5BQHA

Discovery of a potent and selective mpges-1 inhibitor for the treatment of pain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
148
structure length
148
Chain Sequence
b'SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqhA00
4AL0A 5BQHA 3LEOA 5BQIA 4YL1A 4BPMA 3PCVA 4NTBA 4NTAA 4AL1A 4J7TA 2H8AA 2Q7RA 4JC7A 3B29A 4YL3A 4JRZA 4J7YA 3HKKA 5K0IA 4JCZA 3DWWA 4NTFA 2UUIA 5BQGA 4YL0A 4YK5A 2PNOA 2UUHA 4WABA 5HV9A
chains in the Genus database with same CATH superfamily
2R05A 1MNDA 4G7OF 2E87A 4PK4A 1Z63A 4MTGA 4IJJA 3NYLA 4HE8D 3RQFA 3B71A 3EGXA 1ZYRF 1SYQA 1HW1A 1EA8A 1MNEA 3QW1A 2Y3HA 3B29A 5KYYA 1FMVA 3EGDA 1Q0DA 4LLEA 4ULVA 4G7HF 4YT4A 3HKKA 3I5QA 3IHUA 5CI9A 3T4RA 3L1MA 3IEEA 3GM1A 4E7SA 1BR2A 1YA9A 4J32B 1B68A 2NSFA 1PCXA 2YLGA 2DYSC 3WHNA 4C7OB 2CNWD 2HSQA 2IXOA 2PNOA 4YT5A 3TJ5A 1YYXA 4DRJB 2UUHA 1IZMA 2G62A 2L6GA 3KH2A 3K6BA 3K1IA 2R02A 2Q3TA 5IY5C 1YLMA 3WG7C 2AVKA 4YN0B 2FAPB 4FAPB 4JZAA 1JAFA 4KI2A 4OIOF 1LKXA 4XEKA 4UDVA 1HE1A 3LEOA 4A4AA 3E9VA 2QUPA 2QY9A 3PCVA 3LUTB 4HFFB 4U5DE 3W2WA 2IXMA 2XLEA 4AL1A 1PD1A 2H8AA 3UMHA 1FTSA 5A69A 4GQHA 2HJMA 1TWCA 3S28A 5KYUB 2Z15A 1T6IA 1XZPA 3LEVA 5JT4A 5COGA 4BJ5C 4CDVA 2Q4FA 1M57C 4CJGA 2Y3BA 2LD6A 1R4TA 2VB6A 2XS1A 2W4BA 3OA1A 2M64A 4ANJA 1OCOC 2YEVA 2L7AA 3VYWA 2Y3DA 4PR9A 1KNYA 1RJ9B 2WVOA 1Q0MA 3DMDA 4XQ1A 1YZAA 2XS8A 3U9MA 4CS9C 2PX0A 3ZC4A 4C3EA 3E70C 2R9RB 3ATPA 3FOPA 1C17M 3JZ0A 4HFKB 1Z3IX 4NC3A 1ZHWA 2H7VC 1RKEB 2HMZA 1YJGA 1ZU4A 3SXKA 2Q9CA 5DS4A 4O7GA 5DS6A 1M56C 1OCZC 1FAPB 4MQ9F 2L9JA 1YAUO 4C3BA 3AG4C 4OD5A 4YWQA 4C7OA 3GODA 3T6BA 3PMRA 3ZTZA 3C18A 3RF3A 2XM4A 1A7VA 3C8GA 4BJ5A 3RH3A 3X1OA 4E17A 2LSEA 1NLXA 3LLKA 3A9CA 2PP4A 3TOMA 5A6AA 4D4NA 2X51A 4K1OA 4DVYP 2R7TA 2WL8A 3B0PA 1OCCC 3U8PA 3IQCA 3OWTA 1FFTC 1J8MF 1ZVZA 2G3KA 3GANA 3ITFA 3SP1A 3TJ6A 1E86A 3SXZA 3U2LA 5L3QA 3HNJA 3QW0A 4CS9A 3F47A 1U6HA 4H54A 3TULA 2EIKC 3T9OA 3KL4A 3UNGC 5JUAA 1Z23A 1FNTc 2V3CC 3GM2A 1MMNA 2RSEB 3EPVA 5KYUA 1LS1A 3H65A 1JPJA 4FWVA 5B1AC 1IW7F 3T6JA 4X0RA 2CGEA 1ZHYA 5AC4A 2XLMA 1QQ3A 5DVWA 2BC5A 4E0HA 2R7XA 2J9WA 4XPWA 1VLTA 4DBQA 1LIHA 4EHPA 5JVEA 2ZXWC 3PHF2 1RJ9A 5F28E 1TWHA 3DI5A 4XLPF 1T6QA 5L0JA 1FFHA 1MMDA 3CEXA 3FHDA 2XRHA 3HJCA 4RD9A 5HV9A 2I15A 4MVSA 2W45A 5GPGB 4DVZA 2HUJA 1K05A 4DBRA 1RKEA 1WGWA 2JPUA 1N1CA 2EIMC 2ZXRA 3I4UA 1LPEA 3FAJA 3MYFA 3KKBA 3TOLA 5EHHA 2YVKA 4JKVA 3SNHA 1MMAA 2J9VA 3U9JA 2KJGA 1E84A 3M4BA 1U0BB 