5BQHA

Discovery of a potent and selective mpges-1 inhibitor for the treatment of pain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqhA00
4YK5A 4NTFA 4J7YA 4YL1A 5HV9A 2H8AA 3B29A 5BQHA 2Q7RA 5BQIA 4AL0A 4BPMA 3PCVA 4YL0A 4JC7A 4YL3A 2PNOA 2UUIA 4AL1A 3LEOA 3HKKA 5K0IA 4J7TA 4JCZA 4NTAA 3DWWA 5BQGA 2UUHA 4JRZA 4NTBA 4WABA
chains in the Genus database with same CATH superfamily
2R7OA 1NFOA 5CIVA 3N24A 1NG1A 5HV9A 4LLEA 5L0GA 1TWCA 3EZHA 3LESA 2FFHA 3DE9A 3EJNA 2J46A 3GODA 3C8ZA 1SR2A 2WL8A 2Y39A 1LM3B 4ER9A 3EH1A 1Q0GA 2V3CC 2KGOA 2X0CA 2R7TA 3EQLF 3DKAA 2YKZA 1MMDA 4MVQA 5DQTA 1L3PA 4P6IC 1YZCA 3VYWA 4E17A 1JPNA 2BC5A 2XLEA 3W2WA 2W45A 1AEPA 4WGYA 3I5QA 5FZTA 5KYUA 5L0DA 4EBBA 5COGA 1LI5A 3DMDA 3K1HA 3U3FA 1PV3A 4CJOA 3F47A 1LS1A 1PCXA 5A6BD 2QTVA 1HE1A 4O6NA 1V4AA 4MVMA 4YN0B 2A68F 3V5YA 4CS9C 5FCLA 2V26A 2WZGA 4DOZA 2WZLA 4BPMA 1M2OA 3JRTA 2R25A 2OU6A 1M2VB 3SYNA 1JMWA 4KNVA 1JRAA 4K0DA 2A6EF 2BL2A 4M63A 3G4ZA 1LI7A 3GANA 2J9VA 2QE9A 2LSEA 2AU5A 3KYJA 3LNRA 4N06A 4X0RA 2VB6A 5DLJA 2Y3GA 1QLEC 3G50A 3U8PA 1ZU4A 1KTMA 2L6GA 3DE8A 3WAQA 3EGXA 4MVSA 1FMWA 1NSGB 2FGYA 2XLHA 4NY3A 2YL1A 2NUTA 4FAPB 3ITFA 1U89A 2HMQA 3IPMO 3M1CB 2J45A 4FWVA 1H7IA 4WABA 5E3CA 3UMKA 4DBQA 1TFOB 3T6GB 1WGWA 2ZXWC 4AK9A 4ZLCA 2XL6A 2OQMA 3B29A 4LERA 1G5ZA 1D1BA 3Q7GA 4JIOA 2FAPB 2MHRA 2XLMA 3VRCA 5BQIA 4E0IA 2MYSA 2R02A 2YWAA 3ASOC 4DVYP 2Z15A 4CS8A 2VCBA 1QQ3A 3O39A 1OW8A 4MVUA 2NSGA 2OOCA 2Q00A 1TWGA 3K7DA 1LPEA 3RVYA 2ICWG 4XPWA 3M79A 3Q6MA 4PFPA 2IXOA 1TFKB 2MWQA 3KL4A 4OINF 2R7SA 2PX0A 1A7EA 4U5BE 5KYYA 4G78A 1SF8A 2VH3A 3DI5A 5B3SC 1O5HA 1OCCC 1ORYA 1OCZC 1FFTC 2XL8A 3LLKA 4KC9A 4EIYA 2RD9A 3SXKA 3FAPB 4IAQA 5F5HA 5KYUB 1Q0KA 3DZAA 3SXZA 4CS9A 4E7ZA 3LAYA 4W8PA 5L0IA 1TR2A 3RIPA 2XXAA 4U5HA 2ZXOA 1MMAA 3NKDA 2KW3C 2LIGA 4JVSA 3GEEA 3TQOA 5EGYA 3DXJF 2RSEB 1QSPA 1Z3IX 2A0BA 2R7WA 3LS1A 3AG1C 4YL0A 1OQCA 5TJ5E 3TK0A 3W4YA 1H9GA 2HZ8A 4BG0A 4G7ZF 3S28A 2YQYA 2PNOA 3C8GD 3W8HA 4BJ1A 5A6AA 2OCCC 1GM5A 1LE2A 4AE4A 4J7TA 1TWAA 2W4BA 2HFIA 2IXNA 3MYFA 3Q6NA 5CI8A 2HV7A 1L7CA 5E2QA 2J7PD 3BEHA 1K04A 3FXHA 4YT4A 1K05A 1YYJA 3LJBA 3T9OA 3EGXB 1ZHTA 3C8GA 2HMZA 5JS5A 1MNDA 2PFDA 2NUTB 4HEAJ 5B1AC 2CW0F 1V54C 2QY9A 3DJUB 2J7PA 4YWQA 5HSWA 5F5FA 2JX0A 4GQHA 1H6GA 3NYJA 1FNTc 3M4CA 3M4BA 4MW8A 2NUPA 1NZEA 1RJ9A 2QLAA 3HNLA 3UNGC 4D4NA 5A6JA 2P7VA 1XWJA 4JE9A 1ZHYA 2WVNA 1VK5A 2IM8A 5B1BC 3ZDLA 3DD7A 4H54A 