5BQIA

Discovery of a potent and selective mpges-1 inhibitor for the treatment of pain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 66
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqiA00
4YK5A 2Q7RA 3DWWA 4WABA 5BQIA 3PCVA 2UUHA 3B29A 5HV9A 4NTAA 3LEOA 4YL0A 4NTBA 4BPMA 3HKKA 4J7YA 4JRZA 4JCZA 5K0IA 5BQGA 2UUIA 4JC7A 4J7TA 5BQHA 4NTFA 2PNOA 4AL0A 4AL1A 4YL3A 2H8AA 4YL1A
chains in the Genus database with same CATH superfamily
2R7XA 1UFBA 4MVOA 2Y39A 2MHRA 1TFOB 1Z3IX 3DAGA 3U2MA 2DB4A 2IXNA 1LS1A 1M6TA 3KYJA 1H9GA 4E17A 4DXWA 4EBJA 3DKAA 3FDQA 1WN0A 3GEIA 4YN0B 2WZGA 4BJ5C 4KI2A 1YYXA 4LLCA 2EIJC 4JRZA 3NMIA 1S05A 1VOMA 5AC4A 2H7OA 3DAFA 4LDKA 1OXBA 2ZXPA 2D4UA 1KNYA 2A1DD 3ZVRA 5E3CA 2XS8A 1Z23A 1WASA 4Z9HA 5DS4A 1ZHTA 3MLGA 3MYIA 4RDAA 2VCAA 2C04A 1SZIA 2RD9A 3T9OA 4U5GA 1RCPA 4ANJA 2KQ9A 1G5ZA 2MWQA 2A0BA 1TKNA 1XWJA 3DJNB 1K04A 4JEBA 2XS1A 4YT4A 2Q3TA 2A6HF 2OJQA 4IAQA 3KYIA 4ULWA 3ZSUA 3FAPB 3DXJF 5CI8A 3GEHA 1TFKB 3JZ0A 5BQIA 1NU9C 1ZYRF 1JOGA 1CPQA 4CS8A 5HV9A 2DYSC 2W4BA 1D0ZA 1LS4A 1MNDA 2HV6A 3EH1A 3M4CA 3WG7C 2AP3A 2L7AA 4EUKB 2Z15A 3E9VA 2J9VA 2R03A 3U9MA 3N2ZB 4U9DA 1O3UA 4EBBA 2XSEA 2R02A 3EG9A 3QTHA 3LLIA 4G78A 4N6CA 3US6A 5K0IA 1CGOA 2OKUA 1WGWA 2J45A 3DE8A 3HNKA 3JT1A 3K66A 3O10A 4O7GA 4BJ5A 5DQTA 3QZCA 3JYYA 5KYXB 2GA0A 1CGME 1PD0A 2JPUA 3QW1A 1KU2A 1GM5A 3QMKA 1TWHA 5DS6A 1H6GA 4ZLDA 2Y3DA 3RH3A 4FESA 3GODA 1OCOC 3K33A 2XM0A 4W8KA 1WATA 2YZSA 3HTKC 3PCVA 3UGPA 1NLXA 4PFOA 2Y3GA 1N1CA 3Q6MA 3K6BA 4YL0A 3F47A 1HMDA 2QY9A 4U5DE 1RJ9A 3HKKA 4JCHA 3EGXB 4PFPA 4JCZA 3RIPA 2NUTA 3DJUB 4JW1A 5F5HA 2YRFA 2NUPB 3O55A 3W4YA 2AWCA 2EPKX 2J46A 1MMDA 4HFKB 4JC7A 2PX0A 3M4BA 4I3MA 5KYWA 1TWCA 4NY3A 2GFHA 4DBRA 3AQCA 3AG1C 1VYKA 2A6EF 2QE9A 4HFFB 3GEEA 2P7VA 3FOPA 3SXKA 1YYJA 4OD4A 4N4WA 2EILC 4KC9A 3UMKA 2YHSA 4CIHA 2KNHA 3FHDA 2JX0A 1WTYA 2XLWA 3M79A 1D1CA 3NMKA 2R7SA 2IBFA 3ABLC 2EPNA 3AJMA 3JYHA 1OQCA 3L8IA 3S28A 3F46A 1Q0MA 