5BPVA

Crystal structure of zaire ebolavirus vp35 rna binding domain mutant i278a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALAQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Crystal Structure of Zaire ebolavirus VP35 RNA binding domain mutant I278A
rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 39
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5bpvA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 5bpvA02
4GHAA 4IBJA 3L29A 4IBDA 4IJEA 4IBBA 4IBIA 3L27A 4GH9A 3FKEA 4LG2A 3L2AA 3KS4A 4IBGA 4IBFA 3KS8A 4GHLA 3L26A 3L25A 4IBKA 4IBEA 5BPVA 4IJFA 4IBCA 3L28A
chains in the Genus database with same CATH superfamily
2MH8A 1ZAEA 4RF0A 2J7OA 2FFFB 5GKNA 3FE3A 3IHPA 2F5QA 1UR8A 2KEBA 2XF3A 4QOZC 2XSZD 1NJFA 3TQSA 1JR3E 4QHTA 3KXEC 3SYKA 4RKUF 2D7EA 5JI2E 3U6OA 3ZCBB 1V33A 4AKGA 2D7HA 1AIWA 1C1KA 3HJQA 2K0BX 3LQQA 4G6ZA 4KO8A 3WD0A 4Z2JA 5EP4A 1TH2A 5ITXE 1W1YA 1VEJA 1XXHE 3AOGA 4DR6M 1PJTA 3AKZA 3U6DA 4IBFA 3W68A 1E94E 4JV5M 2LNHC 4FVMA 1J7KA 4NYYA 4FCTA 1IN8A 2APLA 2W82A 2WZJA 4Z6YA 2QHOB 2Z3XA 4NRVA 1QVRA 3KSJA 1UFZA 3AFHA 1I4WA 3BOSA 3GQ4A 3SHFA 4AKHA 1E6RA 2YNMD 4LJ7A 4MB4A 4Z2LA 2L4EA 4IBJA 1NNUC 1N33M 3K8ZA 1VG5A 4B7HA 2VQEM 1AUAA 3THGA 2VF8A 3GP1A 2Z4RA 2KNAA 2X4AA 1OIPA 2ZANA 3QYEA 4IJEA 2XH9A 4L16A 3GLHA 4LGMA 3T38A 1IN5A 3GQ5A 3U61A 1MX0A 4DR4M 1IXSA 2LH0A 3I51A 4LJ4A 3U6MA 3U6SA 1H0IA 4B3SM 3HJ8A 2LVPC 5ITRA 2L4FA 4LZZA 1HQCA 2MROB 3I4YA 2D49A 4JI7M 4B7GA 1DV0A 1CK7A 1OGBA 3TPZA 3KS8A 4DR2M 1IXRC 4ANRA 3GPYA 4LZJA 1SXJA 1YU0A 4NSOB 1NV9A 4GC9A 2OPFA 2CHQA 4BLCA 2Y2KA 3M6AA 1WR1B 1O6IA 2R46A 2DXIA 1XXHB 3MQLA 4A3VB 3GPXA 3ILKA 3DOAA 2H5XA 1R6BX 3CGWA 2XSZA 5EP3A 3T1HM 1NY6A 3U6CA 4OJOA 1V34A 4AG5A 4PDIA 2KNVA 4MB5A 3KSXA 1GVNA 4F1IA 5A2QS 3FKEA 2CP8A 3MK6A 4DV7M 4CISA 3FUTA 1J09A 1TH3A 5IREB 2FH0A 3UJNA 4DR7M 3GRUA 5E6JA 3HSHA 1X37A 4B3MM 2R0IA 4Z8XA 1V92A 2CHGA 2X8AA 2FOIC 4IBKA 4IIWA 1A5TA 3HJSA 1WHCA 3JR4A 3T1YM 1CXWA 1TH4A 1NV8A 1XHBA 4JI5M 1QDTA 1H6UA 2M5ZA 1NY5A 4I81A 4MB7A 4OVZB 1H0GA 4M9XA 4PD2A 3VFDA 3PFIA 4Q7JA 2QBYB 5DYGA 3RGPA 4G4OA 3B89A 1HT1E 1OIZA 2L7IA 5FTMA 1IY0A 1HNXM 1QAQA 4DV4M 3QAUA 1H8PA 4NXMM 4L4UA 3LCVB 3SFZA 3J81S 4JI6M 2OO9A 5DNYA 2WSEF 3LQRA 4G4RA 5DYIA 4LF8M 1RU3A 5ITYA 4AQYM 3KS4A 1XB2B 1GLNA 4GEWA 3U6LA 3Q8GA 1G3IA 5IZ7D 4HEOA 1Z59A 4D81A 1E6NA 1GL6A 3VK7A 4IJFA 3VK8A 2CV0A 5FTJA 4GKJM 2NQ8C 4G4NA 1IXZA 4PT5A 5KQDA 1GXDA 3LMMA 1DO0A 2A5YB 2YFQA 4GHAA 2BG1A 4HMCA 4NY2A 1IY1A 3CTWB 2JWSA 1W5SA 4X66M 5EJCA 4PCZA 1L2BA 2DWLA 3WD2A 3E46A 2GQFA 4GRIA 4B08A 5IT9S 2Y2MA 4MGHA 4JXJA 5JI3E 1PRBA 2XFSA 4NZ5A 4EIWA 4LG2A 3HHXA 3PNYA 3SATA 3I04M 3K2LA 1Z6TA 3GPPA 3FYCA 4JI1M 4KHPM 2Y2IA 1VDDA 1S3SA 4NOOB 3RE8A 1E6ZA 3MHVC 3VDPA 2LVAA 3L26A 2G5GX 4OJ6A 1MN3A 2Q2EB 2QPAA 3D8BA 1KS0A 2R4EA 3I01M 1R7RA 4FWHA 4P17A 4M0DA 4NXNM 1GPFA 1HR0M 3UZUA 3J80S 4X62M 2FE8A 3HHWA 3JAMS 5LMUM 2BWBA 4CIZA 3FTDA 3SC3A 4NZ3A 1C7YA 2KRUA 4LJ6A 4HMDA 4LRTA 1YUEA 4NSRA 4RNAA 2CFOA 1WJ7A 2P5TA 1ZMVA 2X49A 3H4MA 3SARA 4TX8A 1L1ZA 4IBBA 2DHRA 4I4LA 2BNKA 3B7QA 2R4JA 1QDRA 3C3DA 2JXNA 4BBAA 3GLHE 3TE6A 3FTEA 2LTUA 1XC8A 2UUBM 3HHYA 3UK6A 1N32M 3U6PA 1OFIA 3W0FA 3QWLA 4OJLA 5EP1A 4L15A 1MU5A 3LW5F 4KODA 4WW0A 2HHHM 2J5YA 4ITQA 2Y2OA 1YLAA 2Y2QA 1TF0B 1SXJE 3KP0E 3L28A 1OAIA 3SMSA 2UXCM 1E9SA 1E88A 1PGYA 4KT0F 1WXQA 3C58A 5L8RF 4JI4M 5C18A 3ZQJA 2HL7A 2LHCA 5ITTA 2DAMA 1W5TA 4DV3M 1SG9A 2I7NA 4LJ9A 3MMPA 3HU1A 4D82A 4GKKM 1G71A 2YQZA 2ZBKB 5EXTA 3GPUA 4FCVA 1IN4A 2JP7A 4GITA 1DGBA 2KHHA 1YU3A 1VEGA 3FUVA 5FTNA 3GRVA 3WD4A 1L6JA 3WHKA 1OJLA 1KYIA 3U60A 3HGIA 2UXDM 1VEKA 4PDGA 1EIJA 1QAOA 1WIVA 5FLXS 4W5WA 2M60A 2WSCF 3GLHB 2VF7A 4REZA 3U61B 1F4IA 3GLIA 1OQYA 1IXSB 2EKKA 3KW6A 2KA6B 2O5RA 2JY6B 2C96A 3F92A 1Z5AA 4P16A 1HNWM 1IFYA 3KOXE 3RGSA 3GLGA 2DENA 3UMMA 3UGJA 1IQPA 1L8QA 1HQYE 3PXGA 2JA2A 1DGHA 