4CIHA 5CI9A 2NSFA 4J32B 4JCZA 5E3AA 4U5FE 1ZW3A 5BUOA 2EPMX 4LACB 4DBRA 1EI7A 2Q4FA 1OCOC 2I8BA 3VAYA 3LS0A 3T6BA 3WODF 3CSKA 2J8WA 4QI0A 2OKUA 1D1CA 3DAFA 5L0FA 5KYYB 2WB7A 3B0PA 1S7ZA 4QI2A 1WN0A 4B6IA 2R7UA 1NLXA 1VMAA 1BR4A 2B0JA 2ASRA 3H2VA 4YJWA 1K40A 2L9JA 4ANJA 3GM1A 5L0HA 5BQHA 2XXAB 4I3MA 4GEHA 1CGOA 1FFHA 2H7BA 2AVKA 2WVQA 5E33A 5L0JA 4C7OA 1YVIA 3A9CA 5F28E 1DOWA 2QUPA 4IGGA 1D0ZA 1ZVZA 3UR3C 1T9KA 1MMGA 2HS5A 1Y6DA 2HV6A 2QNLA 5EHHA 4CS8C 3N0TA 256BA 3X2QC 3K66A 4XEVA 3LEVA 3AG3C 3ATPA 5AC5A 5DS4A 4AE4B 4EUKB 4JJFA 1RMVA 1I4YA 2HSBA 3WG7C 3TULA 1AVOB 5B3IA 2Y3HA 3K1IA 4O79A 5A6KA 2B0HA 3NMIA 4PFOA 3LLIA 3NKEA 1FTSA 1ZZPA 4U5DE 1HMOA 5COFA 1OW6A 5DQZA 1VB5A 5A69A 3W2VA 3C8GB 1D0XA 3A11A 2KQ9A 1V55C 3JYYA 4FX5A 4WJ0A 1ORJA 3IQ6A 4XEKA 4LLCA 3SNHA 1EKYA 1WASA 4JTAB 4QDLA 2DYRC 1J8MF 5D92A 3UMHA 4KI2A 2PP4A 2Q9BA 2O9XA 2YLGA 2LP4A 4ULWA 3ZWIA 5JLIA 3RQGA 1A7DA 1M57C 2NUPB 1RJ9B 4MTGA 3ZQVA 4O7GA 4LDQA 2GDCA 3ZG1A 4CX9A 2XLDA 5A6BA 3HKKA 2AWCA 3ASNC 1ZW2A 1N1CA 2R7QA 1NU9C 2YLIA 2D4UA 2PBEA 4MQ9F 3S90A 2Q9AA 1H9TA 1VYKA 3GWLA 4HFFB 4UDVA 4I1MA 1G8XA 3FHDA 3PMRA 2OEVA 2EINC 2LQGA 4GYTA 4BJ6A 4YK5A 1BZ4A 2XS8A 2LD6A 2H7VC 4HE8D 4YL1A 2J0XA 3AOUA 3QMKA 3QZCA 1VOMA 2EPNA 4H4KC 3UGPA 1IZMA 2ZXRA 2KC3A 2HKVA 3JRMO 4CS7A 3X1OA 5JRAA 1FR0A 1TQGA 4K7BA 4O6MA 3S84A 4JEBA 4F4BA 1OCRC 2DI3A 4G7HF 3O10A 3O6XA 3EPVA 5JSLA 2EIMC 2LCHA 4C7OB 5DVWA 2XS1A 2J9BA 5AGFA 1PD0A 1Q0MA 1J8YF 2R05A 4Z9JA 1VTMP 3M15A 1GS9A 1BR2A 2W4MA 3JYHA 4J30B 4LDKA 2JD3A 1NFNA 4MTFA 4U9EA 3L8IA 4XEFA 1E2XA 1I4ZA 2Y3BA 4XTKA 2XRHA 4YT2A 3HTKC 2GFHA 3L8JA 5JUAA 1BBHA 1HMDA 1QPUA 1ZHWA 4J7YA 2KK1A 2CNWD 1OXBA 2H8AA 1XZPA 3E70C 4WGZA 3GEHA 3T4RA 3OWTA 1Z5ZA 3VM6A 1D1AA 1UG7A 1VLTA 4IWBA 2KNHA 4MVOA 1YYXA 1FMVA 3PCVA 4PK4A 2AP3A 5JP7A 3FMSA 1SMYF 3R7CA 3K6BA 3E9VA 2TMVP 3DM9B 4MVZA 2GA0A 3RF3A 2CNWA 1E85A 4U9DA 2EIJC 2P1AA 1RKCA 4E7SA 1A41A 3GM2A 1C02A 3PHF2 1XZQA 1G4WR 1BDJB 1VLSA 3C7JA 3EH2A 4MTOA 3RFYA 3DJNB 4DRIB 2VCAA 4CDYA 2F22A 2Q9CA 4NTBA 4PJMA 1WOLA 3GORA 4XWJA 1T6QA 2M64A 2OG2A 1EA8A 3MFNA 2HSQA 4NTFA 3MYIA 2NG1A 1SZIA 1MMNA 3JZ0A 3K1IC 5COMA 3RQEA 3U3BA 3SP1A 2LFFA 3C63A 1Z7Qc 1I5NA 4EBJA 1IW7F 5L0CA 1KU2A 2KJGA 3KH2A 1U0BB 2R03A 4CDAA 1YJGA 2X51A 3SXYA 4CBEA 4MS2A 3KYIA 3OA1A 2PF4E 1BR1A 3H65A 4PACA 5JT4A 4KBLA 3NYMA 4NQFA 3FDQA 3KMIA 3B71A 3ABMC 3CAXA 3KKBA 3TOLA 2NPUA 4DJ9A 4CSAC 2VC9A 2C04A 4RBNA 