2P61A 1KU2A 2EINC 4JIOA 4E18A 3JT1A 3AQBA 3HLZA 2LCHA 4PJLA 2WZFA 3DKAA 2LQGA 3H2UA 3C8GD 4A2NB 3SEOA 1G8XA 4NTFA 3F46A 4DRHB 4U5HA 4BG0A 1RKCA 3CSKA 2GA0A 3EHNA 2Q9AA 1LE2A 5JSLA 2C03A 2MWQA 2DI3A 1PV3A 5CIVA 3HNIA 3W8HA 4BJ1A 3NMJA 3AG3C 2CCYA 4EIYA 3LNRA 1JPNA 2IOQA 1HE9A 3IPMO 1OW7A 3L34A 4PJJA 5D92A 2O9XA 3DE8A 5D91A 4JTDB 4EBKA 5DS5A 4P6IC 3DM5A 3RIPA 1Y4CA 4Z9HA 3R7CA 5DQZA 2HV6A 4I1OB 1NFNA 4NTBA 1QLEC 2VC9A 2XLDA 2YLDA 4I1MA 2A0UA 2NG1A 1YDIA 4CJOA 4DRIB 4ULWA 4U5BE 2ICWG 3AGUA 1AEPA 3EH1A 3FAPB 3JYHA 1I4YA 1W2WA 3ECSA 3RW0A 4LDQA 2ZPAA 3RQGA 1TWGA 3EFOB 3MLGA 3ABMC 1VTMP 1HY5A 2OG2A 3CAXA 1D1AA 2VCBA 1RMVA 2HV7A 3OEOA 4O6NA 1BDJB 4K7BA 1R5ID 4IRUA 4NCQA 3WAQA 1BBHA 2P6VA 1M2VA 4CX9A 2XL4A 4XPXA 4MVQA 4E0IA 3DJNB 2H7BA 1YYJA 4PFPA 4JVSA 1VK5A 1Z6AA 2J0WA 4MVMA 4MW3A 1SR2A 4DOZA 2Q7RA 2G3VA 1TFOB 2A1DD 3M1CB 2XM0A 5EGYA 5KYXB 2IXPA 3G4ZA 4RDAA 5BUOA 2EPOA 4EUKB 3KMIA 2BE5F 1V74B 1QSPA 2YWAA 4XPYA 5E33A 2R7SA 2XLWA 3ZQYA 4P9TA 2NUPB 4OIRF 2OQMA 4YK5A 4DXWA 2WVQA 1XZQA 1A41A 2XLOA 4XLNF 1ST6A 1LI7A 3EZIA 2ZD9A 5F5HA 3ZDLA 4EWCA 1G4WR 3Q7GA 4JW1A 3AG1C 3QZCA 1TR2A 3SZRA 2QLAA 1RXQA 2KNHA 3B0VC 2M4EA 1BR1A 3U5SA 1NZEA 2WZLA 1NG1A 3SXYA 4GEHA 3C7JA 3RVZA 1OCRC 3SXMA 2D4UA 3M15A 3EQLF 1G5ZA 3GEHA 4WGZA 1TWAA 3DD7A 4J7TA 2FGYA 1JRAA 2Y39A 3I5PA 4FESA 2W9YA 3NKDA 3FVYA 2J0XA 1VLSA 1JR8A 2A0BA 3IQ5A 4JRZA 1BZ4A 1Z5ZA 4IGGA 4LERA 1Y6DA 2LIGA 3EFOA 4JEBA 1OKKA 3GWLA 1ZU5A 1NU9C 3HNKA 2R7VA 2F22A 2JX0A 1ORSC 4N6CA 1ZZPA 1E2XA 2DGJA 3IQTA 1DOVA 4YT2A 5AC5A 1VOMA 5A6BA 5L0FA 3L8IA 4EBBA 1VB5A 2GAQA 4U9EA 2HJ3A 3GEEA 4U5FE 1LS4A 3UGPA 1KTMA 1PD0A 1O3UA 2OU6A 4I3MA 3TK0A 2AU5A 1K04A 4JJFA 1OR3A 1CGOA 5KYXA 4QI0A 3AG2C 2YL1A 3LAYA 3M4CA 4PFOA 1M6TA 5T3WA 2DB4A 2IYLD 4JC7A 1L7CA 3JRMO 5L0GA 2PFDA 3FDQA 3A11A 2EPLX 3AJMA 3O39A 4J7YA 1FR0A 1CPRA 2NUPA 1LVKA 4LLCA 1JMWA 2WZGA 1TKNA 4C3DA 4F4BA 2YL3A 1SZIA 2I8BA 3ABLC 3DAGA 5T3TA 3S90A 3GEIA 2KGOA 1T5OA 1C03A 2HMQA 2NSGA 4U5GA 2Y69C 2HKVA 2J8WA 1GGQA 2EILC 1AUEA 4EBJA 1GQAA 1ZHZA 1MMGA 5FCLA 4ZLCA 1WASA 1QVXA 3V5YA 1E85A 1O87A 4G7ZF 3B0UX 3S29A 3V7OA 3ZSUA 2R03A 1EI7A 2C04A 3NMIA 3VM6A 4IB4A 1APCA 2KYHA 4KNVA 2H7OA 5E3AA 2OEVA 2R25A 1WATA 1OKKD 2L6HA 3RKOF 3KYJA 2P1AA 4JCZA 2HFIA 5KYYB 1DOWA 2NUTB 1D0ZA 3L8JA 3ZQVA 4FX5A 1S7ZA 2VCCA 4LDKA 2QE9A 1HMOA 1LI5A 3ZVRA 2PBEA 1D0XA 4L6RA 3IQ6A 1XWJA 2HSBA 3EG9B 5A6BD 2MHRA 3HNLA 3J06A 2XL8A 5KYWB 2XXAB 2B0JA 