1NVMA 1UR9A 2QNJA 2Y21A 1T3TA 5DFLA 1SXJB 3CF2A 4QNLA 3WX7A 3HONA 1YUBA 4LF9M 3PNVA 4MGKE 4MGYE 4BB9A 2L09A 2DZLA 4NL4H 4NYUA 2DZOB 2H1RA 3ZH9B 3PVSA 4HL4A 4OJPA 4IBEA 3M7PA 4YHHM 2L7HA 4B7FA 3KVWA 1LTMA 4NZ4A 2JY8A 3WD3A 2EKFA 2RGOA 1E8BA 2BJWA 1XNQM 1GABA 3T6PA 4JI8M 4R71A 1IN7A 2XZFA 5LMNM 1E9RA 3E4RA 2CV1A 4UN2B 5KPTA 4CJ6A 4AI6A 5F3WA 3K9PA 3MJ5A 1R2ZA 4GH9A 3SAUA 4M9SA 1DO2A 2XD1A 3W0LB 4DV6M 5BR8M 1MJGM 1YSYA 2R62A 1IBKM 2DKLA 1PJSA 5KPZA 3AJIB 1IBLM 1QANA 4OUIA 2F5NA 3GQ3A 3IG5A 2XD5A 3NWLA 5FTKA 3M0EA 1L2DA 2K9DA 4LGYA 2R6FA 4NZ1A 1L2CA 2IOUA 3E21A 4JI3M 1J5EM 2RKOA 2C9OA 2B3TA 4Y28F 1HJPA 2HKJA 2Z4SA 2HAKA 5EXXA 3CF0A 2O01F 2CRUA 2C99A 4DR5M 4AG6A 2UUCM 1L1TA 1HT2E 3QYBA 3B7NA 1PJIA 2DAEA 4I5SA 2XGNA 1YU1A 2Y2NA 1P3QQ 2R18A 2R65A 3FTCA 4GC5A 4AKIA 2DVWB 4LCBA 2KZUA 2C98A 3R8FA 4LF5M 3N3FA 3L2AA 4LF7M 1QUSA 2Y0TA 4QNRA 3VLFB 1KFVA 3U6QA 2UUAM 4OX9M 2ZTCA 4CGYB 3U5ZA 4GHLA 3SYLA 2V1CA 1OKSA 5KPRA 1YU4A 1XNRM 4G4QA 1W1TA 3D8LA 3GLFA 2V5OA 1TR8A 2F4VM 3TWKA 1G8PA 3FTFA 2V6ZM 4Z2HA 1VDLA 4LF6M 1QAMA 2CHVA 2OOAA 4QOSA 5EXSA 2Y20A 3EIEA 4GIPA 2EUCA 4YY3M 2ERCA 2F5PA 4WP2A 4NC6A 1PM5A 4MB3A 2MGWA 2LVQD 4S12A 1W1VA 1PDCA 2JY5A 2L6OA 3GRYA 2VIIA 1EFUB 2CWBA 1TDZA 1GO5A 1QZMA 1I94M 2KZSA 3GRRA 2AHMA 3A98B 2YR0A 3EIHA 4FWGA 4FWDA 4WURA 4CHTB 3GLFB 2L2DA 5EP2A 1D0LA 3VKHA 2UU9M 1N34M 4JI0M 1IM2A 2Y2HA 4JN6A 4LFCM 1QO6A 4JYAM 4XBOA 1AIPC 4Z2GA 2FNAA 4F2LA 2DZNB 2LWXA 4X65M 2XLJA 3SBJA 3KP1E 4OU7A 2OQ4A 5BPVA 2HWJA 1ORYB 2G3QA 3HX3A 1N78A 3ZC7B 4XK8F 2Y2PA 4ZPXA 4L78A 4II7A 5EQTA 5E26A 2R44A 3BXWA 1LV7A 3L29A 4M9ZA 4LFBM 2DAKA 3A46A 2UXBM 1Q3BA 3NBIA 1W1PA 2CEAA 2DAGA 1GL7A 4HMEA 3GLIE 4MGZE 4DV0M 3LVVA 2Y0QA 3AOEC 3HY5A 3J27B 1OGGA 1G4AE 2QQ8A 3GLGE 1R4GA 1DGGA 4DR1M 2KNZA 3LVWA 4NRWA 1KSFX 1EE8A 3L25A 2C5RA 1XWIA 3FUXA 2LHGA 3KOWE 1XMQM 1R2YA 1FJGM 4TUWA 3A45A 1ZQ9A 4JI2M 3RFWA 4LJ5A 1JR3A 3FUWA 1QYRA 1ZMWA 1D2NA 1BVSA 1Q39A 1N36M 1TDHA 2F5OA 1NJGA 1WGLA 2KDLA 4I8OA 3GO8A 2XZUA 2LVOC 1E6PA 2CE7A 4K0KM 4QHSA 2JZ1A 3C9PA 4RF1A 1XMOM 2XFTA 3KOZE 1DGFA 5ITXA 1JQJC 1XXHA 2K6BA 2KRKA 1JB0F 5C1BA 3Q8XA 1EAKA 4IBIA 2F5SA 4L8RC 2O25A 4DR3M 3U60B 4G3OA 4DV1M 1OTRA 3E9SA 2JNHA 2DWZB 3IECA 2RRUA 4MGIE 3R9XB 1TTEA 4DUYM 1G41A 2V1UA 2DAIA 3LCUA 3CF6E 3DFZA 3GLIB 4LF4M 1HNZM 1ZMUA 3SASA 3J2PB 4XGIA 2VQFM 1WGNA 1YE9A 1NHGC 4KLNA 4MM3B 1GKIA 1QUTA 3B9PA 4IBCA 4LY6A 3SAVA 1G59A 3KFUG 2C9CA 3GLGB 1FNNA 4L6V6 4Z2KA 3SHGB 1DGHB 4FD2A 3JR5A 2Z7JA 2OOBA 1PJJA 2Y2GA 3K1JA 2ZAOA 2QENA 2G8LA 4OVZA 1Y8GA 1N75A 1PJQA 2EJSA 3B7ZA 2R45A 3FRIA 3FYDA 4IBDA 3TWLA 2DWMA 2QP9X 2Z8YM 3OTOM 2QBYA 4R7GA 3KDSE 1OAOC 1J7MA 4HLQA 2QCUA 2GNOA 3FRHA 2D7GA 3FD9A 3J7BA 3W67A 2QSFX 1NHWC 1YU2A 2JE5A 4IBGA 2DHYA 2LXEA 3K92A 8CATA 2JY7A 3DA1A 4Z2IA 2DWNA 2JCHA 4X64M 3AL0C 4OJ5A 4M0WA 3I4VA 2QZ4A 2FS1A 1Z5CA 2K47A 5EXPA 3T15A 1E32A 4B3RM 2KXEA 1GJTA 3TL4X 4AZFA 4B3TM 2HCBA 2E5LM 3IG8A 5KO3A 1NO1A 3GLFE 3HU3A 5FSWA 4DV2M 4DUZM 2Y2JA 3B74A 1SXJC 4MH0E 3DZDA 4DV5M 3NBXX 1GJSA 2JUJA 1Q02A 2ZTDA 1T43A 2LVNC 3L27A 2ZAMA 3C3EA 1R5LA 4FCWA 1CUKA 3HKPA 3AV0A 3HHZA 2DNAA 1N77A 2LBCA 2FFJA 3FUUA 2UWXA 2J7NA 1Q3CA 4D80A 1E15A 3A42A 2EO2A 4LRSA 1QZEA 5KQ8A 1K82A 2RGHA 4AW4A 1GOIA 2MJ5B 5IWAM 3WD1A 1UM8A 1D0MA 3AOEA 3SMPA 3SAWA 1NNJA 1IBMM 1ZV1A 3H4JA 1ED7A 1JR3D 1Z5BA 3HZJA 1IY2A 3U6EA 5FTLA 4QNMA 2MR9A 4LFAM 4LJAA 4OW0A 2DI0A 4GMQA 3M7GA 4LJ8A 3VDUA 2FN2A 2JZ0A 1OFHA 3U5ZB 2CV2A 2RTSA 2CUZA 5H37D 1IN6A 4R3DA 2EA0A 1QQWA 2BJVA 5ITUA 2ZM6M 1NSFA 2VDBB 3TWMA 1K3XA 2Y2LA 3V76A 3HU2A 3K9OA 4DBGB 3J7AS 3WHLA 2BWEA 2WSFF 3VKGA 1T6OA 3BBZA 2KW0A 1SXJD 1VQ1A 5ITQA 1D0KA 3HWSA 2XEPA 7CATA 4FW9A 2N35A 1TGUA 1K3WA 2I7PA 3KOYE
chains in the Genus database with same CATH topology