3B9QA 4LDRA 4A2NB 5GPGB 3EG9A 2R9RB 3CQZA 1ORSC 3VF0A 2AWYA 1OW7A 1S05A 4L6RA 4PJLA 1YDIA 4ZLDA 2ZXPA 4JZAA 5KYWA 3GWNA 3IQ5A 3JSEO 3NRHA 1FAPB 4HFKB 4DRJB 2GAQA 2XLWA 1KNYA 3NG1A 2G3VA 1RKEA 3AG2C 2IOQA 2XM4A 2DYSC 3HNJA 1JOGA 1YAUO 4JW1A 4CIPA 3DM5A 4JEAA 1JPJA 1NU7D 4BJ6C 3IQTA 2CGEA 1JR8A 4BEJA 3AQCA 2WVOA 2E87A 4JTDB 4EBKA 5KYNA 2OJQA 2YEVA 3MBGA 4JJGA 3FVYA 3EGDA 2J9WA 2XSEA 1APCA 3GEIA 3RH3A 4P9TA 1U6HA 4N4WA 3LNMB 4R32A 2UUHA 4U5EE 3ZSUA 1UFBA 4K1OA 4Z9IA 2EIKC 4IB4A 3AGUA 4IJJA 3I4UA 1ZU5A 1G4US 1GGQA 1NBBA 3HJCA 1B68A 2WZFA 4PJNA 3U8VA 4YT8A 4OIQF 4KNWA 2CYDA 2YLDA 3BRJA 4BJTA 4DRHB 4DVZA 2A69F 1ST6A 3ABLC 3IQCA 3HNIA 4Q4ZF 3ZIBA 3UGOA 2I15A 3ZC4A 1E83A 2R7RA 2YHSA 3RKOF 3AJMA 3CZ6A 4CSAA 2YVKA 2G62A 3T6JA 4N6CA 2HJ3A 3ABKC 3EHNA 1YZAA 1A7VA 1LVKA 1R5ID 3EFOA 4YL3A 4XLNF 4C3EA 3K33A 3PDMP 3S9OA 5DS6A 3ZVRA 4BJ5C 3EHMA 2C03A 2LK4A 2P61A 3TOMA 4OIPF 4JKVA 1M56C 2Y69C 3B0UX 5BQGA 2CCYA 5T3WA 1E86A 4G0HA 1Y4CA 1W2WA 3U5SA 3MLGA 2IXMA 3EG9B 5EK0A 3ZQYA 3HLZA 1F1MA 4G7OF 3MX3A 5KYWB 3V7OA 1T6UA 4OD4A 1LKXA 4C3BA 4C3DA 2Q3TA 4OD5A 5KYXA 1T5OA 3C18A 3NMJA 3RW0A 4MVRA 4NCQA 2L6HA 4EKWA 1RKEB 4ONSA 5T1DB 1HE9A 2YRFA 2H7OA 3EZIA 4AL0A 2P6VA 1D0YA 1JAFA 1SYQA 1DOVA 2YZSA 4JC7A 3N2ZB 4D4XA 4IARA 4JCHA 1ZYRF 1A0BA 3TD7A 2ZPAA 2A1DD 4E18A 2KSFA 1WATA 2EPKX 1OR2A 2M4EA 1QKRA 1TWHA 3EGDB 1LE4A 3SEOA 3I5PA 2IXPA 1M6TA 1R4TA 1V74B 2KYHA 2Y3DA 4JRZA 3WHNA 3NDBB 5D91A 1CGME 2EPOA 1QZXA 1YA7O 3FAJA 3IHUA 3DAGA 1HY5A 1TKNA 4YT5A 4PR9A 4OIOF 5L3QA 3CEXA 5DS5A 2HUJA 4W8KA 4U5GA 3ECSA 4PJJA 1Z63A 2OEXA 3SZRA 1MQVA 1ZHZA 3O55A 4DXWA 1HW1A 1ZHXA 3RYLA 3SXMA 3JSZA 2ETSA 1OXKA 3L1MA 3FOPA 4ULVA 4BJ5A 3ZTMA 3L34A 2BE5F 1T6IA 4OIRF 1O87A 4I1OB 4RD9A 2L81A 3QTHA 3U2MA 4N6HA 2A0UA 3EFOB 1YA9A 1RCPA 4E0HA 3DWWA 2VCCA 5L3VA 3JCUQ 1WTYA 1Z6AA 3ZTZA 1AUEA 3AG4C 3L0IA 4BEMJ 2P0NA 3S27A 2HJMA 1OR3A 2G3KA 2J0WA 3TJ6A 2OJED 2XM0A 3RQFA 3U9MA 3JT1A 3JTLO 2JPUA 4EHPA 4MNDA 4FESA 1C03A 5KYXB 1LIHA 3F46A 1HW2A 2IBFA 4O6YA 3LUTB 4P9FA 4U5CE 2YL0A 3U2LA 1VYIA 3NYLA 3OEOA 3S0XA 4JTCB 1O3UA 1C17M 2UUIA 4Z9HA 2L7AA 2ZD9A 4AL1A 2PX3A 2YL3A 3U0CA 4RDAA 3U9JA 5JVEA 4XLPF 1CGNA 4NTAA 4AX2A 1Z23A 4XPYA 4XQ1A 2DB4A 2VASA 3H2UA 4I44A 3GM3A 4Q7CA 5IY5C 2W9YA 2LFDA 4EWCA 1Q0DA 3NMKA 3QVYA 2IYLD 1RXQA 1T01A 2D5RB 2L6FA 3C62A 3S29A 4A4AA 1CPQA 2XL4A 3QVZA 3POVA 1OKKD 2EPLX 1M2VA 2R7VA 1YLMA 2Q7RA 3W8IA 3FOOA 3KPHA 4CDVA 3J06A 1LS4A 2J9UA 1EQ1A 3R2PA 3TJ5A 3Q7LA 1CPRA 4CJGA 3UMIA 1Q0FA 2A6HF 3QW0A 1MNEA 3B0VC 2DGJA 4IAOA 1OKKA 1YARO 3LEOA 1GQAA 1WWPA 5T3TA 5AC4A 5K0IA 3IEEA 3QW1A 2XLVA 4NC3A 3AGTA 4Q5SF 4XPXA 3V5ZA 3US6A 3RVZA 4IRUA 1QVXA 2GWWA 3G4XA 4JURI 1PD1A 2EILC 3HNKA 4MW3A 3V5XA 2YL7A 3AQBA 2CDQA 1E84A 2R7XA 2XLOA