2J7PA 2R7OA 5F5FA 3MX3A 1WTYA 4N4WA 3G50A 3Q7LA 1M2OA 4N06A 2L81A 3FOOA 1EQ1A 1FMWA 1TFKB 3JTLO 4PJNA 1GM5A 3VRCA 1U89A 4K0DA 4PJMA 5BQIA 2EPKX 4XEVA 3KPHA 4MVOA 4XWJA 4BPMA 3DXJF 2R7RA 5B3IA 1EKYA 1AVOB 4CIPA 1K40A 4G78A 5JP7A 2OKUA 5L0IA 4N6HA 4YL3A 3S27A 1F1MA 2WB7A 2J9UA 4CDYA 3UR3C 3B9QA 4MS2A 1OXKA 3BRJA 3C63A 3O55A 4MW8A 2LP4A 2R7WA 4U5EE 1VYIA 1MQVA 1LE4A 3ZIBA 1WN0A 4CIHA 3NYJA 1BR4A 3RQEA 1H9TA 1OW6A 3ZWIA 2ETSA 2VH3A 2XLHA 4O6MA 4ONSA 1V54C 4WABA 2A69F 3QMKA 4WJ0A 4LACB 2JD3A 2A68F 3V5XA 5A6JA 1ZHXA 2FFHA 2AWCA 1OQCA 1D0YA 3N0TA 1ZW3A 3JCUQ 4PACA 4QI2A 3ZG1A 3WODF 1YZCA 2J45A 5L0CA 5COFA 2QTVA 1GS9A 2VCAA 4YJWA 1Z7Qc 3PDMP 4OIQF 2NUTA 4IAQA 3DZAA 1A7EA 1V4AA 2HZ8A 3DJUB 2A6EF 2W4MA 3W8IA 4AE4B 1A7DA 2KSFA 2CDQA 2XL6A 2D5RB 2EIJC 3HTKC 2R7UA 4AX2A 3CZ6A 3EG9A 1Q0GA 5T1DB 3T6GB 3NMKA 2CYDA 4ER9A 2YHSA 3SYNA 3TQOA 4BEJA 5KYWA 2XXAA 1S05A 3C8ZA 4YL0A 3C8GB 2OOCA 3DE9A 4KBLA 2J7PD 2XSEA 3VF0A 1CGNA 4NQFA 3JYYA 3EH2A 4IWBA 2AP3A 3S9OA 3ASOC 3NKEA 3LS0A 1VYKA 1D1CA 3TD7A 3NDBB 1NBBA 3JSEO 1HW2A 2MYSA 1I4ZA 2NPUA 2RD9A 4HEAJ 4U5CE 3AOUA 4H4KC 4JTAB 4MTFA 4R32A 2X0CA 1SMYF 2GFHA 2OCCC 3RVYA 4E7ZA 5DQTA 1T01A 2YKZA 3AGTA 3JSZA 4U9DA 2R7QA 4MVRA 2KC3A 1QZXA 1YA7O 3KYIA 4BEMJ 2HS5A 4B6IA 2UUIA 2IM8A 3S0XA 2OEXA 5BQGA 5AGFA 1LM3B 2J9BA 4CDAA 2KW3C 4WGYA 1UFBA 2YZSA 3FMSA 3Q6MA 4XEFA 3FXHA 3U3BA 5L3VA 5TJ5E 4W8KA 3EJNA 3U3FA 4XTKA 3NYMA 5EK0A 4J30B 2Q00A 1J8YF 3K66A 2XLVA 5E3CA 4D4XA 5B3SC 4RBNA 4Q4ZF 3U2MA 4AL0A 4BJ6C 2OJED 4BJTA 5L0HA 1NSGB 1O5HA 1H7IA 2LFDA 3NG1A 5L0DA 2LK4A 1HMDA 3RYLA 3N2ZB 5BQHA 3RFYA 4JCHA 3CQZA 1Q0FA 3U8VA 1CGME 1VMAA 2B0HA 3K7DA 4G0HA 3LESA 3LJBA 4NTAA 3UMIA 2VASA 4OINF 4KNWA 4AE4A 2ASRA 3M79A 4KC9A 2P7VA 1H6GA 1QKRA 5JLIA 2J46A 1YVIA 4NY3A 4Z9IA 1ORYA 4CSAC 4I44A 3LLIA 3H2VA 4YT8A 2BL2A 3MYIA 3U0CA 2DYRC 3K33A 2IXNA 3EZHA 3LNMB 3BEHA 2IBFA 1WOLA 2AWYA 3QVYA 5DLJA 5COMA 2ZXPA 2YQYA 4MVUA 4JJGA 4M63A 4AK9A 2P0NA 2V26A 1V55C 1C02A 1NU7D 1CPQA 3DM9B 4MTOA 1I5NA 3LS1A 1NFOA 4BJ6A 3W4YA 3US6A 3QTHA 1L3PA 4MVZA 2Y3GA 2KK1A 3L0IA 5JS5A 2LFFA 2YLIA 3EGXB 4Q7CA 3GORA 5K0IA 4CS8C 4GYTA 1QPUA 4JTCB 3DWWA 3G4XA 256BA 4P9FA 3EGDB 4CSAA 1G4US 2L6FA 3X2QC 1ORJA 4QDLA 1T9KA 3N24A 5KYNA 4ZLDA 3GWNA 4Q5SF 4CBEA 3R2PA 2GWWA 2CNWA 3MBGA 4LDRA 3POVA 5E2QA 3V5ZA 2QNLA 3K1HA 5FZTA 3VAYA 4O79A 1TQGA 3C62A 4IAOA 1A0BA 1UG7A 3QVZA 1YARO 3MFNA 1OXBA 4JEAA 5B1BC 3ZTMA 2WVNA 2YL0A 2PF4E 1M2VB 1WWPA 