A;  3SAT A;  1N75 A;  4JI5 M;  3U5Z A;  2Y2P A;  1XXH B;  3A46 A;  3CF0 A;  3M7G A;  1HQY E;  4NXN M;  3MK6 A;  2DWM A;  4B3R M;  2YNM D;  1YSY A;  1Z5B A;  3I51 A;  4LJ7 A;  2DZN B;  3K8Z A;  4IBC A;  4LF8 M;  2Y0T A;  4NXM M;  2Y2O A;  4GMQ A;  2HCB A;  5FTM A;  3GQ3 A;  3KDS E;  4NRV A;  3DZD A;  1L2D A;  1I94 M;  1HQC A;  4CGY B;  3HJS A;  4AKH A;  5EXP A;  3GQ5 A;  4PCZ A;  2FNA A;  3ZH9 B;  4QOZ C;  2DWZ B;  2R4J A;  3HHW A;  3IG8 A;  2G8L A;  1E9R A;  2QPA A;  1IXR C;  3RFW A;  2QCU A;  1W5T A;  3FUT A;  1HNX M;  3KOW E;  1L2C A;  4LJ5 A;  5KPZ A;  2V1U A;  2IOU A;  3MHV C;  1PM5 A;  3J7A S;  3THG A;  3FUU A;  4GH9 A;  1JR3 D;  2LWX A;  4LJ4 A;  4QNM A;  4GC5 A;  2UU9 M;  1IN5 A;  4X65 M;  3RE8 A;  2Z7J A;  3T38 A;  1UM8 A;  3AOE A;  7CAT A;  3GPX A;  2Y21 A;  1KYI A;  3D8B A;  3KOX E;  2C96 A;  4NZ5 A;  5E6J A;  1XMO M;  4LF9 M;  4AG6 A;  3E9S A;  4M0D A;  3K92 A;  2P5T A;  1PJJ A;  2ZAN A;  4JI6 M;  2W82 A;  3GLG A;  4L78 A;  2Y2H A;  2M5Z A;  4JV5 M;  1E32 A;  2QZ4 A;  3L26 A;  1K82 A;  4GC9 A;  3KP0 E;  1GVN A;  2R4E A;  3W0F A;  4FCT A;  4PD2 A;  1J5E M;  2RKO A;  1YU1 A;  1IY1 A;  2L7H A;  4DR7 M;  4OJP A;  1IN6 A;  5KQD A;  1TGU A;  3GP1 A;  1S3S A;  1TDH A;  5KO3 A;  3HU2 A;  2Z3X A;  2KRK A;  4K0K M;  2R18 A;  2R62 A;  1Z59 A;  2KRU A;  4I5S A;  3A45 A;  1XWI A;  4G4R A;  2Y0Q A;  1YU4 A;  5FTK A;  2XLJ A;  4DV3 M;  2FOI C;  4QOS A;  1OFH A;  5F3W A;  4LZZ A;  2Z4R A;  3GPP A;  5ITT A;  3GPU A;  2Y2J A;  1WXQ A;  3LQQ A;  4IBI A;  2DWL A;  2FFJ A;  3TQS A;  3KSJ A;  4R7G A;  1IN4 A;  3GQ4 A;  3EIH A;  4LCB A;  3HU3 A;  4IIW A;  4FVM A;  5JI2 E;  2XH9 A;  1TH2 A;  3K2L A;  3QWL A;  1TDZ A;  2Q2E B;  1G4A E;  2O5R A;  3M0E A;  1Q3B A;  4DUZ M;  1HT2 E;  3U6E A;  3GRR A;  4MGI E;  4NYY A;  3U6L A;  1Z5C A;  4HLQ A;  5IRE B;  3PFI A;  3U5Z B;  4KHP M;  1XMQ M;  4II7 A;  2NQ8 C;  3LQR A;  3U6D A;  1MX0 A;  3AFH A;  3ZC7 B;  3U6S A;  1N34 M;  2QBY B;  4LFC M;  5IT9 S;  1EE8 A;  4BBA A;  2HKJ A;  3HKP A;  2D7G A;  5ITU A;  1IN8 A;  4JI0 M;  3J7B A;  4LF5 M;  4I4L A;  1SXJ B;  2C9C A;  4DV2 M;  3H4M A;  2Y2I A;  3U6M A;  4IBB A;  2HL7 A;  1IXZ A;  4NZ1 A;  2F5N A;  3SYL A;  3VDP A;  4MGZ E;  1C1K A;  3GRY A;  3GLF A;  3CTW B;  2C9O A;  3R8F A;  3FTF A;  3WHK A;  2R45 A;  4QHS A;  1IBL M;  4JI3 M;  3TWL A;  4NSO