chains in the Genus database with same CATH topology
4YK5A 4NTFA 4J7YA 4YL1A 5HV9A 2H8AA 3B29A 5BQHA 2Q7RA 5BQIA 4AL0A 4BPMA 3PCVA 4YL0A 4JC7A 4YL3A 2PNOA 2UUIA 4AL1A 3LEOA 3HKKA 5K0IA 4J7TA 4JCZA 4NTAA 3DWWA 5BQGA 2UUHA 4JRZA 4NTBA 4WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YK5 A;  4NTF A;  4J7Y A;  4YL1 A;  5HV9 A;  2H8A A;  3B29 A;  5BQH A;  2Q7R A;  5BQI A;  4AL0 A;  4BPM A;  3PCV A;  4YL0 A;  4JC7 A;  4YL3 A;  2PNO A;  2UUI A;  4AL1 A;  3LEO A;  3HKK A;  5K0I A;  4J7T A;  4JCZ A;  4NTA A;  3DWW A;  5BQG A;  2UUH A;  4JRZ A;  4NTB A;  4WAB A; 
#chains in the Genus database with same CATH topology
 2R7O A;  1NFO A;  5CIV A;  3N24 A;  1NG1 A;  5HV9 A;  4LLE A;  5L0G A;  1TWC A;  3EZH A;  3LES A;  2FFH A;  3DE9 A;  3EJN A;  2J46 A;  3GOD A;  3C8Z A;  1SR2 A;  2WL8 A;  2Y39 A;  1LM3 B;  4ER9 A;  3EH1 A;  1Q0G A;  2V3C C;  2KGO A;  2X0C A;  2R7T A;  3EQL F;  3DKA A;  2YKZ A;  1MMD A;  4MVQ A;  5DQT A;  1L3P A;  4P6I C;  1YZC A;  3VYW A;  4E17 A;  1JPN A;  2BC5 A;  2XLE A;  3W2W A;  2W45 A;  1AEP A;  4WGY A;  3I5Q A;  5FZT A;  5KYU A;  5L0D A;  4EBB A;  5COG A;  1LI5 A;  3DMD A;  3K1H A;  3U3F A;  1PV3 A;  4CJO A;  3F47 A;  1LS1 A;  1PCX A;  5A6B D;  2QTV A;  1HE1 A;  4O6N A;  1V4A A;  4MVM A;  4YN0 B;  2A68 F;  3V5Y A;  4CS9 C;  5FCL A;  2V26 A;  2WZG A;  4DOZ A;  2WZL A;  4BPM A;  1M2O A;  3JRT A;  2R25 A;  2OU6 A;  1M2V B;  3SYN A;  1JMW A;  4KNV A;  1JRA A;  4K0D A;  2A6E F;  2BL2 A;  4M63 A;  3G4Z A;  1LI7 A;  3GAN A;  2J9V A;  2QE9 A;  2LSE A;  2AU5 A;  3KYJ A;  3LNR A;  4N06 A;  4X0R A;  2VB6 A;  5DLJ A;  2Y3G A;  1QLE C;  3G50 A;  3U8P A;  1ZU4 A;  1KTM A;  2L6G A;  3DE8 A;  3WAQ A;  3EGX A;  4MVS A;  1FMW A;  1NSG B;  2FGY A;  2XLH A;  4NY3 A;  2YL1 A;  2NUT A;  4FAP B;  3ITF A;  1U89 A;  2HMQ A;  3IPM O;  3M1C B;  2J45 A;  4FWV A;  1H7I A;  4WAB A;  5E3C A;  3UMK A;  4DBQ A;  1TFO B;  3T6G B;  1WGW A;  2ZXW C;  4AK9 A;  4ZLC A;  2XL6 A;  2OQM A;  3B29 A;  4LER A;  1G5Z A;  1D1B A;  3Q7G A;  4JIO A;  2FAP B;  2MHR A;  2XLM A;  3VRC A;  5BQI A;  4E0I A;  2MYS A;  2R02 A;  