2ZXOA 4OD4A 1H9GA 1OR2A 1SF8A 4YL1A 1ZW2A 3AQCA 3O6XA 3EHMA 3Q6NA 4JURI 3NRHA 1T6UA 2KQ9A 4O6YA 5A6KA 1JOGA 2OJQA 1OW8A 3JRTA 3S84A 2Q9BA 1D1BA 2PX3A 3DAFA 3GM3A 3ABKC 2EPNA 4CS8A 2A6HF 5CI8A 4CS7A 4EKWA 2YL7A 3ASNC 2EPMX 4JE9A 3UGOA 1Q0KA 3W2VA 4DJ9A 5JRAA 4OIPF 4MNDA 2YRFA 3O10A 2CW0F 2TMVP 4Z9JA 5HSWA 1ZHTA 4IARA 3K1IC 1E83A 4W8PA 3UMKA 2GDCA 1RCPA
chains in the Genus database with same CATH topology
4AL0A 5BQHA 3LEOA 5BQIA 4YL1A 4BPMA 3PCVA 4NTBA 4NTAA 4AL1A 4J7TA 2H8AA 2Q7RA 4JC7A 3B29A 4YL3A 4JRZA 4J7YA 3HKKA 5K0IA 4JCZA 3DWWA 4NTFA 2UUIA 5BQGA 4YL0A 4YK5A 2PNOA 2UUHA 4WABA 5HV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AL0 A;  5BQH A;  3LEO A;  5BQI A;  4YL1 A;  4BPM A;  3PCV A;  4NTB A;  4NTA A;  4AL1 A;  4J7T A;  2H8A A;  2Q7R A;  4JC7 A;  3B29 A;  4YL3 A;  4JRZ A;  4J7Y A;  3HKK A;  5K0I A;  4JCZ A;  3DWW A;  4NTF A;  2UUI A;  5BQG A;  4YL0 A;  4YK5 A;  2PNO A;  2UUH A;  4WAB A;  5HV9 A; 
#chains in the Genus database with same CATH topology
 2R05 A;  1MND A;  4G7O F;  2E87 A;  4PK4 A;  1Z63 A;  4MTG A;  4IJJ A;  3NYL A;  4HE8 D;  3RQF A;  3B71 A;  3EGX A;  1ZYR F;  1SYQ A;  1HW1 A;  1EA8 A;  1MNE A;  3QW1 A;  2Y3H A;  3B29 A;  5KYY A;  1FMV A;  3EGD A;  1Q0D A;  4LLE A;  4ULV A;  4G7H F;  4YT4 A;  3HKK A;  3I5Q A;  3IHU A;  5CI9 A;  3T4R A;  3L1M A;  3IEE A;  3GM1 A;  4E7S A;  1BR2 A;  1YA9 A;  4J32 B;  1B68 A;  2NSF A;  1PCX A;  2YLG A;  2DYS C;  3WHN A;  4C7O B;  2CNW D;  2HSQ A;  2IXO A;  2PNO A;  4YT5 A;  3TJ5 A;  1YYX A;  4DRJ B;  2UUH A;  1IZM A;  2G62 A;  2L6G A;  3KH2 A;  3K6B A;  3K1I A;  2R02 A;  2Q3T A;  5IY5 C;  1YLM A;  3WG7 C;  2AVK A;  4YN0 B;  2FAP B;  4FAP B;  4JZA A;  1JAF A;  4KI2 A;  4OIO F;  1LKX A;  4XEK A;  4UDV A;  1HE1 A;  3LEO A;  4A4A A;  3E9V A;  2QUP A;  2QY9 A;  3PCV A;  3LUT B;  4HFF B;  4U5D E;  3W2W A;  2IXM A;  2XLE A;  4AL1 A;  1PD1 A;  2H8A A;  3UMH A;  1FTS A;  5A69 A;  4GQH A;  2HJM A;  1TWC A;  3S28 A;  5KYU B;  2Z15 A;  1T6I A;  1XZP A;  3LEV A;  5JT4 A;  5COG A;  4BJ5 C;  4CDV A;  2Q4F A;  1M57 C;  4CJG A;  2Y3B A;  2LD6 A;  1R4T A;  2VB6 A;  2XS1 A;  2W4B A;  3OA1 A;  2M64 A;  4ANJ A;  1OCO C;  2YEV A;  2L7A A;  3VYW A;  2Y3D A;  4PR9 A;  1KNY A;  1RJ9 B;  2WVO A;  1Q0M A;  3DMD A;  4XQ1 A;  1YZA A;  2XS8 A;  3U9M A;  4CS9 C;  2PX0 A;  3ZC4 A;  4C3E A;  3E70 C;  2R9R B;  3ATP A;  3FOP A;  1C17 M;  3JZ0 A;  4HFK B;  1Z3I X;  4NC3 