4RF0A 1ZAEA 2FFFB 2J7OA 5GKNA 2F5QA 2KEBA 2XF3A 4QOZC 2XSZD 1NJFA 3TQSA 3SYKA 4QHTA 3KXEC 5JI2E 3U6OA 2D7EA 3ZCBB 4AKGA 2D7HA 1C1KA 3HJQA 3LQQA 4G6ZA 4KO8A 5EP4A 1TH2A 5ITXE 3AOGA 4DR6M 3AKZA 3U6DA 4IBFA 1E94E 4JV5M 2LNHC 4FVMA 1J7KA 4NYYA 4FCTA 1IN8A 2W82A 4Z6YA 2Z3XA 4NRVA 1QVRA 3KSJA 1YU0A 3AFHA 1I4WA 3BOSA 3GQ4A 3SHFA 4AKHA 2YNMD 4LJ7A 4IBJA 1NNUC 1N33M 3K8ZA 4B7HA 2VQEM 3THGA 3GP1A 2Z4RA 2X4AA 2ZANA 4LGMA 4IJEA 2XH9A 4L16A 3GLHA 3T38A 3GQ5A 1IN5A 3U61A 4DR4M 1MX0A 4OJPA 3I51A 2LH0A 4LJ4A 3U6MA 3U6SA 4B3SM 3HJ8A 5ITRA 4LZZA 1HQCA 3I4YA 4JI7M 4B7GA 3TPZA 3KS8A 4DR2M 1IXRC 3GPYA 4LZJA 1SXJA 4NSOB 4GC9A 2OPFA 2CHQA 4BLCA 2Y2KA 3M6AA 2R46A 2DXIA 1XXHB 4A3VB 3GPXA 3ILKA 3DOAA 1R6BX 2XSZA 5EP3A 3T1HM 1NY6A 3U6CA 4OJOA 4AG5A 4PDIA 3KSXA 1GVNA 5A2QS 3FKEA 3MK6A 4DV7M 4CISA 3FUTA 1J09A 1TH3A 5IREB 3UJNA 4DR7M 3GRUA 5E6JA 3HSHA 1X37A 4B3MM 4Z8XA 2CHGA 2X8AA 2FOIC 4IBKA 4IIWA 3T1YM 3HJSA 3JR4A 1TH4A 1XHBA 4JI5M 1H6UA 2M5ZA 1NY5A 4I81A 4MB7A 4OVZB 4M9XA 4PD2A 3VFDA 3PFIA 2QBYB 5DYGA 3RGPA 4G4OA 1HT1E 2L7IA 5FTMA 1IY0A 1HNXM 1QAQA 4DV4M 3QAUA 4NXMM 4L4UA 3SFZA 3J81S 4JI6M 5DNYA 3LQRA 4G4RA 5DYIA 4LF8M 5ITYA 4AQYM 3KS4A 1GLNA 3U6LA 1G3IA 5IZ7D 1Z59A 4D81A 1GL6A 3VK7A 4IJFA 3VK8A 2CV0A 5FTJA 4GKJM 2NQ8C 4G4NA 1IXZA 4PT5A 5KQDA 3LMMA 1DO0A 2A5YB 2YFQA 4GHAA 2BG1A 4NY2A 1IY1A 3CTWB 4X66M 1W5SA 4PCZA 5EJCA 1L2BA 2DWLA 4B08A 4GRIA 5IT9S 2Y2MA 4MGHA 4JXJA 5JI3E 2XFSA 4NZ5A 4EIWA 4LG2A 3HHXA 3PNYA 3SATA 3K2LA 4JI1M 1Z6TA 3GPPA 3FYCA 4KHPM 2Y2IA 1VDDA 1S3SA 4NOOB 3RE8A 3MHVC 3VDPA 4OJ6A 3L26A 2G5GX 2Q2EB 3D8BA 2QPAA 2R4EA 4FWHA 1R7RA 4NXNM 4M0DA 1HR0M 3UZUA 3J80S 4X62M 2FE8A 3HHWA 3JAMS 5LMUM 3FTDA 3SC3A 4NZ3A 2KRUA 4LJ6A 4LRTA 1YUEA 4NSRA 4RNAA 2CFOA 2P5TA 3H4MA 2X49A 3SARA 1L1ZA 4IBBA 2DHRA 4I4LA 2BNKA 2R4JA 4BBAA 3TE6A 3FTEA 1XC8A 2UUBM 3HHYA 3UK6A 1N32M 3U6PA 1OFIA 3W0FA 3QWLA 4OJLA 5EP1A 4L15A 1MU5A 2HHHM 4KODA 4WW0A 2Y2QA 4ITQA 2Y2OA 3KP0E 1SXJE 3L28A 3SMSA 2UXCM 1E9SA 1WXQA 3C58A 4JI4M 5C18A 2HL7A 5ITTA 4DV3M 1W5TA 2I7NA 4LJ9A 4D82A 3HU1A 4GKKM 5EXTA 2YQZA 2ZBKB 3GPUA 4FCVA 1IN4A 4GITA 1DGBA 1YU3A 3FUVA 5FTNA 3GRVA 3WHKA 1OJLA 1KYIA 3U60A 3HGIA 2UXDM 4PDGA 1QAOA 5FLXS 4W5WA 2M60A 4REZA 3GLHB 3U61B 3GLIA 3KW6A 1IXSB 2KA6B 2O5RA 2C96A 1Z5AA 4P16A 1HNWM 3KOXE 3RGSA 3GLGA 3UGJA 3UMMA 1IQPA 1L8QA 1HQYE 3PXGA 2JA2A 1DGHA 1NVMA 2Y21A 1T3TA 4QNLA 1SXJB 3CF2A 3WX7A 3HONA 1YUBA 4LF9M 3PNVA 4MGKE 4MGYE 4BB9A 2L09A 4NL4H 4NYUA 2DZOB 2H1RA 3ZH9B 3PVSA 4HL4A 4IBEA 4YHHM 2L7HA 4B7FA 3KVWA 4NZ4A 2RGOA 2BJWA 4JI8M 2XZFA 1IN7A 5LMNM 1E9RA 3E4RA 2CV1A 5KPTA 4AI6A 5F3WA 3MJ5A 1R2ZA 4GH9A 3SAUA 4M9SA 1DO2A 2XD1A 3W0LB 4DV6M 5BR8M 1YSYA 2R62A 1IBKM 5KPZA 3AJIB 1IBLM 1QANA 4OUIA 2F5NA 3GQ3A 3IG5A 2XD5A 3NWLA 5FTKA 3M0EA 1L2DA 4LGYA 4NZ1A 1L2CA 2IOUA 4JI3M 1J5EM 2RKOA 2C9OA 2HKJA 2Z4SA 5EXXA 3CF0A 2C99A 4DR5M 4AG6A 2UUCM 1L1TA 1HT2E 1PJIA 1YU1A 4I5SA 2XGNA 2Y2NA 2R18A 2R65A 3FTCA 4GC5A 4AKIA 2DVWB 4LCBA 2KZUA 2C98A 3R8FA 4LF5M 3N3FA 3L2AA 4LF7M 2Y0TA 4QNRA 3VLFB 1KFVA 3U6QA 2UUAM 4OX9M 4CGYB 3U5ZA 4GHLA 3SYLA 2V1CA 5KPRA 1YU4A 1XNRM 4G4QA 3D8LA 3GLFA 2F4VM 3TWKA 1G8PA 3FTFA 2V6ZM 1QAMA 2CHVA 1XNQM 4QOSA 5EXSA 2Y20A 3EIEA 4GIPA 2EUCA 4YY3M 2ERCA 2F5PA 1PM5A 4S12A 2L6OA 3GRYA 2VIIA 1TDZA 1QZMA 1I94M 2KZSA 3GRRA 2AHMA 3A98B 2YR0A 3EIHA 4FWGA 4FWDA 4WURA 4CHTB 3GLFB 5EP2A 3VKHA 2UU9M 1N34M 4JI0M 1IM2A 2Y2HA 4JN6A 4LFCM 4JYAM 4XBOA 2FNAA 4X65M 2DZNB 2LWXA 2XLJA 3SBJA 3KP1E 4OU7A 2OQ4A 5BPVA 1ORYB 1N78A 3ZC7B 2Y2PA 4ZPXA 4L78A 4II7A 5EQTA 5E26A 1LV7A 3L29A 4M9ZA 4LFBM 3A46A 2UXBM 1Q3BA 3NBIA 2CEAA 1GL7A 4MGZE 4DV0M 3LVVA 2Y0QA 3AOEC 3J27B 1G4AE 4DR1M 1DGGA 3LVWA 4NRWA 1KSFX 1EE8A 3L25A 2C5RA 1XWIA 3FUXA 3KOWE 1R2YA 1XMQM 1FJGM 4TUWA 3A45A 1ZQ9A 4JI2M 3RFWA 4LJ5A 1JR3A 3FUWA 1D2NA 1QYRA 2F5OA 1Q39A 1N36M 1TDHA 1NJGA 3GO8A 4I8OA 2XZUA 2CE7A 4K0KM 4QHSA 1XMOM 4RF1A 2XFTA 3KOZE 1DGFA 5ITXA 1JQJC 1XXHA 2KRKA 5C1BA 3Q8XA 4IBIA 2F5SA 4L8RC 4DR3M 3U60B 4DV1M 3E9SA 2DWZB 4MGIE 3R9XB 