2YWA A;  3ASO C;  4DVY P;  2Z15 A;  4CS8 A;  2VCB A;  1QQ3 A;  3O39 A;  1OW8 A;  4MVU A;  2NSG A;  2OOC A;  2Q00 A;  1TWG A;  3K7D A;  1LPE A;  3RVY A;  2ICW G;  4XPW A;  3M79 A;  3Q6M A;  4PFP A;  2IXO A;  1TFK B;  2MWQ A;  3KL4 A;  4OIN F;  2R7S A;  2PX0 A;  1A7E A;  4U5B E;  5KYY A;  4G78 A;  1SF8 A;  2VH3 A;  3DI5 A;  5B3S C;  1O5H A;  1OCC C;  1ORY A;  1OCZ C;  1FFT C;  2XL8 A;  3LLK A;  4KC9 A;  4EIY A;  2RD9 A;  3SXK A;  3FAP B;  4IAQ A;  5F5H A;  5KYU B;  1Q0K A;  3DZA A;  3SXZ A;  4CS9 A;  4E7Z A;  3LAY A;  4W8P A;  5L0I A;  1TR2 A;  3RIP A;  2XXA A;  4U5H A;  2ZXO A;  1MMA A;  3NKD A;  2KW3 C;  2LIG A;  4JVS A;  3GEE A;  3TQO A;  5EGY A;  3DXJ F;  2RSE B;  1QSP A;  1Z3I X;  2A0B A;  2R7W A;  3LS1 A;  3AG1 C;  4YL0 A;  1OQC A;  5TJ5 E;  3TK0 A;  3W4Y A;  1H9G A;  2HZ8 A;  4BG0 A;  4G7Z F;  3S28 A;  2YQY A;  2PNO A;  3C8G D;  3W8H A;  4BJ1 A;  5A6A A;  2OCC C;  1GM5 A;  1LE2 A;  4AE4 A;  4J7T A;  1TWA A;  2W4B A;  2HFI A;  2IXN A;  3MYF A;  3Q6N A;  5CI8 A;  2HV7 A;  1L7C A;  5E2Q A;  2J7P D;  3BEH A;  1K04 A;  3FXH A;  4YT4 A;  1K05 A;  1YYJ A;  3LJB A;  3T9O A;  3EGX B;  1ZHT A;  3C8G A;  2HMZ A;  5JS5 A;  1MND A;  2PFD A;  2NUT B;  4HEA J;  5B1A C;  2CW0 F;  1V54 C;  2QY9 A;  3DJU B;  2J7P A;  4YWQ A;  5HSW A;  5F5F A;  2JX0 A;  4GQH A;  1H6G A;  3NYJ A;  1FNT c;  3M4C A;  3M4B A;  4MW8 A;  2NUP A;  1NZE A;  1RJ9 A;  2QLA A;  3HNL A;  3UNG C;  4D4N A;  5A6J A;  2P7V A;  1XWJ A;  4JE9 A;  1ZHY A;  2WVN A;  1VK5 A;  2IM8 A;  5B1B C;  3ZDL A;  3DD7 A;  4H54 A;  4CIH A;  5CI9 A;  2NSF A;  4J32 B;  4JCZ A;  5E3A A;  4U5F E;  1ZW3 A;  5BUO A;  2EPM X;  4LAC B;  4DBR A;  1EI7 A;  2Q4F A;  1OCO C;  2I8B A;  3VAY A;  3LS0 A;  3T6B A;  3WOD F;  3CSK A;  2J8W A;  4QI0 A;  2OKU A;  1D1C A;  3DAF A;  5L0F A;  5KYY B;  2WB7 A;  3B0P A;  1S7Z A;  4QI2 A;  1WN0 A;  4B6I A;  2R7U A;  1NLX A;  1VMA A;  1BR4 A;  2B0J A;  2ASR A;  3H2V A;  4YJW A;  1K40 A;  2L9J A;  4ANJ A;  3GM1 A;  5L0H A;  5BQH A;  2XXA B;  4I3M A;  4GEH A;  1CGO A;  1FFH A;  2H7B A;  2AVK A;  2WVQ A;  5E33 A;  5L0J A;  4C7O A;  1YVI A;  3A9C A;  5F28 E;  1DOW A;  2QUP A;  4IGG A;  1D0Z A;  1ZVZ A;  3UR3 C;  1T9K A;  1MMG A;  2HS5 A;  1Y6D A;  2HV6 A;  2QNL A;  5EHH A;  4CS8 C;  3N0T A;  256B A;  3X2Q C;  3K66 A;  4XEV A;  3LEV A;  3AG3 C;  3ATP A;  5AC5 A;  5DS4 A;  4AE4 B;  4EUK B;  4JJF A;  1RMV A;  1I4Y A;  2HSB