5BQIA

Discovery of a potent and selective mpges-1 inhibitor for the treatment of pain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
total genus 66
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqiA00
4YL0A 4J7TA 3B29A 3DWWA 4YL3A 3HKKA 4NTFA 5K0IA 2UUHA 2PNOA 4AL1A 4JC7A 2UUIA 4YK5A 4JCZA 4WABA 4NTBA 4NTAA 4AL0A 5BQGA 4BPMA 2Q7RA 5HV9A 5BQHA 3LEOA 4YL1A 4J7YA 4JRZA 3PCVA 2H8AA 5BQIA
chains in the Genus database with same CATH superfamily
2M64A 3IQCA 3LLIA 4EBBA 2PFDA 2YLGA 3G4XA 4EWCA 1H6GA 4JURI 4PFOA 4E0IA 3JRTA 3L34A 3JTLO 1BBHA 1QSPA 3JCUQ 1Y4CA 1ORJA 4XEFA 3NDBB 5KYWB 3I5PA 3KYIA 4BJ6C 4KNVA 3ZIBA 4BJ5C 2LFFA 2W4BA 3V5ZA 5B3IA 4CBEA 4P9TA 4XLPF 1LE2A 3G4ZA 3DKAA 1Q0MA 4MNDA 3BRJA 4JEBA 5DS6A 4MTGA 2XLWA 3GEIA 4JVSA 3W8IA 4RD9A 1SF8A 4IAQA 1T6IA 1BR1A 1RKEA 2EPKX 4CS8A 2MHRA 2IXPA 3M79A 4MVQA 3DXJF 1RJ9A 3N24A 2A68F 3FVYA 4G7ZF 1N1CA 1G5ZA 1TWAA 3EGDB 1Y6DA 4HFFB 3SXZA 3ZDLA 2HMZA 3SXYA 3ZQYA 4EHPA 5K0IA 1TFKB 2IBFA 3IQ5A 3RVZA 3DMDA 4KNWA 4E7SA 2XS1A 3GM2A 1A7DA 1T6UA 1V4AA 4CS9A 2H7BA 4I3MA 4NCQA 4YT8A 4DBRA 5L0GA 4CSAC 4D4NA 4LDKA 2ASRA 3ZQVA 4C3BA 1E84A 2Q7RA 4NY3A 3POVA 4KI2A 5B1BC 2I15A 2WZLA 1OCRC 3E9VA 2J9BA 5KYYA 1A0BA 2IYLD 3DAGA 4U5BE 3UMHA 2DGJA 1WTYA 2CNWA 2FFHA 2Q9AA 2W45A 3B9QA 1HMDA 1D0YA 2LFDA 2CCYA 4H4KC 3SXKA 4DJ9A 4CSAA 2XXAA 3Q7LA 4PJJA 4O6YA 4YL3A 5DVWA 2DB4A 1AVOB 3C8ZA 4OD4A 5CI8A 2VCCA 5COMA 1OW8A 4IB4A 4XEVA 4EUKB 2YL1A 3U3FA 4WABA 2B0HA 3V5YA 2WB7A 3ABLC 3EFOA 1FNTc 2A69F 3GANA 3EGXB 4JZAA 1TR2A 1OCCC 3NKEA 5BQGA 2KW3C 4ANJA 1BR2A 5TJ5E 1JAFA 4XQ1A 3H65A 2J8WA 1MNDA 2QTVA 1UG7A 2GDCA 1HW2A 2VH3A 2QLAA 4U5DE 5BUOA 4N06A 1JMWA 4CDYA 1M2VA 1M2OA 4YL1A 4ONSA 2X0CA 4MVRA 4JRZA 4BJ5A 4YT4A 1C03A 2GWWA 1Q0GA 3DI5A 4YWQA 5KYNA 2YQYA 3L0IA 4G78A 4B6IA 3EH2A 1FTSA 2E87A 3SZRA 4FAPB 3DWWA 4YJWA 4NC3A 1MQVA 3UGOA 1JOGA 1ORSC 4XPYA 4E18A 4NTFA 1U0BB 2CW0F 2HSQA 2QNLA 3LNMB 3C8GD 3M4CA 4QI2A 3PMRA 5T3TA 2G62A 1ZZPA 2XLOA 1XZQA 3H2UA 3LUTB 3DZAA 1OCOC 1SMYF 3EQLF 2KGOA 2Y39A 4XEKA 3ATPA 4O6NA 2P7VA 3AQCA 2R7SA 2Z15A 4WJ0A 3DD7A 1ZYRF 3SP1A 3T4RA 2IM8A 1G4WR 2KNHA 4IGGA 3U3BA 1OW7A 1SYQA 4HE8D 3AGTA 4Q7CA 3FAJA 5F5HA 2MWQA 4I1OB 3JYYA 4LERA 5BQIA 1OW6A 1A7VA 1OQCA 3N2ZB 3T9OA 1CPQA 2P61A 4JCHA 4CJGA 1MMAA 2QY9A 2EPMX 1OKKA 3EFOB 4LLEA 2I8BA 2J45A 4MQ9F 3NYMA 1O87A 1RXQA 2A1DD 2A6EF 4RDAA 4ZLCA 3U0CA 4JJGA 1LKXA 2A0UA 2XSEA 2ZXRA 3MLGA 4OIOF 1J8MF 4CS7A 4BPMA 