B;  5ITQ A;  1SXJ D;  1ZAE A;  1ZQ9 A;  4NZ4 A;  4X66 M;  1DGB A;  2UXB M;  3L27 A;  2XSZ D;  1QZM A;  2RGH A;  3KW6 A;  2CE7 A;  4RF1 A;  3IG5 A;  3GRV A;  2AHM A;  1PJI A;  3FTD A;  3UZU A;  3W0L B;  4B7H A;  2OQ4 A;  4AI6 A;  3GLH B;  4GHL A;  1QAO A;  2BJV A;  2CHG A;  5EXT A;  2K47 A;  3FTC A;  3SAW A;  4IBD A;  3N3F A;  3TWK A;  3QAU A;  2J7N A;  2EA0 A;  4NRW A;  4D81 A;  5ITX A;  3U6C A;  3SAR A;  4AG5 A;  3AV0 A;  2L09 A;  2CFO A;  2F5S A;  3T15 A;  5EQT A;  4DR2 M;  4B3T M;  2XF3 A;  4WUR A;  4GIP A;  2X8A A;  2XGN A;  3HHX A;  3KOY E;  5JI3 E;  3M6A A;  1QYR A;  1XHB A;  5ITY A;  3VFD A;  5A2Q S;  3HU1 A;  2OPF A;  1J7K A;  1XC8 A;  1L2B A;  3PNV A;  3VK8 A;  4LF7 M;  4FWH A;  4AZF A;  3JR4 A;  3HON A;  2DXI A;  5EXX A;  4B7F A;  2I7N A;  3U61 B;  2ERC A;  2BNK A;  1W5S A;  2XZF A;  1HR0 M;  4OJ5 A;  2X49 A;  4LJA A;  3MJ5 A;  4JI7 M;  4M0W A;  1DGF A;  2CV1 A;  4G4Q A;  1XXH A;  5DYI A;  4EIW A;  5BPV A;  2DZO B;  4MM3 B;  2Y2Q A;  1VDD A;  1N36 M;  4IBJ A;  1IQP A;  4LJ8 A;  3ILK A;  4LGY A;  1T3T A;  1DO2 A;  3J81 S;  2L7I A;  3T1H M;  1NNJ A;  2YFQ A;  2E5L M;  1R7R A;  1SXJ C;  3AOG A;  4NZ3 A;  3KVW A;  2Y20 A;  3GO8 A;  2QP9 X;  1JR3 A;  2KA6 B;  2ZAM A;  2VQF M;  4IBE A;  3VKG A;  3JR5 A;  3KP1 E;  3SYK A;  2CV0 A;  4L15 A;  1R2Y A;  1KFV A;  1YU2 A;  1NVM A;  1K3X A;  4KOD A;  3SC3 A;  5BR8 M;  2UWX A;  4PT5 A;  5EP4 A;  1YUE A;  3R9X B;  3ZCB B;  2CV2 A;  4M9Z A;  1J09 A;  4FWD A;  5KQ8 A;  4GHA A;  4DV0 M;  4XGI A;  4LZJ A;  4ITQ A;  2F4V M;  2QEN A;  4IBF A;  2XFT A;  3KSX A;  3AOE C;  4MB7 A;  1DGG A;  3AKZ A;  3U60 B;  1YU0 A;  1IBK M;  2UUA M;  4IBG A;  3U6Q A;  4B3S M;  3VKH A;  2ZBK B;  2R65 A;  4OU7 A;  4JYA M;  3KOZ E;  2DHR A;  2FE8 A;  2V6Z M;  4LGM A;  1QAQ A;  4B7G A;  1R6B X;  3GLF B;  1TH3 A;  4GRI A;  3SBJ A;  4B3M M;  2EO2 A;  4AKI A;  4OJL A;  4JI2 M;  4HL4 A;  5LMN M;  3LMM A;  4MGK E;  4AKG A;  1IN7 A;  4FCV A;  5EJC A;  1N77 A;  1N32 M;  4OW0 A;  4JXJ A;  1SXJ E;  3FUV A;  5EP3 A;  1Z6T A;  2L6O A;  3J2P B;  1NY5 A;  4LFA M;  3GPY A;  3WX7 A;  1DO0 A;  4L8R C;  4X64 M;  4LRS A;  1X37 A;  1HNW M;  3J80 S;  3FYC A;  4NY2 A;  1DGH A;  4MGY E;  3CF6 E;  2FFF B;  2XZU A;  4JI4 M;  2F5P A;  2CUZ A;  2XD5 A;  1N78 A;  2KEB A;  2X4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...