A;  3WG7 C;  3TUL A;  1AVO B;  5B3I A;  2Y3H A;  3K1I A;  4O79 A;  5A6K A;  2B0H A;  3NMI A;  4PFO A;  3LLI A;  3NKE A;  1FTS A;  1ZZP A;  4U5D E;  1HMO A;  5COF A;  1OW6 A;  5DQZ A;  1VB5 A;  5A69 A;  3W2V A;  3C8G B;  1D0X A;  3A11 A;  2KQ9 A;  1V55 C;  3JYY A;  4FX5 A;  4WJ0 A;  1ORJ A;  3IQ6 A;  4XEK A;  4LLC A;  3SNH A;  1EKY A;  1WAS A;  4JTA B;  4QDL A;  2DYR C;  1J8M F;  5D92 A;  3UMH A;  4KI2 A;  2PP4 A;  2Q9B A;  2O9X A;  2YLG A;  2LP4 A;  4ULW A;  3ZWI A;  5JLI A;  3RQG A;  1A7D A;  1M57 C;  2NUP B;  1RJ9 B;  4MTG A;  3ZQV A;  4O7G A;  4LDQ A;  2GDC A;  3ZG1 A;  4CX9 A;  2XLD A;  5A6B A;  3HKK A;  2AWC A;  3ASN C;  1ZW2 A;  1N1C A;  2R7Q A;  1NU9 C;  2YLI A;  2D4U A;  2PBE A;  4MQ9 F;  3S90 A;  2Q9A A;  1H9T A;  1VYK A;  3GWL A;  4HFF B;  4UDV A;  4I1M A;  1G8X A;  3FHD A;  3PMR A;  2OEV A;  2EIN C;  2LQG A;  4GYT A;  4BJ6 A;  4YK5 A;  1BZ4 A;  2XS8 A;  2LD6 A;  2H7V C;  4HE8 D;  4YL1 A;  2J0X A;  3AOU A;  3QMK A;  3QZC A;  1VOM A;  2EPN A;  4H4K C;  3UGP A;  1IZM A;  2ZXR A;  2KC3 A;  2HKV A;  3JRM O;  4CS7 A;  3X1O A;  5JRA A;  1FR0 A;  1TQG A;  4K7B A;  4O6M A;  3S84 A;  4JEB A;  4F4B A;  1OCR C;  2DI3 A;  4G7H F;  3O10 A;  3O6X A;  3EPV A;  5JSL A;  2EIM C;  2LCH A;  4C7O B;  5DVW A;  2XS1 A;  2J9B A;  5AGF A;  1PD0 A;  1Q0M A;  1J8Y F;  2R05 A;  4Z9J A;  1VTM P;  3M15 A;  1GS9 A;  1BR2 A;  2W4M A;  3JYH A;  4J30 B;  4LDK A;  2JD3 A;  1NFN A;  4MTF A;  4U9E A;  3L8I A;  4XEF A;  1E2X A;  1I4Z A;  2Y3B A;  4XTK A;  2XRH A;  4YT2 A;  3HTK C;  2GFH A;  3L8J A;  5JUA A;  1BBH A;  1HMD A;  1QPU A;  1ZHW A;  4J7Y A;  2KK1 A;  2CNW D;  1OXB A;  2H8A A;  1XZP A;  3E70 C;  4WGZ A;  3GEH A;  3T4R A;  3OWT A;  1Z5Z A;  3VM6 A;  1D1A A;  1UG7 A;  1VLT A;  4IWB A;  2KNH A;  4MVO A;  1YYX A;  1FMV A;  3PCV A;  4PK4 A;  2AP3 A;  5JP7 A;  3FMS A;  1SMY F;  3R7C A;  3K6B A;  3E9V A;  2TMV P;  3DM9 B;  4MVZ A;  2GA0 A;  3RF3 A;  2CNW A;  1E85 A;  4U9D A;  2EIJ C;  2P1A A;  1RKC A;  4E7S A;  1A41 A;  3GM2 A;  1C02 A;  3PHF 2;  1XZQ A;  1G4W R;  1BDJ B;  1VLS A;  3C7J A;  3EH2 A;  4MTO A;  3RFY A;  3DJN B;  4DRI B;  2VCA A;  4CDY A;  2F22 A;  2Q9C A;  4NTB A;  4PJM A;  1WOL A;  3GOR A;  4XWJ A;  1T6Q A;  2M64 A;  2OG2 A;  1EA8 A;  3MFN A;  2HSQ A;  4NTF A;  3MYI A;  2NG1 A;  1SZI A;  1MMN A;  3JZ0 A;  3K1I C;  5COM A;  3RQE A;  3U3B A;  3SP1 A;  2LFF A;  3C63 A;  1Z7Q c;  1I5N A;  