3T6JA 5COGA 2WVNA 2XL8A 4K0DA 3U2MA 5A69A 3IQTA 4OIRF 2XM4A 3UNGC 4EBJA 1NU7D 4C7OB 2J0WA 1WGWA 4LLCA 1VLSA 4HEAJ 3RKOF 5HSWA 2CDQA 4I44A 4OD5A 2XLDA 3GWNA 5COFA 4OINF 2HSBA 3S29A 2WZFA 2WVQA 4LDRA 2Y3BA 2L9JA 3DJUB 3S27A 2J7PA 4K1OA 1YA7O 1ZW3A 1H9TA 5EHHA 2WZGA 2UUIA 3ITFA 2HUJA 3OWTA 4YK5A 3RQEA 3W2WA 4NTBA 4DOZA 3EJNA 3GEHA 3TK0A 2VCBA 4ULWA 3Q6NA 1L3PA 4PACA 4U5HA 3R2PA 3K1HA 4AL0A 1JRAA 5B1AC 1EQ1A 2NSFA 2XRHA 4EBKA 1PCXA 2J9UA 2XLMA 1WWPA 1GGQA 3C18A 4D4XA 4MW3A 3KH2A 5BQHA 5JS5A 4F4BA 2KK1A 4L6RA 3RVYA 3UMKA 2ZXOA 2DYSC 3KKBA 4E0HA 3RQGA 1YVIA 2R7OA 4W8KA 3W4YA 3KPHA 1TWGA 3RQFA 5KYWA 4ZLDA 3QVZA 4J32B 3GM1A 2RD9A 2X51A 1MMNA 3LAYA 3O10A 1DOWA 3QTHA 4K7BA 2J7PD 2J9WA 3WG7C 4BEJA 5B3SC 2EPLX 2R7TA 1ZVZA 2A6HF 2Y3DA 2WL8A 3DAFA 2YL7A 4ULVA 2LD6A 1ZW2A 3ZTMA 1ZHXA 2PX0A 3FOPA 4XTKA 3C8GB 3SNHA 1T9KA 2R7VA 5KYYB 4IJJA 2PF4E 3X2QC 1JPNA 1H9GA 1FMVA 1TWCA 1NFOA 2OCCC 3RH3A 1SR2A 3HNJA 1E2XA 3K6BA 4A2NB 2R9RB 4AK9A 1R4TA 4XWJA 2NG1A 3JT1A 5DLJA 2O9XA 4C3EA 2C03A 3CQZA 1NBBA 1FFHA 2V26A 3TJ5A 5FZTA 1BZ4A 3HTKC 3Q7GA 3FOOA 4PJMA 3W2VA 1EA8A 3VAYA 4DRIB 3DM9B 3M15A 1NU9C 2NUTA 1MMGA 1S05A 3R7CA 1GQAA 3I5QA 5JSLA 4U9DA 4R32A 2D4UA 3L8IA 4MS2A 4OIQF 1VK5A 2W4MA 4Z9JA 2ZD9A 2LIGA 5L0HA 1E86A 2VC9A 3HKKA 3ABKC 1TWHA 4MVOA 3OA1A 1A7EA 3ZG1A 1NLXA 4CS9C 1LM3B 1MNEA 1Q0KA 1TQGA 2OQMA 1BR4A 2R7QA 3F47A 4QI0A 3ASNC 1JR8A 3DM5A 4N6CA 2ICWG 1OXKA 1HY5A 2WVOA 3FMSA 2RSEB 3CEXA 3EZHA 3M4BA 2R05A 4CDVA 1ORYA 2FGYA 3EPVA 5DQTA 2XXAB 3C63A 1G4US 2LCHA 3QVYA 3CAXA 1NFNA 3TOLA 2CNWD 2R7XA 2IXOA 2OJED 2P1AA 5E2QA 2YL0A 2GA0A 3AG1C 1FMWA 3LS0A 1Z7Qc 3MYFA 3US6A 3G50A 3LEVA 1Z5ZA 2KQ9A 4AE4B 3IEEA 2OEVA 4DVZA 1FFTC 2G3VA 2OEXA 4KBLA 1WN0A 3ECSA 3CSKA 3GWLA 1WATA 3Q6MA 1O3UA 1VOMA 2Y69C 3S0XA 2UUHA 4PK4A 1U6HA 2Q4FA 4MW8A 1V55C 1A41A 3NYJA 1EKYA 1PV3A 5D91A 1AEPA 3AGUA 1NG1A 3UR3C 1Q0DA 3K1IA 4XPWA 4JEAA 5JLIA 4BEMJ 4E7ZA 5L3QA 1AUEA 5JUAA 4H54A 1ZU4A 5F28E 2CYDA 1LE4A 2Y3HA 2AWCA 3DE9A 5JVEA 2ZXWC 3LESA 2YLDA 5HV9A 1M57C 1JPJA 1TFOB 1LI5A 2L6HA 2QUPA 3AG2C 2J0XA 2OU6A 3JZ0A 2YHSA 5KYXA 4O79A 4FX5A 4YT5A 2LK4A 5CI9A 3MX3A 3S84A 4YL0A 3IQ6A 2ZXPA 3NMKA 5A6BD 3ZSUA 1VLTA 3E70C 4BJ6A 4CDAA 1D1BA 1BDJB 1R5ID 1XZPA 2HMQA 2IXNA 4M63A 4CX9A 2PNOA 4JTDB 1OR2A 2R7WA 2HV7A 3NMJA 2HJ3A 2NSGA 4PFPA 2H7OA 2NUPB 3AG4C 3K1IC 1G8XA 4AX2A 4GEHA 2R02A 5E3CA 3ASOC 1YDIA 4MVZA 4DRHB 1K40A 2XLEA 1L7CA 3KMIA 2EPOA 4U5CE 1YARO 2JPUA 