A;  1ZHW A;  2H7V C;  1RKE B;  2HMZ A;  1YJG A;  1ZU4 A;  3SXK A;  2Q9C A;  5DS4 A;  4O7G A;  5DS6 A;  1M56 C;  1OCZ C;  1FAP B;  4MQ9 F;  2L9J A;  1YAU O;  4C3B A;  3AG4 C;  4OD5 A;  4YWQ A;  4C7O A;  3GOD A;  3T6B A;  3PMR A;  3ZTZ A;  3C18 A;  3RF3 A;  2XM4 A;  1A7V A;  3C8G A;  4BJ5 A;  3RH3 A;  3X1O A;  4E17 A;  2LSE A;  1NLX A;  3LLK A;  3A9C A;  2PP4 A;  3TOM A;  5A6A A;  4D4N A;  2X51 A;  4K1O A;  4DVY P;  2R7T A;  2WL8 A;  3B0P A;  1OCC C;  3U8P A;  3IQC A;  3OWT A;  1FFT C;  1J8M F;  1ZVZ A;  2G3K A;  3GAN A;  3ITF A;  3SP1 A;  3TJ6 A;  1E86 A;  3SXZ A;  3U2L A;  5L3Q A;  3HNJ A;  3QW0 A;  4CS9 A;  3F47 A;  1U6H A;  4H54 A;  3TUL A;  2EIK C;  3T9O A;  3KL4 A;  3UNG C;  5JUA A;  1Z23 A;  1FNT c;  2V3C C;  3GM2 A;  1MMN A;  2RSE B;  3EPV A;  5KYU A;  1LS1 A;  3H65 A;  1JPJ A;  4FWV A;  5B1A C;  1IW7 F;  3T6J A;  4X0R A;  2CGE A;  1ZHY A;  5AC4 A;  2XLM A;  1QQ3 A;  5DVW A;  2BC5 A;  4E0H A;  2R7X A;  2J9W A;  4XPW A;  1VLT A;  4DBQ A;  1LIH A;  4EHP A;  5JVE A;  2ZXW C;  3PHF 2;  1RJ9 A;  5F28 E;  1TWH A;  3DI5 A;  4XLP F;  1T6Q A;  5L0J A;  1FFH A;  1MMD A;  3CEX A;  3FHD A;  2XRH A;  3HJC A;  4RD9 A;  5HV9 A;  2I15 A;  4MVS A;  2W45 A;  5GPG B;  4DVZ A;  2HUJ A;  1K05 A;  4DBR A;  1RKE A;  1WGW A;  2JPU A;  1N1C A;  2EIM C;  2ZXR A;  3I4U A;  1LPE A;  3FAJ A;  3MYF A;  3KKB A;  3TOL A;  5EHH A;  2YVK A;  4JKV A;  3SNH A;  1MMA A;  2J9V A;  3U9J A;  2KJG A;  1E84 A;  3M4B A;  1U0B B;  2P61 A;  1KU2 A;  2EIN C;  4JIO A;  4E18 A;  3JT1 A;  3AQB A;  3HLZ A;  2LCH A;  4PJL A;  2WZF A;  3DKA A;  2LQG A;  3H2U A;  3C8G D;  4A2N B;  3SEO A;  1G8X A;  4NTF A;  3F46 A;  4DRH B;  4U5H A;  4BG0 A;  1RKC A;  3CSK A;  2GA0 A;  3EHN A;  2Q9A A;  1LE2 A;  5JSL A;  2C03 A;  2MWQ A;  2DI3 A;  1PV3 A;  5CIV A;  3HNI A;  3W8H A;  4BJ1 A;  3NMJ A;  3AG3 C;  2CCY A;  4EIY A;  3LNR A;  1JPN A;  2IOQ A;  1HE9 A;  3IPM O;  1OW7 A;  3L34 A;  4PJJ A;  5D92 A;  2O9X A;  3DE8 A;  5D91 A;  4JTD B;  4EBK A;  5DS5 A;  4P6I C;  3DM5 A;  3RIP A;  1Y4C A;  4Z9H A;  3R7C A;  5DQZ A;  2HV6 A;  4I1O B;  1NFN A;  4NTB A;  1QLE C;  2VC9 A;  2XLD A;  2YLD A;  4I1M A;  2A0U A;  2NG1 A;  1YDI A;  4CJO A;  4DRI B;  4ULW A;  4U5B E;  2ICW G;  3AGU A;  1AEP A;  3EH1 A;  3FAP B;  3JYH A;  1I4Y A;  1W2W A;  3ECS A;  3RW0 A;  4LDQ A;  2ZPA A;  3RQG A;  1TWG A;  3EFO B;  3MLG A;  3ABM C;  1VTM P;  1HY5 A;  2OG2 A;  3CAX A;  1D1A