4DUYM 1G41A 2V1UA 3CF6E 3DFZA 3GLIB 4LF4M 1HNZM 3SASA 3J2PB 4XGIA 2VQFM 4KLNA 1YE9A 1NHGC 4MM3B 1GKIA 3B9PA 4IBCA 4LY6A 3SAVA 1G59A 3KFUG 2C9CA 3GLGB 1FNNA 3SHGB 1DGHB 4FD2A 3JR5A 2Z7JA 1PJJA 2Y2GA 3K1JA 2ZAOA 2QENA 2G8LA 4OVZA 1N75A 3FYDA 4IBDA 2DWMA 2R45A 4LF6M 3TWLA 2QP9X 3OTOM 2QBYA 4R7GA 3KDSE 4HLQA 2QCUA 3J7BA 2D7GA 3FD9A 1NHWC 1YU2A 2JE5A 4IBGA 8CATA 2LXEA 3K92A 3DA1A 2DWNA 2JCHA 4X64M 3AL0C 4OJ5A 4M0WA 3I4VA 2QZ4A 1Z5CA 2K47A 5EXPA 3T15A 1E32A 4B3RM 2KXEA 3TL4X 4AZFA 4B3TM 2HCBA 2E5LM 3IG8A 5KO3A 3HU3A 5FSWA 4DV2M 4DUZM 2Y2JA 1SXJC 4MH0E 3DZDA 4DV5M 3L27A 2ZAMA 4FCWA 3HKPA 3AV0A 3HHZA 1N77A 3FUUA 2FFJA 2UWXA 2J7NA 1Q3CA 4D80A 3A42A 2EO2A 4LRSA 1K82A 5KQ8A 2RGHA 4AW4A 5IWAM 1UM8A 3AOEA 3SMPA 3SAWA 1NNJA 1IBMM 1JR3D 1Z5BA 1IY2A 3U6EA 5FTLA 4QNMA 4LFAM 4LJAA 4OW0A 3VDUA 4GMQA 3M7GA 4LJ8A 1OFHA 3U5ZB 2CV2A 2CUZA 5H37D 1IN6A 4R3DA 2EA0A 1QQWA 2BJVA 5ITUA 2ZM6M 1NSFA 3TWMA 1K3XA 2Y2LA 3HU2A 3J7AS 3WHLA 3VKGA 2KW0A 1SXJD 5ITQA 3HWSA 2XEPA 7CATA 4FW9A 1TGUA 1K3WA 2I7PA 3KOYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4IBJ A;  3L29 A;  4IBD A;  4IJE A;  4IBB A;  4IBI A;  3L27 A;  4GH9 A;  3FKE A;  4LG2 A;  3L2A A;  3KS4 A;  4IBG A;  4IBF A;  3KS8 A;  4GHL A;  3L26 A;  3L25 A;  4IBK A;  4IBE A;  5BPV A;  4IJF A;  4IBC A;  3L28 A; 
#chains in the Genus database with same CATH topology
 2MH8 A;  1ZAE A;  4RF0 A;  2J7O A;  2FFF B;  5GKN A;  3FE3 A;  3IHP A;  2F5Q A;  1UR8 A;  2KEB A;  2XF3 A;  4QOZ C;  2XSZ D;  1NJF A;  3TQS A;  1JR3 E;  4QHT A;  3KXE C;  3SYK A;  4RKU F;  2D7E A;  5JI2 E;  3U6O A;  3ZCB B;  1V33 A;  4AKG A;  2D7H A;  1AIW A;  1C1K A;  3HJQ A;  2K0B X;  3LQQ A;  4G6Z A;  4KO8 A;  3WD0 A;  4Z2J A;  5EP4 A;  1TH2 A;  5ITX E;  1W1Y A;  1VEJ A;  1XXH E;  3AOG A;  4DR6 M;  1PJT A;  3AKZ A;  3U6D A;  4IBF A;  3W68 A;  1E94 E;  4JV5 M;  2LNH C;  4FVM A;  1J7K A;  4NYY A;  4FCT A;  1IN8 A;  2APL A;  2W82 A;  2WZJ A;  4Z6Y A;  2QHO B;  2Z3X A;  4NRV A;  1QVR A;  3KSJ A;  1UFZ A;  3AFH A;  1I4W A;  3BOS A;  3GQ4 A;  3SHF A;  4AKH A;  1E6R A;  2YNM D;  4LJ7 A;  4MB4 A;  4Z2L A;  2L4E A;  4IBJ A;  1NNU C;  1N33 M;  3K8Z A;  1VG5 A;  4B7H A;  2VQE M;  1AUA A;  3THG A;  2VF8 A;  3GP1 A;  2Z4R A;  2KNA A;  2X4A A;  1OIP A;  2ZAN A;  3QYE A;  4IJE A;  2XH9 A;  4L16 A;  3GLH A;  4LGM A;  3T38 A;  1IN5 A;  3GQ5 A;  3U61 A;  1MX0 A;  4DR4 M;  1IXS A;  2LH0 A;  3I51 A;  4LJ4 A;  3U6M A;  3U6S A;  1H0I A;  4B3S M;  3HJ8 A;  2LVP C;  5ITR A;  2L4F A;  4LZZ A;  1HQC A;  2MRO B;  3I4Y A;  2D49 A;  4JI7 M;  4B7G A;  1DV0 A;  1CK7 A;  1OGB A;  3TPZ A;  3KS8 A;  4DR2 M;  1IXR C;  4ANR A;  3GPY A;  4LZJ A;  1SXJ A;  1YU0 A;  4NSO B;  1NV9 A;  4GC9 A;  2OPF A;  2CHQ A;  4BLC A;  2Y2K A;  3M6A A;  1WR1 B;  1O6I A;  2R46 A;  2DXI A;  1XXH B;  3MQL A;  4A3V B;  3GPX A;  3ILK A;  3DOA A;  2H5X A;  1R6B X;  3CGW A;  2XSZ A;  5EP3 A;  3T1H M;  1NY6 A;  3U6C A;  4OJO A;  1V34 A;  4AG5 A;  4PDI A;  2KNV A;  4MB5 A;  3KSX A;  1GVN A;  4F1I A;  5A2Q S;  3FKE A;  2CP8 A;  3MK6 A;  4DV7 M;  4CIS A;  3FUT A;  1J09 A;  1TH3 A;  5IRE B;  2FH0 A;  3UJN A;  4DR7 M;  3GRU A;  5E6J A;  3HSH A;  1X37 A;  4B3M M;  2R0I A;  4Z8X A;  1V92 A;  2CHG A;  2X8A A;  2FOI C;  4IBK A;  4IIW A;  1A5T A;  3HJS A;  1WHC A;  3JR4 A;  3T1Y M;  1CXW A;  1TH4 A;  1NV8 A;  1XHB A;  4JI5 M;  1QDT A;  1H6U A;  2M5Z A;  1NY5 A;  4I81 A;  4MB7 A;  4OVZ B;  1H0G A;  4M9X A;  4PD2 A;  3VFD A;  3PFI A;  4Q7J A;  2QBY B;  5DYG A;  3RGP A;  4G4O A;  3B89 A;  1HT1 E;  1OIZ A;  2L7I A;  5FTM A;  1IY0 A;  1HNX M;  1QAQ A;  4DV4 M;  3QAU A;  1H8P A;  4NXM M;  4L4U A;  3LCV B;  3SFZ A;  3J81 S;  4JI6 M;  2OO9 A;  5DNY A;  2WSE F;  3LQR A;  4G4R A;  5DYI A;  4LF8 M;  1RU3 A;  5ITY A;  4AQY M;  3KS4 A;  1XB2 B;  1GLN A;  4GEW A;  3U6L A;  3Q8G A;  1G3I A;  5IZ7 D;  4HEO A;  1Z59 A;  