4JIOA 5L0DA 1VB5A 2P0NA 2EINC 3B71A 2YZSA 1YA9A 2XL4A 2XM0A 2YEVA 4WGYA 1CGNA 2NUTB 1KU2A 2PX3A 2KSFA 4JW1A 1C17M 3AJMA 3I4UA 4U9EA 2V3CC 4DVYP 1HW1A 3ZTZA 3S28A 1OCZC 3MYIA 4FWVA 2KYHA 4O6MA 3WAQA 1VMAA 2LP4A 1NZEA 5KYUB 1YYXA 2EPNA 4PR9A 3K33A 3L8JA 3ABMC 3B0VC 2JD3A 3U9JA 1K04A 4YT2A 4JC7A 1V74B 2OJQA 3JYHA 2BC5A 2AVKA 4W8PA 1H7IA 3VYWA 2AWYA 3PDMP 2G3KA 3N0TA 3L1MA 4GQHA 1LI7A 2XL6A 1U89A 2HKVA 3C8GA 2Q3TA 3EHNA 5F5FA 3NKDA 3NMIA 1PD0A 2HV6A 3GEEA 1QQ3A 2B0JA 3EHMA 3QMKA 4AE4A 4A4AA 5L0FA 3WODF 1T6QA 2VASA 1YJGA 4P9FA 1QKRA 4Q5SF 3H2VA 1Z63A 1DOVA 5AC5A 3RW0A 1QZXA 2L7AA 4FESA 3UMIA 4PJLA 3M1CB 3K7DA 3ZWIA 4DBQA 1WASA 5IY5C 2OG2A 3IHUA 3U8VA 3V5XA 2QE9A 2VCAA 3JSEO 5DS5A 1UFBA 1O5HA 4RBNA 1D1AA 2L6FA 3UGPA 2CGEA 2YVKA 1LIHA 2XLVA 1VTMP 3JSZA 2KJGA 1I5NA 2C04A 2EILC 1VYIA 1Q0FA 2L6GA 4MVSA 4EKWA 2M4EA 3O39A 5E33A 5T1DB 3S9OA 2YLIA 1ZU5A 3FHDA 1C02A 4WGZA 2EIKC 5A6BA 1QVXA 3C62A 3HJCA 2A0BA 3WHNA 2TMVP 2HS5A 1J8YF 4DRJB 5CIVA 5JRAA 3KYJA 4J7YA 2YL3A 4NQFA 3SXMA 4IRUA 2GAQA 5A6KA 1S7ZA 3QW1A 2R25A 4JKVA 4MVUA 2LQGA 5EK0A 3VF0A 4BG0A 1RMVA 1KTMA 1CPRA 3TQOA 1HE1A 1VYKA 2F22A 2EIMC 2NUPA 3GM3A 3LJBA 4G7OF 1KNYA 1YAUO 4O7GA 4OIPF 1IZMA 3K66A 2P6VA 1YZAA 3LS1A 4IWBA 4JE9A 4JTAB 2J46A 4J30B 4YN0B 3U2LA 1RKEB 3RYLA 1LPEA 1NSGB 1RCPA 1Z23A 3QW0A 4CS8C 3F46A 4DXWA 5EGYA 4CIHA 256BA 1ZHZA 4XLNF 1Z6AA 5AC4A 3FAPB 3NYLA 2HZ8A 4QDLA 2YKZA 3TJ6A 3W8HA 3RF3A 2YWAA 4ER9A 2D5RB 2NPUA 3A9CA 3LEOA 4N6HA 5L0JA 2HFIA 2MYSA 2PP4A 4LDQA 2ZPAA 1YLMA 2EIJC 2H8AA 1D0XA 3GODA 1OKKD 2Q9BA 3AOUA 2R03A 3T6BA 4BJ1A 3V7OA 3BEHA 1ZHTA 2KC3A 1LS1A 2DYRC 3U5SA 1K05A 5A6AA 2R7UA 1OR3A 2IOQA 2H7VC 1ZHWA 5D92A 5JT4A 1I4YA 3O6XA 4MTOA 2XLHA 4JCZA 4CIPA 3S90A 4PJNA 1RKCA 4U5GA 1LS4A 1YYJA 4E17A 3TULA 1FAPB 5JP7A 2Q9CA 3JRMO 5E3AA 2W9YA 1F1MA 3EZIA 3HLZA 2ETSA 3ZC4A 5DS4A 3IPMO 3EG9B 3FXHA 1IW7F 1T01A 1E85A 2XS8A 3TD7A 4Q4ZF 2DI3A 1W2WA 1FR0A 3SYNA 2LSEA 2VB6A 2JX0A 3PCVA 4UDVA 4N4WA 5L0IA 4U5EE 3NRHA 4X0RA 3MBGA 1HE9A 4J7TA 4GYTA 3DE8A 3B29A 3KL4A 2R7RA 2BE5F 3B0PA 4BJTA 4IARA 3EGXA 3PHF2 2L81A 3LLKA 1D0ZA 1EI7A 1V54C 2AU5A 1M2VB 3DJNB 3CZ6A 4NTAA 3AQBA 2GFHA 4U5FE 3FDQA 1WOLA 1HMOA 3RFYA 2J9VA 5KYUA 2OOCA 3J06A 2HJMA 3VRCA 2IXMA 4MVMA 3RIPA 3AG3C 4CJOA 1I4ZA 4C3DA 1M56C 4Z9IA 1T5OA 1CGOA 2FAPB 4IAOA 5A6JA 3A11A 3X1OA 1APCA 3OEOA 1QPUA 1M6TA 1ZHYA 4JTCB 2AP3A 1ST6A 4LACB 1QLEC 4XPXA 5T3WA 3T6GB 1TKNA 1B68A 4G0HA 3GORA 1OXBA 1PD1A 4HFKB 3NG1A 1XWJA 4AL1A 4I1MA 1RJ9B 2BL2A 3EH1A 3HNLA 4EIYA 3QZCA 4C7OA 3U8PA 5L3VA 4JJFA 1GM5A 3SEOA 4P6IC 4Z9HA 4KC9A 3B0UX 1D1CA 1E83A 1LVKA 1YZCA 3HNIA 3EG9A 3EGDA 3U9MA 5L0CA 3ZVRA 3HNKA 5FCLA 3C7JA 1Z3IX 5DQZA 3VM6A 2Q00A 1CGME 1SZIA 1MMDA 2PBEA 3MFNA 3LNRA 5AGFA 2OKUA 4G7HF 5GPGB 5KYXB 2Y3GA 1GS9A 3TOMA 4MTFA 3O55A 2YRFA