4U5FE 3TQOA 1BR2A 4U5CE 3MFNA 5L0FA 1G8XA 2ETSA 3VF0A 2J9BA 4C3DA 5DQZA 4DRIB 4MTGA 4FAPB 1HW1A 3V5ZA 1L7CA 2IOQA 3A9CA 4XEFA 1VLTA 4D4NA 3L8JA 4DRJB 2W45A 3JSZA 3L0IA 3EZHA 2QNLA 3T6JA 3IQ5A 2YLGA 3LS0A 3Q6NA 5F28E 3W2WA 4CDAA 4MTOA 1H7IA 3TD7A 3JCUQ 1WWPA 1Y6DA 4YT8A 5KYYA 3SYNA 3LUTB 4Q5SF 3ATPA 2YQYA 3G4XA 4D4XA 1SMYF 4NTAA 1FMVA 1E85A 2GAQA 3A11A 1JPJA 1BDJB 3B0UX 2OU6A 1FNTc 3HNJA 4IWBA 2A0UA 1OCCC 4NC3A 2TMVP 1MMAA 3M1CB 1F1MA 5CIVA 3DM9B 5E3AA 3N24A 5E33A 3S29A 2OOCA 3ZDLA 5L0DA 1VYIA 5D92A 2L9JA 1V54C 2XLVA 2XL6A 1YJGA 4CBEA 2GWWA 4RBNA 3TULA 4QI2A 1BBHA 2VCCA 1AVOB 2X0CA 4G7OF 4AL0A 4W8PA 1FFTC 1SR2A 1ZHYA 3FOOA 3RQEA 4EBKA 4EIYA 1FFHA 2XLOA 2OCCC 3ASNC 3FAJA 5JT4A 4GYTA 5DVWA 2Q9AA 3I5PA 3K7DA 4JTDB 1OR3A 1YA9A 3LEVA 4XQ1A 1ZHWA 2HSQA 2ZD9A 2DYRC 5L0IA 1I4YA 3EHMA 5JP7A 2WVOA 2PF4E 4DJ9A 3U2LA 3HJCA 1W2WA 1CGNA 2XRHA 3EZIA 2G3KA 3ASOC 2XLEA 3GWLA 4NCQA 5JSLA 4MVUA 2L81A 1HY5A 1SF8A 3C63A 3S27A 1RXQA 4JVSA 4R32A 3DZAA 2ZXRA 5A69A 3RQFA 3O39A 3U9JA 5IY5C 3VAYA 3DD7A 3U0CA 4CSAC 1JMWA 4CJGA 2Y69C 5COMA 3ECSA 2H7BA 2LFFA 4U5BE 4BEJA 3LNMB 1M2VA 2EPOA 5A6AA 4NQFA 3C62A 2R7VA 1OKKA 1OW7A 3POVA 1HW2A 2NSGA 3EPVA 3ZTMA 3RFYA 1RJ9B 4HE8D 4C7OB 3B29A 2L6HA 3SNHA 2XXAA 1XZQA 5KYUA 2LIGA 2DI3A 3RW0A 4MVRA 4JURI 2QUPA 1T9KA 3C8GB 5KYWB 3ZG1A 1JR8A 1OR2A 2VB6A 2OEXA 4PACA 3SXYA 5A6JA 2IXPA 3B0PA 3AG4C 1A41A 3X1OA 4DVYP 4ZLCA 1T5OA 1PCXA 1I5NA 4PJJA 4YL3A 3ABKC 3BEHA 3DI5A 2R7UA 3K1IC 2XLHA 1IW7F 2CCYA 4O6NA 1TQGA 5B1AC 2R7OA 1JAFA 2Y3BA 3HNLA 2WB7A 2HMZA 3GANA 3NKDA 1UG7A 1ZU4A 3LESA 3MBGA 4BJ6C 4AE4A 4G7HF 4CSAA 3B9QA 1U6HA 5A6BA 4N06A 4Q7CA 4GEHA 2FGYA 1EI7A 1V4AA 2CNWA 3TOLA 1T6QA 2ZXOA 1I4ZA 1OW8A 2VC9A 3GWNA 3LNRA 5JS5A 2OG2A 4BPMA 4E7SA 3SXMA 4UDVA 4A2NB 1D1BA 1RKCA 1AEPA 1A7DA 1NG1A 4MVQA 1E84A 1BR1A 2KJGA 1NSGB 1G4US 1LVKA 4JE9A 2BE5F 2IXOA 1QSPA 4IGGA 4PR9A 1YZCA 1MNEA 1Z5ZA 1ZW3A 3K1HA 1J8YF 4MQ9F 3Q7LA 1JPNA 1YZAA 2HV7A 3V7OA 3ZQVA 1NU7D 