A;  2VCB A;  1RMV A;  2HV7 A;  3OEO A;  4O6N A;  1BDJ B;  4K7B A;  1R5I D;  4IRU A;  4NCQ A;  3WAQ A;  1BBH A;  2P6V A;  1M2V A;  4CX9 A;  2XL4 A;  4XPX A;  4MVQ A;  4E0I A;  3DJN B;  2H7B A;  1YYJ A;  4PFP A;  4JVS A;  1VK5 A;  1Z6A A;  2J0W A;  4MVM A;  4MW3 A;  1SR2 A;  4DOZ A;  2Q7R A;  2G3V A;  1TFO B;  2A1D D;  3M1C B;  2XM0 A;  5EGY A;  5KYX B;  2IXP A;  3G4Z A;  4RDA A;  5BUO A;  2EPO A;  4EUK B;  3KMI A;  2BE5 F;  1V74 B;  1QSP A;  2YWA A;  4XPY A;  5E33 A;  2R7S A;  2XLW A;  3ZQY A;  4P9T A;  2NUP B;  4OIR F;  2OQM A;  4YK5 A;  4DXW A;  2WVQ A;  1XZQ A;  1A41 A;  2XLO A;  4XLN F;  1ST6 A;  1LI7 A;  3EZI A;  2ZD9 A;  5F5H A;  3ZDL A;  4EWC A;  1G4W R;  3Q7G A;  4JW1 A;  3AG1 C;  3QZC A;  1TR2 A;  3SZR A;  2QLA A;  1RXQ A;  2KNH A;  3B0V C;  2M4E A;  1BR1 A;  3U5S A;  1NZE A;  2WZL A;  1NG1 A;  3SXY A;  4GEH A;  3C7J A;  3RVZ A;  1OCR C;  3SXM A;  2D4U A;  3M15 A;  3EQL F;  1G5Z A;  3GEH A;  4WGZ A;  1TWA A;  3DD7 A;  4J7T A;  2FGY A;  1JRA A;  2Y39 A;  3I5P A;  4FES A;  2W9Y A;  3NKD A;  3FVY A;  2J0X A;  1VLS A;  1JR8 A;  2A0B A;  3IQ5 A;  4JRZ A;  1BZ4 A;  1Z5Z A;  4IGG A;  4LER A;  1Y6D A;  2LIG A;  3EFO A;  4JEB A;  1OKK A;  3GWL A;  1ZU5 A;  1NU9 C;  3HNK A;  2R7V A;  2F22 A;  2JX0 A;  1ORS C;  4N6C A;  1ZZP A;  1E2X A;  2DGJ A;  3IQT A;  1DOV A;  4YT2 A;  5AC5 A;  1VOM A;  5A6B A;  5L0F A;  3L8I A;  4EBB A;  1VB5 A;  2GAQ A;  4U9E A;  2HJ3 A;  3GEE A;  4U5F E;  1LS4 A;  3UGP A;  1KTM A;  1PD0 A;  1O3U A;  2OU6 A;  4I3M A;  3TK0 A;  2AU5 A;  1K04 A;  4JJF A;  1OR3 A;  1CGO A;  5KYX A;  4QI0 A;  3AG2 C;  2YL1 A;  3LAY A;  3M4C A;  4PFO A;  1M6T A;  5T3W A;  2DB4 A;  2IYL D;  4JC7 A;  1L7C A;  3JRM O;  5L0G A;  2PFD A;  3FDQ A;  3A11 A;  2EPL X;  3AJM A;  3O39 A;  4J7Y A;  1FR0 A;  1CPR A;  2NUP A;  1LVK A;  4LLC A;  1JMW A;  2WZG A;  1TKN A;  4C3D A;  4F4B A;  2YL3 A;  1SZI A;  2I8B A;  3ABL C;  3DAG A;  5T3T A;  3S90 A;  3GEI A;  2KGO A;  1T5O A;  1C03 A;  2HMQ A;  2NSG A;  4U5G A;  2Y69 C;  2HKV A;  2J8W A;  1GGQ A;  2EIL C;  1AUE A;  4EBJ A;  1GQA A;  1ZHZ A;  1MMG A;  5FCL A;  4ZLC A;  1WAS A;  1QVX A;  3V5Y A;  1E85 A;  1O87 A;  4G7Z F;  3B0U X;  3S29 A;  3V7O A;  3ZSU A;  2R03 A;  1EI7 A;  2C04 A;  3NMI A;  3VM6 A;  4IB4 A;  1APC A;  2KYH A;  4KNV A;  2H7O A;  5E3A A;  2OEV A;  2R25 A;  1WAT A;  1OKK D;  2L6H A;  3RKO F;  3KYJ A;  2P1A A;  4JCZ A;  2HFI A;  5KYY B;  1DOW