chains in the Genus database with same CATH topology
4YL0A 4J7TA 3B29A 3DWWA 4YL3A 3HKKA 4NTFA 5K0IA 2UUHA 2PNOA 4AL1A 4JC7A 2UUIA 4YK5A 4JCZA 4WABA 4NTBA 4NTAA 4AL0A 5BQGA 4BPMA 2Q7RA 5HV9A 5BQHA 3LEOA 4YL1A 4J7YA 4JRZA 3PCVA 2H8AA 5BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL0 A;  4J7T A;  3B29 A;  3DWW A;  4YL3 A;  3HKK A;  4NTF A;  5K0I A;  2UUH A;  2PNO A;  4AL1 A;  4JC7 A;  2UUI A;  4YK5 A;  4JCZ A;  4WAB A;  4NTB A;  4NTA A;  4AL0 A;  5BQG A;  4BPM A;  2Q7R A;  5HV9 A;  5BQH A;  3LEO A;  4YL1 A;  4J7Y A;  4JRZ A;  3PCV A;  2H8A A;  5BQI A; 
#chains in the Genus database with same CATH topology
 2M64 A;  3IQC A;  3LLI A;  4EBB A;  2PFD A;  2YLG A;  3G4X A;  4EWC A;  1H6G A;  4JUR I;  4PFO A;  4E0I A;  3JRT A;  3L34 A;  3JTL O;  1BBH A;  1QSP A;  3JCU Q;  1Y4C A;  1ORJ A;  4XEF A;  3NDB B;  5KYW B;  3I5P A;  3KYI A;  4BJ6 C;  4KNV A;  3ZIB A;  4BJ5 C;  2LFF A;  2W4B A;  3V5Z A;  5B3I A;  4CBE A;  4P9T A;  4XLP F;  1LE2 A;  3G4Z A;  3DKA A;  1Q0M A;  4MND A;  3BRJ A;  4JEB A;  5DS6 A;  4MTG A;  2XLW A;  3GEI A;  4JVS A;  3W8I A;  4RD9 A;  1SF8 A;  4IAQ A;  1T6I A;  1BR1 A;  1RKE A;  2EPK X;  4CS8 A;  2MHR A;  2IXP A;  3M79 A;  4MVQ A;  3DXJ F;  1RJ9 A;  3N24 A;  2A68 F;  3FVY A;  4G7Z F;  1N1C A;  1G5Z A;  1TWA A;  3EGD B;  1Y6D A;  4HFF B;  3SXZ A;  3ZDL A;  2HMZ A;  3SXY A;  3ZQY A;  4EHP A;  5K0I A;  1TFK B;  2IBF A;  3IQ5 A;  3RVZ A;  3DMD A;  4KNW A;  4E7S A;  2XS1 A;  3GM2 A;  1A7D A;  1T6U A;  1V4A A;  4CS9 A;  2H7B A;  4I3M A;  4NCQ A;  4YT8 A;  4DBR A;  5L0G A;  4CSA C;  4D4N A;  4LDK A;  2ASR A;  3ZQV A;  4C3B A;  1E84 A;  2Q7R A;  4NY3 A;  3POV A;  4KI2 A;  5B1B C;  2I15 A;  2WZL A;  1OCR C;  3E9V A;  2J9B A;  5KYY A;  1A0B A;  2IYL D;  3DAG A;  4U5B E;  3UMH A;  2DGJ A;  1WTY A;  2CNW A;  2FFH A;  2Q9A A;  2W45 A;  3B9Q A;  1HMD A;  1D0Y A;  2LFD A;  2CCY A;  4H4K C;  3SXK A;  4DJ9 A;  4CSA A;  2XXA A;  3Q7L A;  4PJJ A;  4O6Y A;  4YL3 A;  5DVW A;  2DB4 A;  1AVO B;  3C8Z A;  4OD4 A;  5CI8 A;  2VCC A;  5COM A;  1OW8 A;  4IB4 A;  