1MMNA 1YDIA 1FTSA 2YEVA 3EFOB 3PMRA 4X0RA 3UGOA 2YLDA 3FVYA 3IPMO 1FMWA 1QPUA 1D0XA 1GQAA 2B0JA 4E0HA 4ER9A 1EKYA 1Q0DA 2KC3A 4XEVA 4CIPA 3JSEO 3TOMA 2Q9CA 4WGZA 2VCBA 2EIMC 3L34A 3CAXA 4BJTA 1ZVZA 3U8VA 2UUHA 1WOLA 5B3IA 4EKWA 2BL2A 3EQLF 3U3BA 3PHF2 4OIOF 3W8HA 3G50A 2J0XA 4CS9C 2X51A 4BJ6A 2G62A 4MW8A 4ONSA 3O6XA 2DGJA 2KGOA 4J7YA 4KBLA 5EGYA 4K0DA 5FCLA 4C3BA 4XTKA 4OINF 2UUIA 1ZHXA 256BA 5JRAA 4U9EA 3W2VA 2LP4A 1AUEA 4P6IC 3GM2A 1C03A 2PFDA 3LAYA 3TJ5A 1BZ4A 1YVIA 2NG1A 2ZXWC 2CW0F 2XL8A 5B1BC 2EINC 3TJ6A 4CX9A 5KYXA 2XLMA 2J7PA 2YVKA 4C3EA 3IHUA 4RD9A 5KYNA 2WVNA 4O6YA 2A68F 4WABA 2G3VA 4QDLA 3B0VC 4IAOA 2CGEA 1Q0GA 2ICWG 2WVQA 3SZRA 2HSBA 1V74B 4Z9IA 2Y3HA 4N6HA 4EWCA 4LDRA 1VB5A 3EGDA 3KPHA 4JZAA 4WGYA 3ZIBA 3R2PA 2WZLA 4U5EE 1RMVA 4DBQA 2IYLD 3C8GD 1S7ZA 1FR0A 3ABMC 5BQGA 1Z63A 3QVYA 4I1MA 1Q0KA 4H54A 2LK4A 4G0HA 3UNGC 4FX5A 1RKEA 3OA1A 1YLMA 2NUPA 1Y4CA 1L3PA 1OCRC 2ZPAA 4OIQF 2HKVA 3CSKA 2PBEA 5EK0A 5FZTA 4CJOA 4DRHB 2R7WA 3OEOA 5DLJA 2O9XA 3T4RA 2OJED 2YL1A 2Q9BA 1E86A 3BRJA 1T6UA 2W9YA 3NDBB 5F5FA 4XPXA 2YL0A 2P6VA 3NYLA 3HLZA 3I4UA 3S0XA 2H7VC 3EG9B 4JJGA 5T1DB 3VM6A 3RVZA 3RVYA 4NTBA 1SYQA 2M4EA 4XEKA 3SXZA 1QQ3A 3QW0A 3ZWIA 4YT2A 5GPGB 4Q4ZF 3C7JA 4E18A 3V5YA 5BUOA 3H2UA 2LFDA 5L0JA 2PP4A 3J06A 3LJBA 1OCZC 2FAPB 2V26A 2J8WA 4BG0A 1ORJA 4NTFA 2CDQA 2R7RA 1G4WR 4KNVA 3ITFA 4AE4B 1K40A 2L6FA 3CQZA 1MQVA 4MVZA 4IARA 1DOVA 4GQHA 1QVXA 4JEAA 1KTMA 5AC5A 3GM1A 1T6IA 3S90A 2HZ8A 1QZXA 4LACB 4MVSA 4YK5A 3DWWA 1VTMP 4O79A 1C17M 1E2XA 4MVMA 4XLPF 3FXHA 2EIKC 1B68A 5L0CA 2NUTB 3LEOA 1K05A 2Q00A 2HS5A 3GORA 2P0NA 3W8IA 5A6KA 2HFIA 1T01A 2NSFA 4E7ZA 1GGQA 2GDCA 4JKVA 3R7CA 4Z9JA 1M56C 4OIPF 2R7TA 1LI7A 3EJNA 3RKOF 2R05A 1NZEA 1VLSA 4LERA 2KYHA 2EPMX 2YLIA 1FAPB 3DE9A 3V5XA 3WHNA 4DVZA 3DM5A 4A4AA 4F4BA 2AU5A 1QLEC 2L6GA 2YKZA 4JTAB 4MS2A 2XL4A 1APCA 3IEEA 2H8AA 3L1MA 4IRUA 3C18A 5D91A 2VASA 3VYWA 2JD3A 3GM3A 3NG1A 3AG2C 1D1AA 3OWTA 4U5HA 4OIRF 3H65A 