A;  2NUT B;  1D0Z A;  3L8J A;  3ZQV A;  4FX5 A;  1S7Z A;  2VCC A;  4LDK A;  2QE9 A;  1HMO A;  1LI5 A;  3ZVR A;  2PBE A;  1D0X A;  4L6R A;  3IQ6 A;  1XWJ A;  2HSB A;  3EG9 B;  5A6B D;  2MHR A;  3HNL A;  3J06 A;  2XL8 A;  5KYW B;  2XXA B;  2B0J A;  2J7P A;  2R7O A;  5F5F A;  3MX3 A;  1WTY A;  4N4W A;  3G50 A;  3Q7L A;  1M2O A;  4N06 A;  2L81 A;  3FOO A;  1EQ1 A;  1FMW A;  1TFK B;  3JTL O;  4PJN A;  1GM5 A;  3VRC A;  1U89 A;  4K0D A;  4PJM A;  5BQI A;  2EPK X;  4XEV A;  3KPH A;  4MVO A;  4XWJ A;  4BPM A;  3DXJ F;  2R7R A;  5B3I A;  1EKY A;  1AVO B;  4CIP A;  1K40 A;  4G78 A;  5JP7 A;  2OKU A;  5L0I A;  4N6H A;  4YL3 A;  3S27 A;  1F1M A;  2WB7 A;  2J9U A;  4CDY A;  3UR3 C;  3B9Q A;  4MS2 A;  1OXK A;  3BRJ A;  3C63 A;  3O55 A;  4MW8 A;  2LP4 A;  2R7W A;  4U5E E;  1VYI A;  1MQV A;  1LE4 A;  3ZIB A;  1WN0 A;  4CIH A;  3NYJ A;  1BR4 A;  3RQE A;  1H9T A;  1OW6 A;  3ZWI A;  2ETS A;  2VH3 A;  2XLH A;  4O6M A;  4ONS A;  1V54 C;  4WAB A;  2A69 F;  3QMK A;  4WJ0 A;  4LAC B;  2JD3 A;  2A68 F;  3V5X A;  5A6J A;  1ZHX A;  2FFH A;  2AWC A;  1OQC A;  1D0Y A;  3N0T A;  1ZW3 A;  3JCU Q;  4PAC A;  4QI2 A;  3ZG1 A;  3WOD F;  1YZC A;  2J45 A;  5L0C A;  5COF A;  2QTV A;  1GS9 A;  2VCA A;  4YJW A;  1Z7Q c;  3PDM P;  4OIQ F;  2NUT A;  4IAQ A;  3DZA A;  1A7E A;  1V4A A;  2HZ8 A;  3DJU B;  2A6E F;  2W4M A;  3W8I A;  4AE4 B;  1A7D A;  2KSF A;  2CDQ A;  2XL6 A;  2D5R B;  2EIJ C;  3HTK C;  2R7U A;  4AX2 A;  3CZ6 A;  3EG9 A;  1Q0G A;  5T1D B;  3T6G B;  3NMK A;  2CYD A;  4ER9 A;  2YHS A;  3SYN A;  3TQO A;  4BEJ A;  5KYW A;  2XXA A;  1S05 A;  3C8Z A;  4YL0 A;  3C8G B;  2OOC A;  3DE9 A;  4KBL A;  2J7P D;  2XSE A;  3VF0 A;  1CGN A;  4NQF A;  3JYY A;  3EH2 A;  4IWB A;  2AP3 A;  3S9O A;  3ASO C;  3NKE A;  3LS0 A;  1VYK A;  1D1C A;  3TD7 A;  3NDB B;  1NBB A;  3JSE O;  1HW2 A;  2MYS A;  1I4Z A;  2NPU A;  2RD9 A;  4HEA J;  4U5C E;  3AOU A;  4H4K C;  4JTA B;  4MTF A;  4R32 A;  2X0C A;  1SMY F;  2GFH A;  2OCC C;  3RVY A;  4E7Z A;  5DQT A;  1T01 A;  2YKZ A;  3AGT A;  3JSZ A;  4U9D A;  2R7Q A;  4MVR A;  2KC3 A;  1QZX A;  1YA7 O;  3KYI A;  4BEM J;  2HS5 A;  4B6I A;  2UUI A;  2IM8 A;  3S0X A;  2OEX A;  5BQG A;  5AGF A;  1LM3 B;  2J9B A;  4CDA A;  2KW3 C;  4WGY A;  1UFB A;  2YZS A;  3FMS A;  3Q6M A;  4XEF A;  3FXH A;  3U3B A;  5L3V A;  5TJ5 E;  4W8K A;  3EJN A;  3U3F A;  4XTK A;  3NYM A;  5EK0 A;  4J30 B;  2Q00 A;  1J8Y F;  3K66 A;  2XLV