4XEV A;  4EUK B;  2YL1 A;  3U3F A;  4WAB A;  2B0H A;  3V5Y A;  2WB7 A;  3ABL C;  3EFO A;  1FNT c;  2A69 F;  3GAN A;  3EGX B;  4JZA A;  1TR2 A;  1OCC C;  3NKE A;  5BQG A;  2KW3 C;  4ANJ A;  1BR2 A;  5TJ5 E;  1JAF A;  4XQ1 A;  3H65 A;  2J8W A;  1MND A;  2QTV A;  1UG7 A;  2GDC A;  1HW2 A;  2VH3 A;  2QLA A;  4U5D E;  5BUO A;  4N06 A;  1JMW A;  4CDY A;  1M2V A;  1M2O A;  4YL1 A;  4ONS A;  2X0C A;  4MVR A;  4JRZ A;  4BJ5 A;  4YT4 A;  1C03 A;  2GWW A;  1Q0G A;  3DI5 A;  4YWQ A;  5KYN A;  2YQY A;  3L0I A;  4G78 A;  4B6I A;  3EH2 A;  1FTS A;  2E87 A;  3SZR A;  4FAP B;  3DWW A;  4YJW A;  4NC3 A;  1MQV A;  3UGO A;  1JOG A;  1ORS C;  4XPY A;  4E18 A;  4NTF A;  1U0B B;  2CW0 F;  2HSQ A;  2QNL A;  3LNM B;  3C8G D;  3M4C A;  4QI2 A;  3PMR A;  5T3T A;  2G62 A;  1ZZP A;  2XLO A;  1XZQ A;  3H2U A;  3LUT B;  3DZA A;  1OCO C;  1SMY F;  3EQL F;  2KGO A;  2Y39 A;  4XEK A;  3ATP A;  4O6N A;  2P7V A;  3AQC A;  2R7S A;  2Z15 A;  4WJ0 A;  3DD7 A;  1ZYR F;  3SP1 A;  3T4R A;  2IM8 A;  1G4W R;  2KNH A;  4IGG A;  3U3B A;  1OW7 A;  1SYQ A;  4HE8 D;  3AGT A;  4Q7C A;  3FAJ A;  5F5H A;  2MWQ A;  4I1O B;  3JYY A;  4LER A;  5BQI A;  1OW6 A;  1A7V A;  1OQC A;  3N2Z B;  3T9O A;  1CPQ A;  2P61 A;  4JCH A;  4CJG A;  1MMA A;  2QY9 A;  2EPM X;  1OKK A;  3EFO B;  4LLE A;  2I8B A;  2J45 A;  4MQ9 F;  3NYM A;  1O87 A;  1RXQ A;  2A1D D;  2A6E F;  4RDA A;  4ZLC A;  3U0C A;  4JJG A;  1LKX A;  2A0U A;  2XSE A;  2ZXR A;  3MLG A;  4OIO F;  1J8M F;  4CS7 A;  4BPM A;  3T6J A;  5COG A;  2WVN A;  2XL8 A;  4K0D A;  3U2M A;  5A69 A;  3IQT A;  4OIR F;  2XM4 A;  3UNG C;  4EBJ A;  1NU7 D;  4C7O B;  2J0W A;  1WGW A;  4LLC A;  1VLS A;  4HEA J;  3RKO F;  5HSW A;  2CDQ A;  4I44 A;  4OD5 A;  2XLD A;  3GWN A;  5COF A;  4OIN F;  2HSB A;  3S29 A;  2WZF A;  2WVQ A;  4LDR A;  2Y3B A;  2L9J A;  3DJU B;  3S27 A;  2J7P A;  4K1O A;  1YA7 O;  1ZW3 A;  1H9T A;  5EHH A;  2WZG A;  2UUI A;  3ITF A;  2HUJ A;  3OWT A;  4YK5 A;  3RQE A;  3W2W A;  4NTB A;  4DOZ A;  3EJN A;  3GEH A;  3TK0 A;  2VCB A;  4ULW A;  3Q6N A;  1L3P A;  4PAC A;  4U5H A;  3R2P A;  3K1H A;  4AL0 A;  1JRA A;  5B1A C;  1EQ1 A;  2NSF A;  2XRH A;  4EBK A;  1PCX A;  2J9U A;  2XLM A;  1WWP A;  1GGQ A;  3C18 A;  4D4X A;  4MW3 A;  3KH2 A;  5BQH A;  5JS5 A;  4F4B A;  2KK1 A;  4L6R A;  3RVY A;  3UMK A;  2ZXO A;  2DYS C;  3KKB A;  4E0H A;  3RQG A;  1YVI A;  2R7O A;  4W8K A;  3W4Y A;  3KPH A;  1TWG A;  3RQF