4D81 A;  1E6N A;  1GL6 A;  3VK7 A;  4IJF A;  3VK8 A;  2CV0 A;  5FTJ A;  4GKJ M;  2NQ8 C;  4G4N A;  1IXZ A;  4PT5 A;  5KQD A;  1GXD A;  3LMM A;  1DO0 A;  2A5Y B;  2YFQ A;  4GHA A;  2BG1 A;  4HMC A;  4NY2 A;  1IY1 A;  3CTW B;  2JWS A;  1W5S A;  4X66 M;  5EJC A;  4PCZ A;  1L2B A;  2DWL A;  3WD2 A;  3E46 A;  2GQF A;  4GRI A;  4B08 A;  5IT9 S;  2Y2M A;  4MGH A;  4JXJ A;  5JI3 E;  1PRB A;  2XFS A;  4NZ5 A;  4EIW A;  4LG2 A;  3HHX A;  3PNY A;  3SAT A;  3I04 M;  3K2L A;  1Z6T A;  3GPP A;  3FYC A;  4JI1 M;  4KHP M;  2Y2I A;  1VDD A;  1S3S A;  4NOO B;  3RE8 A;  1E6Z A;  3MHV C;  3VDP A;  2LVA A;  3L26 A;  2G5G X;  4OJ6 A;  1MN3 A;  2Q2E B;  2QPA A;  3D8B A;  1KS0 A;  2R4E A;  3I01 M;  1R7R A;  4FWH A;  4P17 A;  4M0D A;  4NXN M;  1GPF A;  1HR0 M;  3UZU A;  3J80 S;  4X62 M;  2FE8 A;  3HHW A;  3JAM S;  5LMU M;  2BWB A;  4CIZ A;  3FTD A;  3SC3 A;  4NZ3 A;  1C7Y A;  2KRU A;  4LJ6 A;  4HMD A;  4LRT A;  1YUE A;  4NSR A;  4RNA A;  2CFO A;  1WJ7 A;  2P5T A;  1ZMV A;  2X49 A;  3H4M A;  3SAR A;  4TX8 A;  1L1Z A;  4IBB A;  2DHR A;  4I4L A;  2BNK A;  3B7Q A;  2R4J A;  1QDR A;  3C3D A;  2JXN A;  4BBA A;  3GLH E;  3TE6 A;  3FTE A;  2LTU A;  1XC8 A;  2UUB M;  3HHY A;  3UK6 A;  1N32 M;  3U6P A;  1OFI A;  3W0F A;  3QWL A;  4OJL A;  5EP1 A;  4L15 A;  1MU5 A;  3LW5 F;  4KOD A;  4WW0 A;  2HHH M;  2J5Y A;  4ITQ A;  2Y2O A;  1YLA A;  2Y2Q A;  1TF0 B;  1SXJ E;  3KP0 E;  3L28 A;  1OAI A;  3SMS A;  2UXC M;  1E9S A;  1E88 A;  1PGY A;  4KT0 F;  1WXQ A;  3C58 A;  5L8R F;  4JI4 M;  5C18 A;  3ZQJ A;  2HL7 A;  2LHC A;  5ITT A;  2DAM A;  1W5T A;  4DV3 M;  1SG9 A;  2I7N A;  4LJ9 A;  3MMP A;  3HU1 A;  4D82 A;  4GKK M;  1G71 A;  2YQZ A;  2ZBK B;  5EXT A;  3GPU A;  4FCV A;  1IN4 A;  2JP7 A;  4GIT A;  1DGB A;  2KHH A;  1YU3 A;  1VEG A;  3FUV A;  5FTN A;  3GRV A;  3WD4 A;  1L6J A;  3WHK A;  1OJL A;  1KYI A;  3U60 A;  3HGI A;  2UXD M;  1VEK A;  4PDG A;  1EIJ A;  1QAO A;  1WIV A;  5FLX S;  4W5W A;  2M60 A;  2WSC F;  3GLH B;  2VF7 A;  4REZ A;  3U61 B;  1F4I A;  3GLI A;  1OQY A;  1IXS B;  2EKK A;  3KW6 A;  2KA6 B;  2O5R A;  2JY6 B;  2C96 A;  3F92 A;  1Z5A A;  4P16 A;  1HNW M;  1IFY A;  3KOX E;  3RGS A;  3GLG A;  2DEN A;  3UMM A;  3UGJ A;  1IQP A;  1L8Q A;  1HQY E;  3PXG A;  2JA2 A;  1DGH A;  1NVM A;  1UR9 A;  2QNJ A;  2Y21 A;  1T3T A;  5DFL A;  1SXJ B;  3CF2 A;  4QNL A;  3WX7 A;  3HON A;  1YUB A;  4LF9 M;  3PNV A;  4MGK E;  4MGY E;  4BB9 A;  2L09 A;  2DZL A;  4NL4 H;  4NYU A;  2DZO B;  2H1R A;  3ZH9 B;  3PVS A;  4HL4 A;  4OJP A;  4IBE A;  3M7P A;  4YHH M;  2L7H A;  4B7F A;  3KVW A;  1LTM A;  4NZ4 A;  2JY8 A;  3WD3 A;  2EKF A;  2RGO A;  1E8B A;  2BJW A;  1XNQ M;  1GAB A;  3T6P A;  4JI8 M;  4R71 A;  1IN7 A;  2XZF A;  5LMN M;  1E9R A;  3E4R A;  2CV1 A;  4UN2 B;  5KPT A;  4CJ6 A;  4AI6 A;  5F3W A;  3K9P A;  3MJ5 A;  1R2Z A;  4GH9 A;  3SAU A;  4M9S A;  1DO2 A;  2XD1 A;  3W0L B;  4DV6 M;  5BR8 M;  1MJG M;  1YSY A;  2R62 A;  1IBK M;  2DKL A;  1PJS A;  5KPZ A;  3AJI B;  1IBL M;  1QAN A;  4OUI A;  2F5N A;  3GQ3 A;  3IG5 A;  2XD5 A;  3NWL A;  5FTK A;  3M0E A;  1L2D A;  2K9D A;  4LGY A;  2R6F A;  4NZ1 A;  1L2C A;  2IOU A;  3E21 A;  4JI3 M;  1J5E M;  2RKO A;  2C9O A;  2B3T A;  4Y28 F;  1HJP A;  2HKJ A;  2Z4S A;  2HAK A;  5EXX A;  3CF0 A;  2O01 F;  2CRU A;  2C99 A;  4DR5 M;  4AG6 A;  2UUC M;  1L1T A;  1HT2 E;  3QYB A;  3B7N A;  1PJI A;  2DAE A;  4I5S A;  2XGN A;  1YU1 A;  2Y2N A;  1P3Q Q;  2R18 A;  2R65 A;  3FTC A;  4GC5 A;  4AKI A;  2DVW B;  4LCB A;  2KZU A;  2C98 A;  3R8F A;  4LF5 M;  3N3F A;  3L2A A;  4LF7 M;  1QUS A;  2Y0T A;  4QNR A;  3VLF B;  1KFV A;  3U6Q A;  2UUA M;  4OX9 M;  2ZTC A;  4CGY B;  3U5Z A;  4GHL A;  3SYL A;  2V1C A;  1OKS A;  5KPR A;  1YU4 A;  1XNR M;  4G4Q A;  1W1T A;  3D8L A;  3GLF A;  2V5O A;  1TR8 A;  2F4V M;  3TWK A;  1G8P A;  3FTF A;  2V6Z M;  4Z2H A;  1VDL