A;  5E3C A;  4D4X A;  5B3S C;  4RBN A;  4Q4Z F;  3U2M A;  4AL0 A;  4BJ6 C;  2OJE D;  4BJT A;  5L0H A;  1NSG B;  1O5H A;  1H7I A;  2LFD A;  3NG1 A;  5L0D A;  2LK4 A;  1HMD A;  3RYL A;  3N2Z B;  5BQH A;  3RFY A;  4JCH A;  3CQZ A;  1Q0F A;  3U8V A;  1CGM E;  1VMA A;  2B0H A;  3K7D A;  4G0H A;  3LES A;  3LJB A;  4NTA A;  3UMI A;  2VAS A;  4OIN F;  4KNW A;  4AE4 A;  2ASR A;  3M79 A;  4KC9 A;  2P7V A;  1H6G A;  1QKR A;  5JLI A;  2J46 A;  1YVI A;  4NY3 A;  4Z9I A;  1ORY A;  4CSA C;  4I44 A;  3LLI A;  3H2V A;  4YT8 A;  2BL2 A;  3MYI A;  3U0C A;  2DYR C;  3K33 A;  2IXN A;  3EZH A;  3LNM B;  3BEH A;  2IBF A;  1WOL A;  2AWY A;  3QVY A;  5DLJ A;  5COM A;  2ZXP A;  2YQY A;  4MVU A;  4JJG A;  4M63 A;  4AK9 A;  2P0N A;  2V26 A;  1V55 C;  1C02 A;  1NU7 D;  1CPQ A;  3DM9 B;  4MTO A;  1I5N A;  3LS1 A;  1NFO A;  4BJ6 A;  3W4Y A;  3US6 A;  3QTH A;  1L3P A;  4MVZ A;  2Y3G A;  2KK1 A;  3L0I A;  5JS5 A;  2LFF A;  2YLI A;  3EGX B;  4Q7C A;  3GOR A;  5K0I A;  4CS8 C;  4GYT A;  1QPU A;  4JTC B;  3DWW A;  3G4X A;  256B A;  4P9F A;  3EGD B;  4CSA A;  1G4U S;  2L6F A;  3X2Q C;  1ORJ A;  4QDL A;  1T9K A;  3N24 A;  5KYN A;  4ZLD A;  3GWN A;  4Q5S F;  4CBE A;  3R2P A;  2GWW A;  2CNW A;  3MBG A;  4LDR A;  3POV A;  5E2Q A;  3V5Z A;  2QNL A;  3K1H A;  5FZT A;  3VAY A;  4O79 A;  1TQG A;  3C62 A;  4IAO A;  1A0B A;  1UG7 A;  3QVZ A;  1YAR O;  3MFN A;  1OXB A;  4JEA A;  5B1B C;  3ZTM A;  2WVN A;  2YL0 A;  2PF4 E;  1M2V B;  1WWP A;  2ZXO A;  4OD4 A;  1H9G A;  1OR2 A;  1SF8 A;  4YL1 A;  1ZW2 A;  3AQC A;  3O6X A;  3EHM A;  3Q6N A;  4JUR I;  3NRH A;  1T6U A;  2KQ9 A;  4O6Y A;  5A6K A;  1JOG A;  2OJQ A;  1OW8 A;  3JRT A;  3S84 A;  2Q9B A;  1D1B A;  2PX3 A;  3DAF A;  3GM3 A;  3ABK C;  2EPN A;  4CS8 A;  2A6H F;  5CI8 A;  4CS7 A;  4EKW A;  2YL7 A;  3ASN C;  2EPM X;  4JE9 A;  3UGO A;  1Q0K A;  3W2V A;  4DJ9 A;  5JRA A;  4OIP F;  4MND A;  2YRF A;  3O10 A;  2CW0 F;  2TMV P;  4Z9J A;  5HSW A;  1ZHT A;  4IAR A;  3K1I C;  1E83 A;  4W8P A;  3UMK A;  2GDC A;  1RCP A; 
#chains in the Genus database with same CATH homology
 4AL0 A;  5BQH A;  3LEO A;  5BQI A;  4YL1 A;  4BPM A;  3PCV A;  4NTB A;  4NTA A;  4AL1 A;  4J7T A;  2H8A A;  2Q7R A;  4JC7 A;  3B29 A;  4YL3 A;  4JRZ A;  4J7Y A;  3HKK A;  5K0I A;  4JCZ A;  3DWW A;  4NTF A;  2UUI A;  5BQG A;  4YL0 A;  4YK5 A;  2PNO A;  2UUH A;  4WAB A;  5HV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...