A;  5KYW A;  4ZLD A;  3QVZ A;  4J32 B;  3GM1 A;  2RD9 A;  2X51 A;  1MMN A;  3LAY A;  3O10 A;  1DOW A;  3QTH A;  4K7B A;  2J7P D;  2J9W A;  3WG7 C;  4BEJ A;  5B3S C;  2EPL X;  2R7T A;  1ZVZ A;  2A6H F;  2Y3D A;  2WL8 A;  3DAF A;  2YL7 A;  4ULV A;  2LD6 A;  1ZW2 A;  3ZTM A;  1ZHX A;  2PX0 A;  3FOP A;  4XTK A;  3C8G B;  3SNH A;  1T9K A;  2R7V A;  5KYY B;  4IJJ A;  2PF4 E;  3X2Q C;  1JPN A;  1H9G A;  1FMV A;  1TWC A;  1NFO A;  2OCC C;  3RH3 A;  1SR2 A;  3HNJ A;  1E2X A;  3K6B A;  4A2N B;  2R9R B;  4AK9 A;  1R4T A;  4XWJ A;  2NG1 A;  3JT1 A;  5DLJ A;  2O9X A;  4C3E A;  2C03 A;  3CQZ A;  1NBB A;  1FFH A;  2V26 A;  3TJ5 A;  5FZT A;  1BZ4 A;  3HTK C;  3Q7G A;  3FOO A;  4PJM A;  3W2V A;  1EA8 A;  3VAY A;  4DRI B;  3DM9 B;  3M15 A;  1NU9 C;  2NUT A;  1MMG A;  1S05 A;  3R7C A;  1GQA A;  3I5Q A;  5JSL A;  4U9D A;  4R32 A;  2D4U A;  3L8I A;  4MS2 A;  4OIQ F;  1VK5 A;  2W4M A;  4Z9J A;  2ZD9 A;  2LIG A;  5L0H A;  1E86 A;  2VC9 A;  3HKK A;  3ABK C;  1TWH A;  4MVO A;  3OA1 A;  1A7E A;  3ZG1 A;  1NLX A;  4CS9 C;  1LM3 B;  1MNE A;  1Q0K A;  1TQG A;  2OQM A;  1BR4 A;  2R7Q A;  3F47 A;  4QI0 A;  3ASN C;  1JR8 A;  3DM5 A;  4N6C A;  2ICW G;  1OXK A;  1HY5 A;  2WVO A;  3FMS A;  2RSE B;  3CEX A;  3EZH A;  3M4B A;  2R05 A;  4CDV A;  1ORY A;  2FGY A;  3EPV A;  5DQT A;  2XXA B;  3C63 A;  1G4U S;  2LCH A;  3QVY A;  3CAX A;  1NFN A;  3TOL A;  2CNW D;  2R7X A;  2IXO A;  2OJE D;  2P1A A;  5E2Q A;  2YL0 A;  2GA0 A;  3AG1 C;  1FMW A;  3LS0 A;  1Z7Q c;  3MYF A;  3US6 A;  3G50 A;  3LEV A;  1Z5Z A;  2KQ9 A;  4AE4 B;  3IEE A;  2OEV A;  4DVZ A;  1FFT C;  2G3V A;  2OEX A;  4KBL A;  1WN0 A;  3ECS A;  3CSK A;  3GWL A;  1WAT A;  3Q6M A;  1O3U A;  1VOM A;  2Y69 C;  3S0X A;  2UUH A;  4PK4 A;  1U6H A;  2Q4F A;  4MW8 A;  1V55 C;  1A41 A;  3NYJ A;  1EKY A;  1PV3 A;  5D91 A;  1AEP A;  3AGU A;  1NG1 A;  3UR3 C;  1Q0D A;  3K1I A;  4XPW A;  4JEA A;  5JLI A;  4BEM J;  4E7Z A;  5L3Q A;  1AUE A;  5JUA A;  4H54 A;  1ZU4 A;  5F28 E;  2CYD A;  1LE4 A;  2Y3H A;  2AWC A;  3DE9 A;  5JVE A;  2ZXW C;  3LES A;  2YLD A;  5HV9 A;  1M57 C;  1JPJ A;  1TFO B;  1LI5 A;  2L6H A;  2QUP A;  3AG2 C;  2J0X A;  2OU6 A;  3JZ0 A;  2YHS A;  5KYX A;  4O79 A;  4FX5 A;  4YT5 A;  2LK4 A;  5CI9 A;  3MX3 A;  3S84 A;  4YL0 A;  3IQ6 A;  2ZXP A;  3NMK A;  5A6B D;  3ZSU A;  1VLT A;  3E70 C;  4BJ6 A;  4CDA A;  1D1B A;  1BDJ B;  1R5I D;  1XZP A;  2HMQ A;  2IXN A;  4M63 A;  4CX9 