A;  4LF6 M;  1QAM A;  2CHV A;  2OOA A;  4QOS A;  5EXS A;  2Y20 A;  3EIE A;  4GIP A;  2EUC A;  4YY3 M;  2ERC A;  2F5P A;  4WP2 A;  4NC6 A;  1PM5 A;  4MB3 A;  2MGW A;  2LVQ D;  4S12 A;  1W1V A;  1PDC A;  2JY5 A;  2L6O A;  3GRY A;  2VII A;  1EFU B;  2CWB A;  1TDZ A;  1GO5 A;  1QZM A;  1I94 M;  2KZS A;  3GRR A;  2AHM A;  3A98 B;  2YR0 A;  3EIH A;  4FWG A;  4FWD A;  4WUR A;  4CHT B;  3GLF B;  2L2D A;  5EP2 A;  1D0L A;  3VKH A;  2UU9 M;  1N34 M;  4JI0 M;  1IM2 A;  2Y2H A;  4JN6 A;  4LFC M;  1QO6 A;  4JYA M;  4XBO A;  1AIP C;  4Z2G A;  2FNA A;  4F2L A;  2DZN B;  2LWX A;  4X65 M;  2XLJ A;  3SBJ A;  3KP1 E;  4OU7 A;  2OQ4 A;  5BPV A;  2HWJ A;  1ORY B;  2G3Q A;  3HX3 A;  1N78 A;  3ZC7 B;  4XK8 F;  2Y2P A;  4ZPX A;  4L78 A;  4II7 A;  5EQT A;  5E26 A;  2R44 A;  3BXW A;  1LV7 A;  3L29 A;  4M9Z A;  4LFB M;  2DAK A;  3A46 A;  2UXB M;  1Q3B A;  3NBI A;  1W1P A;  2CEA A;  2DAG A;  1GL7 A;  4HME A;  3GLI E;  4MGZ E;  4DV0 M;  3LVV A;  2Y0Q A;  3AOE C;  3HY5 A;  3J27 B;  1OGG A;  1G4A E;  2QQ8 A;  3GLG E;  1R4G A;  1DGG A;  4DR1 M;  2KNZ A;  3LVW A;  4NRW A;  1KSF X;  1EE8 A;  3L25 A;  2C5R A;  1XWI A;  3FUX A;  2LHG A;  3KOW E;  1XMQ M;  1R2Y A;  1FJG M;  4TUW A;  3A45 A;  1ZQ9 A;  4JI2 M;  3RFW A;  4LJ5 A;  1JR3 A;  3FUW A;  1QYR A;  1ZMW A;  1D2N A;  1BVS A;  1Q39 A;  1N36 M;  1TDH A;  2F5O A;  1NJG A;  1WGL A;  2KDL A;  4I8O A;  3GO8 A;  2XZU A;  2LVO C;  1E6P A;  2CE7 A;  4K0K M;  4QHS A;  2JZ1 A;  3C9P A;  4RF1 A;  1XMO M;  2XFT A;  3KOZ E;  1DGF A;  5ITX A;  1JQJ C;  1XXH A;  2K6B A;  2KRK A;  1JB0 F;  5C1B A;  3Q8X A;  1EAK A;  4IBI A;  2F5S A;  4L8R C;  2O25 A;  4DR3 M;  3U60 B;  4G3O A;  4DV1 M;  1OTR A;  3E9S A;  2JNH A;  2DWZ B;  3IEC A;  2RRU A;  4MGI E;  3R9X B;  1TTE A;  4DUY M;  1G41 A;  2V1U A;  2DAI A;  3LCU A;  3CF6 E;  3DFZ A;  3GLI B;  4LF4 M;  1HNZ M;  1ZMU A;  3SAS A;  3J2P B;  4XGI A;  2VQF M;  1WGN A;  1YE9 A;  1NHG C;  4KLN A;  4MM3 B;  1GKI A;  1QUT A;  3B9P A;  4IBC A;  4LY6 A;  3SAV A;  1G59 A;  3KFU G;  2C9C A;  3GLG B;  1FNN A;  4L6V 6;  4Z2K A;  3SHG B;  1DGH B;  4FD2 A;  3JR5 A;  2Z7J A;  2OOB A;  1PJJ A;  2Y2G A;  3K1J A;  2ZAO A;  2QEN A;  2G8L A;  4OVZ A;  1Y8G A;  1N75 A;  1PJQ A;  2EJS A;  3B7Z A;  2R45 A;  3FRI A;  3FYD A;  4IBD A;  3TWL A;  2DWM A;  2QP9 X;  2Z8Y M;  3OTO M;  2QBY A;  4R7G A;  3KDS E;  1OAO C;  1J7M A;  4HLQ A;  2QCU A;  2GNO A;  3FRH A;  2D7G A;  3FD9 A;  3J7B A;  3W67 A;  2QSF X;  1NHW C;  1YU2 A;  2JE5 A;  4IBG A;  2DHY A;  2LXE A;  3K92 A;  8CAT A;  2JY7 A;  3DA1 A;  4Z2I A;  2DWN A;  2JCH A;  4X64 M;  3AL0 C;  4OJ5 A;  4M0W A;  3I4V A;  2QZ4 A;  2FS1 A;  1Z5C A;  2K47 A;  5EXP A;  3T15 A;  1E32 A;  4B3R M;  2KXE A;  1GJT A;  3TL4 X;  4AZF A;  4B3T M;  2HCB A;  2E5L M;  3IG8 A;  5KO3 A;  1NO1 A;  3GLF E;  3HU3 A;  5FSW A;  4DV2 M;  4DUZ M;  2Y2J A;  3B74 A;  1SXJ C;  4MH0 E;  3DZD A;  4DV5 M;  3NBX X;  1GJS A;  2JUJ A;  1Q02 A;  2ZTD A;  1T43 A;  2LVN C;  3L27 A;  2ZAM A;  3C3E A;  1R5L A;  4FCW A;  1CUK A;  3HKP A;  3AV0 A;  3HHZ A;  2DNA A;  1N77 A;  2LBC A;  2FFJ A;  3FUU A;  2UWX A;  2J7N A;  1Q3C A;  4D80 A;  1E15 A;  3A42 A;  2EO2 A;  4LRS A;  1QZE A;  5KQ8 A;  1K82 A;  2RGH A;  4AW4 A;  1GOI A;  2MJ5 B;  5IWA M;  3WD1 A;  1UM8 A;  1D0M A;  3AOE A;  3SMP A;  3SAW A;  1NNJ A;  1IBM M;  1ZV1 A;  3H4J A;  1ED7 A;  1JR3 D;  1Z5B A;  3HZJ A;  1IY2 A;  3U6E A;  5FTL A;  4QNM A;  2MR9 A;  4LFA M;  4LJA A;  4OW0 A;  2DI0 A;  4GMQ A;  3M7G A;  4LJ8 A;  3VDU A;  2FN2 A;  2JZ0 A;  1OFH A;  3U5Z B;  2CV2 A;  2RTS A;  2CUZ A;  5H37 D;  1IN6 A;  4R3D A;  2EA0 A;  1QQW A;  2BJV A;  5ITU A;  2ZM6 M;  1NSF A;  2VDB B;  3TWM A;  1K3X A;  2Y2L A;  3V76 A;  3HU2 A;  3K9O A;  4DBG B;  3J7A S;  3WHL A;  2BWE A;  2WSF F;  3VKG A;  1T6O A;  3BBZ A;  2KW0 A;  1SXJ D;  1VQ1 A;  5ITQ A;  1D0K A;  3HWS A;  2XEP A;  7CAT A;  4FW9 A;  2N35 A;  1TGU A;  1K3W A;  2I7P A;  3KOY E; 