4EBJ A;  1IW7 F;  5L0C A;  1KU2 A;  2KJG A;  3KH2 A;  1U0B B;  2R03 A;  4CDA A;  1YJG A;  2X51 A;  3SXY A;  4CBE A;  4MS2 A;  3KYI A;  3OA1 A;  2PF4 E;  1BR1 A;  3H65 A;  4PAC A;  5JT4 A;  4KBL A;  3NYM A;  4NQF A;  3FDQ A;  3KMI A;  3B71 A;  3ABM C;  3CAX A;  3KKB A;  3TOL A;  2NPU A;  4DJ9 A;  4CSA C;  2VC9 A;  2C04 A;  4RBN A;  3B9Q A;  4LDR A;  4A2N B;  5GPG B;  3EG9 A;  2R9R B;  3CQZ A;  1ORS C;  3VF0 A;  2AWY A;  1OW7 A;  1S05 A;  4L6R A;  4PJL A;  1YDI A;  4ZLD A;  2ZXP A;  4JZA A;  5KYW A;  3GWN A;  3IQ5 A;  3JSE O;  3NRH A;  1FAP B;  4HFK B;  4DRJ B;  2GAQ A;  2XLW A;  1KNY A;  3NG1 A;  2G3V A;  1RKE A;  3AG2 C;  2IOQ A;  2XM4 A;  2DYS C;  3HNJ A;  1JOG A;  1YAU O;  4JW1 A;  4CIP A;  3DM5 A;  4JEA A;  1JPJ A;  1NU7 D;  4BJ6 C;  3IQT A;  2CGE A;  1JR8 A;  4BEJ A;  3AQC A;  2WVO A;  2E87 A;  4JTD B;  4EBK A;  5KYN A;  2OJQ A;  2YEV A;  3MBG A;  4JJG A;  3FVY A;  3EGD A;  2J9W A;  2XSE A;  1APC A;  3GEI A;  3RH3 A;  4P9T A;  1U6H A;  4N4W A;  3LNM B;  4R32 A;  2UUH A;  4U5E E;  3ZSU A;  1UFB A;  4K1O A;  4Z9I A;  2EIK C;  4IB4 A;  3AGU A;  4IJJ A;  3I4U A;  1ZU5 A;  1G4U S;  1GGQ A;  1NBB A;  3HJC A;  1B68 A;  2WZF A;  4PJN A;  3U8V A;  4YT8 A;  4OIQ F;  4KNW A;  2CYD A;  2YLD A;  3BRJ A;  4BJT A;  4DRH B;  4DVZ A;  2A69 F;  1ST6 A;  3ABL C;  3IQC A;  3HNI A;  4Q4Z F;  3ZIB A;  3UGO A;  2I15 A;  3ZC4 A;  1E83 A;  2R7R A;  2YHS A;  3RKO F;  3AJM A;  3CZ6 A;  4CSA A;  2YVK A;  2G62 A;  3T6J A;  4N6C A;  2HJ3 A;  3ABK C;  3EHN A;  1YZA A;  1A7V A;  1LVK A;  1R5I D;  3EFO A;  4YL3 A;  4XLN F;  4C3E A;  3K33 A;  3PDM P;  3S9O A;  5DS6 A;  3ZVR A;  4BJ5 C;  3EHM A;  2C03 A;  2LK4 A;  2P61 A;  3TOM A;  4OIP F;  4JKV A;  1M56 C;  2Y69 C;  3B0U X;  5BQG A;  2CCY A;  5T3W A;  1E86 A;  4G0H A;  1Y4C A;  1W2W A;  3U5S A;  3MLG A;  2IXM A;  3EG9 B;  5EK0 A;  3ZQY A;  3HLZ A;  1F1M A;  4G7O F;  3MX3 A;  5KYW B;  3V7O A;  1T6U A;  4OD4 A;  1LKX A;  4C3B A;  4C3D A;  2Q3T A;  4OD5 A;  5KYX A;  1T5O A;  3C18 A;  3NMJ A;  3RW0 A;  4MVR A;  4NCQ A;  2L6H A;  4EKW A;  1RKE B;  4ONS A;  5T1D B;  1HE9 A;  2YRF A;  2H7O A;  3EZI A;  4AL0 A;  2P6V A;  1D0Y A;  1JAF A;  1SYQ A;  1DOV A;  2YZS A;  4JC7 A;  3N2Z B;  4D4X A;  4IAR A;  4JCH A;  1ZYR F;  1A0B A;  3TD7 A;  2ZPA A;  2A1D D;  4E18 A;  2KSF A;  1WAT A;  2EPK X;  1OR2 A;  2M4E A;  1QKR A;  1TWH A;  3EGD B;  1LE4 A;  3SEO A;  3I5P A;  2IXP A;  