A;  2PNO A;  4JTD B;  1OR2 A;  2R7W A;  2HV7 A;  3NMJ A;  2HJ3 A;  2NSG A;  4PFP A;  2H7O A;  2NUP B;  3AG4 C;  3K1I C;  1G8X A;  4AX2 A;  4GEH A;  2R02 A;  5E3C A;  3ASO C;  1YDI A;  4MVZ A;  4DRH B;  1K40 A;  2XLE A;  1L7C A;  3KMI A;  2EPO A;  4U5C E;  1YAR O;  2JPU A;  4JIO A;  5L0D A;  1VB5 A;  2P0N A;  2EIN C;  3B71 A;  2YZS A;  1YA9 A;  2XL4 A;  2XM0 A;  2YEV A;  4WGY A;  1CGN A;  2NUT B;  1KU2 A;  2PX3 A;  2KSF A;  4JW1 A;  1C17 M;  3AJM A;  3I4U A;  4U9E A;  2V3C C;  4DVY P;  1HW1 A;  3ZTZ A;  3S28 A;  1OCZ C;  3MYI A;  4FWV A;  2KYH A;  4O6M A;  3WAQ A;  1VMA A;  2LP4 A;  1NZE A;  5KYU B;  1YYX A;  2EPN A;  4PR9 A;  3K33 A;  3L8J A;  3ABM C;  3B0V C;  2JD3 A;  3U9J A;  1K04 A;  4YT2 A;  4JC7 A;  1V74 B;  2OJQ A;  3JYH A;  2BC5 A;  2AVK A;  4W8P A;  1H7I A;  3VYW A;  2AWY A;  3PDM P;  2G3K A;  3N0T A;  3L1M A;  4GQH A;  1LI7 A;  2XL6 A;  1U89 A;  2HKV A;  3C8G A;  2Q3T A;  3EHN A;  5F5F A;  3NKD A;  3NMI A;  1PD0 A;  2HV6 A;  3GEE A;  1QQ3 A;  2B0J A;  3EHM A;  3QMK A;  4AE4 A;  4A4A A;  5L0F A;  3WOD F;  1T6Q A;  2VAS A;  1YJG A;  4P9F A;  1QKR A;  4Q5S F;  3H2V A;  1Z63 A;  1DOV A;  5AC5 A;  3RW0 A;  1QZX A;  2L7A A;  4FES A;  3UMI A;  4PJL A;  3M1C B;  3K7D A;  3ZWI A;  4DBQ A;  1WAS A;  5IY5 C;  2OG2 A;  3IHU A;  3U8V A;  3V5X A;  2QE9 A;  2VCA A;  3JSE O;  5DS5 A;  1UFB A;  1O5H A;  4RBN A;  1D1A A;  2L6F A;  3UGP A;  2CGE A;  2YVK A;  1LIH A;  2XLV A;  1VTM P;  3JSZ A;  2KJG A;  1I5N A;  2C04 A;  2EIL C;  1VYI A;  1Q0F A;  2L6G A;  4MVS A;  4EKW A;  2M4E A;  3O39 A;  5E33 A;  5T1D B;  3S9O A;  2YLI A;  1ZU5 A;  3FHD A;  1C02 A;  4WGZ A;  2EIK C;  5A6B A;  1QVX A;  3C62 A;  3HJC A;  2A0B A;  3WHN A;  2TMV P;  2HS5 A;  1J8Y F;  4DRJ B;  5CIV A;  5JRA A;  3KYJ A;  4J7Y A;  2YL3 A;  4NQF A;  3SXM A;  4IRU A;  2GAQ A;  5A6K A;  1S7Z A;  3QW1 A;  2R25 A;  4JKV A;  4MVU A;  2LQG A;  5EK0 A;  3VF0 A;  4BG0 A;  1RMV A;  1KTM A;  1CPR A;  3TQO A;  1HE1 A;  1VYK A;  2F22 A;  2EIM C;  2NUP A;  3GM3 A;  3LJB A;  4G7O F;  1KNY A;  1YAU O;  4O7G A;  4OIP F;  1IZM A;  3K66 A;  2P6V A;  1YZA A;  3LS1 A;  4IWB A;  4JE9 A;  4JTA B;  2J46 A;  4J30 B;  4YN0 B;  3U2L A;  1RKE B;  3RYL A;  1LPE A;  1NSG B;  1RCP A;  1Z23 A;  3QW0 A;  4CS8 C;  3F46 A;  4DXW A;  5EGY A;  4CIH A;  256B A;  1ZHZ A;  4XLN F;  1Z6A A;  5AC4 A;  3FAP B;  3NYL A;  2HZ8 A;  4QDL A;  2YKZ A;  3TJ6 A;  3W8H A;  3RF3 A;  