#chains in the Genus database with same CATH homology
 4RF0 A;  1ZAE A;  2FFF B;  2J7O A;  5GKN A;  2F5Q A;  2KEB A;  2XF3 A;  4QOZ C;  2XSZ D;  1NJF A;  3TQS A;  3SYK A;  4QHT A;  3KXE C;  5JI2 E;  3U6O A;  2D7E A;  3ZCB B;  4AKG A;  2D7H A;  1C1K A;  3HJQ A;  3LQQ A;  4G6Z A;  4KO8 A;  5EP4 A;  1TH2 A;  5ITX E;  3AOG A;  4DR6 M;  3AKZ A;  3U6D A;  4IBF A;  1E94 E;  4JV5 M;  2LNH C;  4FVM A;  1J7K A;  4NYY A;  4FCT A;  1IN8 A;  2W82 A;  4Z6Y A;  2Z3X A;  4NRV A;  1QVR A;  3KSJ A;  1YU0 A;  3AFH A;  1I4W A;  3BOS A;  3GQ4 A;  3SHF A;  4AKH A;  2YNM D;  4LJ7 A;  4IBJ A;  1NNU C;  1N33 M;  3K8Z A;  4B7H A;  2VQE M;  3THG A;  3GP1 A;  2Z4R A;  2X4A A;  2ZAN A;  4LGM A;  4IJE A;  2XH9 A;  4L16 A;  3GLH A;  3T38 A;  3GQ5 A;  1IN5 A;  3U61 A;  4DR4 M;  1MX0 A;  4OJP A;  3I51 A;  2LH0 A;  4LJ4 A;  3U6M A;  3U6S A;  4B3S M;  3HJ8 A;  5ITR A;  4LZZ A;  1HQC A;  3I4Y A;  4JI7 M;  4B7G A;  3TPZ A;  3KS8 A;  4DR2 M;  1IXR C;  3GPY A;  4LZJ A;  1SXJ A;  4NSO B;  4GC9 A;  2OPF A;  2CHQ A;  4BLC A;  2Y2K A;  3M6A A;  2R46 A;  2DXI A;  1XXH B;  4A3V B;  3GPX A;  3ILK A;  3DOA A;  1R6B X;  2XSZ A;  5EP3 A;  3T1H M;  1NY6 A;  3U6C A;  4OJO A;  4AG5 A;  4PDI A;  3KSX A;  1GVN A;  5A2Q S;  3FKE A;  3MK6 A;  4DV7 M;  4CIS A;  3FUT A;  1J09 A;  1TH3 A;  5IRE B;  3UJN A;  4DR7 M;  3GRU A;  5E6J A;  3HSH A;  1X37 A;  4B3M M;  4Z8X A;  2CHG A;  2X8A A;  2FOI C;  4IBK A;  4IIW A;  3T1Y M;  3HJS A;  3JR4 A;  1TH4 A;  1XHB A;  4JI5 M;  1H6U A;  2M5Z A;  1NY5 A;  4I81 A;  4MB7 A;  4OVZ B;  4M9X A;  4PD2 A;  3VFD A;  3PFI A;  2QBY B;  5DYG A;  3RGP A;  4G4O A;  1HT1 E;  2L7I A;  5FTM A;  1IY0 A;  1HNX M;  1QAQ A;  4DV4 M;  3QAU A;  4NXM M;  4L4U A;  3SFZ A;  3J81 S;  4JI6 M;  5DNY A;  3LQR A;  4G4R A;  5DYI A;  4LF8 M;  5ITY A;  4AQY M;  3KS4 A;  1GLN A;  3U6L A;  1G3I A;  5IZ7 D;  1Z59 A;  4D81 A;  1GL6 A;  3VK7 A;  4IJF A;  3VK8 A;  2CV0 A;  5FTJ A;  4GKJ M;  2NQ8 C;  4G4N A;  1IXZ A;  4PT5 A;  5KQD A;  3LMM A;  1DO0 A;  2A5Y B;  2YFQ A;  4GHA A;  2BG1 A;  4NY2 A;  1IY1 A;  3CTW B;  4X66 M;  1W5S A;  4PCZ A;  5EJC A;  1L2B A;  2DWL A;  4B08 A;  4GRI A;  5IT9 S;  2Y2M A;  4MGH A;  4JXJ A;  5JI3 E;  2XFS A;  4NZ5 A;  4EIW A;  4LG2 A;  3HHX A;  3PNY A;  3SAT A;  3K2L A;  4JI1 M;  1Z6T A;  3GPP A;  3FYC A;  4KHP M;  2Y2I A;  1VDD A;  1S3S A;  4NOO B;  3RE8 A;  3MHV C;  3VDP A;  4OJ6 A;  3L26 A;  2G5G X;  2Q2E B;  3D8B A;  2QPA A;  2R4E A;  4FWH A;  1R7R A;  4NXN M;  4M0D A;  1HR0 M;  3UZU A;  3J80 S;  4X62 M;  2FE8 A;  3HHW A;  3JAM S;  5LMU M;  3FTD A;  3SC3 A;  4NZ3 A;  2KRU A;  4LJ6 A;  4LRT A;  1YUE A;  4NSR A;  4RNA A;  2CFO A;  2P5T A;  3H4M A;  2X49 A;  3SAR A;  1L1Z A;  4IBB A;  2DHR A;  4I4L A;  2BNK A;  2R4J A;  4BBA A;  3TE6 A;  3FTE A;  1XC8 A;  2UUB M;  3HHY A;  3UK6 A;  1N32 M;  3U6P A;  1OFI A;  3W0F A;  3QWL A;  4OJL A;  5EP1 A;  4L15 A;  1MU5 A;  2HHH M;  4KOD A;  4WW0 A;  2Y2Q A;  4ITQ A;  2Y2O A;  3KP0 E;  1SXJ E;  3L28 A;  3SMS A;  2UXC M;  1E9S A;  1WXQ A;  3C58 A;  4JI4 M;  5C18 A;  2HL7 A;  5ITT A;  4DV3 M;  1W5T A;  2I7N A;  4LJ9 A;  4D82 A;  3HU1 A;  4GKK M;  5EXT A;  2YQZ A;  2ZBK B;  3GPU A;  4FCV A;  1IN4 A;  4GIT A;  1DGB A;  1YU3 A;  3FUV A;  5FTN A;  3GRV A;  3WHK A;  1OJL A;  1KYI A;  3U60 A;  3HGI A;  2UXD M;  4PDG A;  1QAO A;  5FLX S;  4W5W A;  2M60 A;  4REZ A;  3GLH B;  3U61 B;  3GLI A;  3KW6 A;  1IXS B;  2KA6 B;  2O5R A;  2C96 A;  1Z5A A;  4P16 A;  1HNW M;  3KOX E;  3RGS A;  3GLG A;  3UGJ A;  3UMM A;  1IQP A;  1L8Q A;  1HQY E;  3PXG A;  2JA2 A;  1DGH A;  1NVM A;  2Y21 A;  1T3T A;  4QNL A;  1SXJ B;  3CF2 A;  3WX7 A;  3HON A;  1YUB A;  4LF9 M;  3PNV A;  4MGK E;  4MGY E;  4BB9 A;  2L09 A;  4NL4 H;  4NYU A;  2DZO B;  2H1R A;  3ZH9 B;  3PVS A;  