1M6T A;  1R4T A;  1V74 B;  2KYH A;  2Y3D A;  4JRZ A;  3WHN A;  3NDB B;  5D91 A;  1CGM E;  2EPO A;  1QZX A;  1YA7 O;  3FAJ A;  3IHU A;  3DAG A;  1HY5 A;  1TKN A;  4YT5 A;  4PR9 A;  4OIO F;  5L3Q A;  3CEX A;  5DS5 A;  2HUJ A;  4W8K A;  4U5G A;  3ECS A;  4PJJ A;  1Z63 A;  2OEX A;  3SZR A;  1MQV A;  1ZHZ A;  3O55 A;  4DXW A;  1HW1 A;  1ZHX A;  3RYL A;  3SXM A;  3JSZ A;  2ETS A;  1OXK A;  3L1M A;  3FOP A;  4ULV A;  4BJ5 A;  3ZTM A;  3L34 A;  2BE5 F;  1T6I A;  4OIR F;  1O87 A;  4I1O B;  4RD9 A;  2L81 A;  3QTH A;  3U2M A;  4N6H A;  2A0U A;  3EFO B;  1YA9 A;  1RCP A;  4E0H A;  3DWW A;  2VCC A;  5L3V A;  3JCU Q;  1WTY A;  1Z6A A;  3ZTZ A;  1AUE A;  3AG4 C;  3L0I A;  4BEM J;  2P0N A;  3S27 A;  2HJM A;  1OR3 A;  2G3K A;  2J0W A;  3TJ6 A;  2OJE D;  2XM0 A;  3RQF A;  3U9M A;  3JT1 A;  3JTL O;  2JPU A;  4EHP A;  4MND A;  4FES A;  1C03 A;  5KYX B;  1LIH A;  3F46 A;  1HW2 A;  2IBF A;  4O6Y A;  3LUT B;  4P9F A;  4U5C E;  2YL0 A;  3U2L A;  1VYI A;  3NYL A;  3OEO A;  3S0X A;  4JTC B;  1O3U A;  1C17 M;  2UUI A;  4Z9H A;  2L7A A;  2ZD9 A;  4AL1 A;  2PX3 A;  2YL3 A;  3U0C A;  4RDA A;  3U9J A;  5JVE A;  4XLP F;  1CGN A;  4NTA A;  4AX2 A;  1Z23 A;  4XPY A;  4XQ1 A;  2DB4 A;  2VAS A;  3H2U A;  4I44 A;  3GM3 A;  4Q7C A;  5IY5 C;  2W9Y A;  2LFD A;  4EWC A;  1Q0D A;  3NMK A;  3QVY A;  2IYL D;  1RXQ A;  1T01 A;  2D5R B;  2L6F A;  3C62 A;  3S29 A;  4A4A A;  1CPQ A;  2XL4 A;  3QVZ A;  3POV A;  1OKK D;  2EPL X;  1M2V A;  2R7V A;  1YLM A;  2Q7R A;  3W8I A;  3FOO A;  3KPH A;  4CDV A;  3J06 A;  1LS4 A;  2J9U A;  1EQ1 A;  3R2P A;  3TJ5 A;  3Q7L A;  1CPR A;  4CJG A;  3UMI A;  1Q0F A;  2A6H F;  3QW0 A;  1MNE A;  3B0V C;  2DGJ A;  4IAO A;  1OKK A;  1YAR O;  3LEO A;  1GQA A;  1WWP A;  5T3T A;  5AC4 A;  5K0I A;  3IEE A;  3QW1 A;  2XLV A;  4NC3 A;  3AGT A;  4Q5S F;  4XPX A;  3V5Z A;  3US6 A;  3RVZ A;  4IRU A;  1QVX A;  2GWW A;  3G4X A;  4JUR I;  1PD1 A;  2EIL C;  3HNK A;  4MW3 A;  3V5X A;  2YL7 A;  3AQB A;  2CDQ A;  1E84 A;  2R7X A;  2XLO A; 
#chains in the Genus database with same CATH homology
 4YK5 A;  4NTF A;  4J7Y A;  4YL1 A;  5HV9 A;  2H8A A;  3B29 A;  5BQH A;  2Q7R A;  5BQI A;  4AL0 A;  4BPM A;  3PCV A;  4YL0 A;  4JC7 A;  4YL3 A;  2PNO A;  2UUI A;  4AL1 A;  3LEO A;  3HKK A;  5K0I A;  4J7T A;  4JCZ A;  4NTA A;  3DWW A;  5BQG A;  2UUH A;  4JRZ A;  4NTB A;  4WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...