2YWA A;  4ER9 A;  2D5R B;  2NPU A;  3A9C A;  3LEO A;  4N6H A;  5L0J A;  2HFI A;  2MYS A;  2PP4 A;  4LDQ A;  2ZPA A;  1YLM A;  2EIJ C;  2H8A A;  1D0X A;  3GOD A;  1OKK D;  2Q9B A;  3AOU A;  2R03 A;  3T6B A;  4BJ1 A;  3V7O A;  3BEH A;  1ZHT A;  2KC3 A;  1LS1 A;  2DYR C;  3U5S A;  1K05 A;  5A6A A;  2R7U A;  1OR3 A;  2IOQ A;  2H7V C;  1ZHW A;  5D92 A;  5JT4 A;  1I4Y A;  3O6X A;  4MTO A;  2XLH A;  4JCZ A;  4CIP A;  3S90 A;  4PJN A;  1RKC A;  4U5G A;  1LS4 A;  1YYJ A;  4E17 A;  3TUL A;  1FAP B;  5JP7 A;  2Q9C A;  3JRM O;  5E3A A;  2W9Y A;  1F1M A;  3EZI A;  3HLZ A;  2ETS A;  3ZC4 A;  5DS4 A;  3IPM O;  3EG9 B;  3FXH A;  1IW7 F;  1T01 A;  1E85 A;  2XS8 A;  3TD7 A;  4Q4Z F;  2DI3 A;  1W2W A;  1FR0 A;  3SYN A;  2LSE A;  2VB6 A;  2JX0 A;  3PCV A;  4UDV A;  4N4W A;  5L0I A;  4U5E E;  3NRH A;  4X0R A;  3MBG A;  1HE9 A;  4J7T A;  4GYT A;  3DE8 A;  3B29 A;  3KL4 A;  2R7R A;  2BE5 F;  3B0P A;  4BJT A;  4IAR A;  3EGX A;  3PHF 2;  2L81 A;  3LLK A;  1D0Z A;  1EI7 A;  1V54 C;  2AU5 A;  1M2V B;  3DJN B;  3CZ6 A;  4NTA A;  3AQB A;  2GFH A;  4U5F E;  3FDQ A;  1WOL A;  1HMO A;  3RFY A;  2J9V A;  5KYU A;  2OOC A;  3J06 A;  2HJM A;  3VRC A;  2IXM A;  4MVM A;  3RIP A;  3AG3 C;  4CJO A;  1I4Z A;  4C3D A;  1M56 C;  4Z9I A;  1T5O A;  1CGO A;  2FAP B;  4IAO A;  5A6J A;  3A11 A;  3X1O A;  1APC A;  3OEO A;  1QPU A;  1M6T A;  1ZHY A;  4JTC B;  2AP3 A;  1ST6 A;  4LAC B;  1QLE C;  4XPX A;  5T3W A;  3T6G B;  1TKN A;  1B68 A;  4G0H A;  3GOR A;  1OXB A;  1PD1 A;  4HFK B;  3NG1 A;  1XWJ A;  4AL1 A;  4I1M A;  1RJ9 B;  2BL2 A;  3EH1 A;  3HNL A;  4EIY A;  3QZC A;  4C7O A;  3U8P A;  5L3V A;  4JJF A;  1GM5 A;  3SEO A;  4P6I C;  4Z9H A;  4KC9 A;  3B0U X;  1D1C A;  1E83 A;  1LVK A;  1YZC A;  3HNI A;  3EG9 A;  3EGD A;  3U9M A;  5L0C A;  3ZVR A;  3HNK A;  5FCL A;  3C7J A;  1Z3I X;  5DQZ A;  3VM6 A;  2Q00 A;  1CGM E;  1SZI A;  1MMD A;  2PBE A;  3MFN A;  3LNR A;  5AGF A;  2OKU A;  4G7H F;  5GPG B;  5KYX B;  2Y3G A;  1GS9 A;  3TOM A;  4MTF A;  3O55 A;  2YRF A; 
#chains in the Genus database with same CATH homology
 4YL0 A;  4J7T A;  3B29 A;  3DWW A;  4YL3 A;  3HKK A;  4NTF A;  5K0I A;  2UUH A;  2PNO A;  4AL1 A;  4JC7 A;  2UUI A;  4YK5 A;  4JCZ A;  4WAB A;  4NTB A;  4NTA A;  4AL0 A;  5BQG A;  4BPM A;  2Q7R A;  5HV9 A;  5BQH A;  3LEO A;  4YL1 A;  4J7Y A;  4JRZ A;  3PCV A;  2H8A A;  5BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...