4HL4 A;  4IBE A;  4YHH M;  2L7H A;  4B7F A;  3KVW A;  4NZ4 A;  2RGO A;  2BJW A;  4JI8 M;  2XZF A;  1IN7 A;  5LMN M;  1E9R A;  3E4R A;  2CV1 A;  5KPT A;  4AI6 A;  5F3W A;  3MJ5 A;  1R2Z A;  4GH9 A;  3SAU A;  4M9S A;  1DO2 A;  2XD1 A;  3W0L B;  4DV6 M;  5BR8 M;  1YSY A;  2R62 A;  1IBK M;  5KPZ A;  3AJI B;  1IBL M;  1QAN A;  4OUI A;  2F5N A;  3GQ3 A;  3IG5 A;  2XD5 A;  3NWL A;  5FTK A;  3M0E A;  1L2D A;  4LGY A;  4NZ1 A;  1L2C A;  2IOU A;  4JI3 M;  1J5E M;  2RKO A;  2C9O A;  2HKJ A;  2Z4S A;  5EXX A;  3CF0 A;  2C99 A;  4DR5 M;  4AG6 A;  2UUC M;  1L1T A;  1HT2 E;  1PJI A;  1YU1 A;  4I5S A;  2XGN A;  2Y2N A;  2R18 A;  2R65 A;  3FTC A;  4GC5 A;  4AKI A;  2DVW B;  4LCB A;  2KZU A;  2C98 A;  3R8F A;  4LF5 M;  3N3F A;  3L2A A;  4LF7 M;  2Y0T A;  4QNR A;  3VLF B;  1KFV A;  3U6Q A;  2UUA M;  4OX9 M;  4CGY B;  3U5Z A;  4GHL A;  3SYL A;  2V1C A;  5KPR A;  1YU4 A;  1XNR M;  4G4Q A;  3D8L A;  3GLF A;  2F4V M;  3TWK A;  1G8P A;  3FTF A;  2V6Z M;  1QAM A;  2CHV A;  1XNQ M;  4QOS A;  5EXS A;  2Y20 A;  3EIE A;  4GIP A;  2EUC A;  4YY3 M;  2ERC A;  2F5P A;  1PM5 A;  4S12 A;  2L6O A;  3GRY A;  2VII A;  1TDZ A;  1QZM A;  1I94 M;  2KZS A;  3GRR A;  2AHM A;  3A98 B;  2YR0 A;  3EIH A;  4FWG A;  4FWD A;  4WUR A;  4CHT B;  3GLF B;  5EP2 A;  3VKH A;  2UU9 M;  1N34 M;  4JI0 M;  1IM2 A;  2Y2H A;  4JN6 A;  4LFC M;  4JYA M;  4XBO A;  2FNA A;  4X65 M;  2DZN B;  2LWX A;  2XLJ A;  3SBJ A;  3KP1 E;  4OU7 A;  2OQ4 A;  5BPV A;  1ORY B;  1N78 A;  3ZC7 B;  2Y2P A;  4ZPX A;  4L78 A;  4II7 A;  5EQT A;  5E26 A;  1LV7 A;  3L29 A;  4M9Z A;  4LFB M;  3A46 A;  2UXB M;  1Q3B A;  3NBI A;  2CEA A;  1GL7 A;  4MGZ E;  4DV0 M;  3LVV A;  2Y0Q A;  3AOE C;  3J27 B;  1G4A E;  4DR1 M;  1DGG A;  3LVW A;  4NRW A;  1KSF X;  1EE8 A;  3L25 A;  2C5R A;  1XWI A;  3FUX A;  3KOW E;  1R2Y A;  1XMQ M;  1FJG M;  4TUW A;  3A45 A;  1ZQ9 A;  4JI2 M;  3RFW A;  4LJ5 A;  1JR3 A;  3FUW A;  1D2N A;  1QYR A;  2F5O A;  1Q39 A;  1N36 M;  1TDH A;  1NJG A;  3GO8 A;  4I8O A;  2XZU A;  2CE7 A;  4K0K M;  4QHS A;  1XMO M;  4RF1 A;  2XFT A;  3KOZ E;  1DGF A;  5ITX A;  1JQJ C;  1XXH A;  2KRK A;  5C1B A;  3Q8X A;  4IBI A;  2F5S A;  4L8R C;  4DR3 M;  3U60 B;  4DV1 M;  3E9S A;  2DWZ B;  4MGI E;  3R9X B;  4DUY M;  1G41 A;  2V1U A;  3CF6 E;  3DFZ A;  3GLI B;  4LF4 M;  1HNZ M;  3SAS A;  3J2P B;  4XGI A;  2VQF M;  4KLN A;  1YE9 A;  1NHG C;  4MM3 B;  1GKI A;  3B9P A;  4IBC A;  4LY6 A;  3SAV A;  1G59 A;  3KFU G;  2C9C A;  3GLG B;  1FNN A;  3SHG B;  1DGH B;  4FD2 A;  3JR5 A;  2Z7J A;  1PJJ A;  2Y2G A;  3K1J A;  2ZAO A;  2QEN A;  2G8L A;  4OVZ A;  1N75 A;  3FYD A;  4IBD A;  2DWM A;  2R45 A;  4LF6 M;  3TWL A;  2QP9 X;  3OTO M;  2QBY A;  4R7G A;  3KDS E;  4HLQ A;  2QCU A;  3J7B A;  2D7G A;  3FD9 A;  1NHW C;  1YU2 A;  2JE5 A;  4IBG A;  8CAT A;  2LXE A;  3K92 A;  3DA1 A;  2DWN A;  2JCH A;  4X64 M;  3AL0 C;  4OJ5 A;  4M0W A;  3I4V A;  2QZ4 A;  1Z5C A;  2K47 A;  5EXP A;  3T15 A;  1E32 A;  4B3R M;  2KXE A;  3TL4 X;  4AZF A;  4B3T M;  2HCB A;  2E5L M;  3IG8 A;  5KO3 A;  3HU3 A;  5FSW A;  4DV2 M;  4DUZ M;  2Y2J A;  1SXJ C;  4MH0 E;  3DZD A;  4DV5 M;  3L27 A;  2ZAM A;  4FCW A;  3HKP A;  3AV0 A;  3HHZ A;  1N77 A;  3FUU A;  2FFJ A;  2UWX A;  2J7N A;  1Q3C A;  4D80 A;  3A42 A;  2EO2 A;  4LRS A;  1K82 A;  5KQ8 A;  2RGH A;  4AW4 A;  5IWA M;  1UM8 A;  3AOE A;  3SMP A;  3SAW A;  1NNJ A;  1IBM M;  1JR3 D;  1Z5B A;  1IY2 A;  3U6E A;  5FTL A;  4QNM A;  4LFA M;  4LJA A;  4OW0 A;  3VDU A;  4GMQ A;  3M7G A;  4LJ8 A;  1OFH A;  3U5Z B;  2CV2 A;  2CUZ A;  5H37 D;  1IN6 A;  4R3D A;  2EA0 A;  1QQW A;  2BJV A;  5ITU A;  2ZM6 M;  1NSF A;  3TWM A;  1K3X A;  2Y2L A;  3HU2 A;  3J7A S;  3WHL A;  3VKG A;  2KW0 A;  1SXJ D;  5ITQ A;  3HWS A;  2XEP A;  7CAT A;  4FW9 A;  1TGU A;  1K3W A;  2I7P A;  3KOY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...