1ZU5A 2Q4FA 3JRMO 3EHNA 3KH2A 3SEOA 4CDYA 2A69F 1E83A 1VK5A 1O87A 3QVZA 2I15A 1LPEA 3ZQYA 4QI0A 2BC5A 1DOWA 4O6MA 4ULVA 2J0WA 3U5SA 2XM4A 4MW3A 3AQBA 4FWVA 3CZ6A 2J9WA 1U0BB 3UR3C 1ORYA 1OXKA 3T6GB 3S84A 1M2OA 3IQTA 1LKXA 1YARO 2AVKA 2FFHA 4JIOA 5T3WA 2HJMA 3AOUA 4J7TA 3ZTZA 2PNOA 2QLAA 2OQMA 1OKKD 3WAQA 2P1AA 3G4ZA 1ORSC 2CYDA 1LI5A 4PJNA 3H2VA 1CPRA 2M64A 5KYYB 3M15A 3MX3A 1XZPA 1ZZPA 4I1OB 1NFOA 4G7ZF 1LIHA 4XPYA 4HEAJ 4DOZA 4BEMJ 2J9UA 3AG3C 4IJJA 4L6RA 3KL4A 3EGDB 4AX2A 4AK9A 3U8PA 1A0BA 4XPWA 4BJ1A 5JVEA 2HMQA 3RF3A 2YWAA 1C02A 3K1IA 2C03A 3NYMA 5L0GA 1PV3A 3JRTA 1J8MF 5EHHA 1HE9A 5T3TA 3UMIA 1H9TA 2OEVA 4C7OA 5JLIA 1Z6AA 1RKEB 2B0HA 3N0TA 4MTFA 2YL3A 5E2QA 3B71A 5HSWA 1LM3B 3LLKA 2W4MA 3C8GA 2YL7A 1LE2A 2LD6A 3IQ6A 5L3QA 2NPUA 1D0YA 1M57C 4K7BA 1R4TA 3TK0A 2KSFA 2WL8A 4LDQA 2QTVA 4EHPA 5A6BD 1ZHZA 2LCHA 1OW6A 2CNWD 3JTLO 1EA8A 1QKRA 4J32B 4LLEA 1O5HA 4OD5A 2Q7RA 3SP1A 1NBBA 4PK4A 3UMHA 4PJLA 4YJWA 1A7EA 2VH3A 3NYJA 2IXMA 4M63A 2E87A 4JJFA 3DMDA 2ASRA 2F22A 2XLDA 3RYLA 3VRCA 3X2QC 1Z7Qc 1TWGA 4XLNF 2KK1A 4CS9A 1M2VB 3EGXA 4B6IA 2I8BA 4I44A 5CI9A 1YA7O 1R5ID 2MYSA 3Q7GA 2WZFA 1U89A 2EPLX 3NMJA 5AGFA 3NKEA 3I5QA 5L0HA 2R9RB 3T6BA 2D5RB 1A7VA 4WJ0A 3EH2A 5COGA 3S9OA 2XXAB 2KW3C 3EFOA 5KYUB 4E0IA 3AGUA 3KKBA 5B3SC 1HMOA 1JRAA 1LE4A 3KMIA 3IQCA 1YAUO 3LS1A 5JUAA 1TWAA 3C8ZA 1Q0FA 1HE1A 2LQGA 4CDVA 4MNDA 2IM8A 1GS9A 2LSEA 4KNWA 1PD1A 3MYFA 3E70C 4YT5A 4J30B 2V3CC 3CEXA 1EQ1A 5DS5A 1ST6A 1NFNA 3AGTA 4H4KC 1VMAA 1MMGA 4P9TA 1IZMA 1V55C 2RSEB 2R7QA 4K1OA 3PDMP 3ZC4A 3WODF 2PX3A 4CS7A 1ZW2A 3U3FA 5BQHA 3FMSA 2P61A 2R25A 3NRHA 2HUJA 4AL1A 4JTCB 2J7PD 4PJMA 5COFA 3RQGA 4XWJA 4P9FA 1TR2A 5L3VA 2AWYA 5TJ5E 4IB4A 3HNIA 2HJ3A 4YL1A 4CS8C 1BR4A 4YWQA
chains in the Genus database with same CATH topology
4YK5A 2Q7RA 3DWWA 4WABA 5BQIA 3PCVA 2UUHA 3B29A 5HV9A 4NTAA 3LEOA 4YL0A 4NTBA 4BPMA 3HKKA 4J7YA 4JRZA 4JCZA 5K0IA 5BQGA 2UUIA 4JC7A 4J7TA 5BQHA 4NTFA 2PNOA 4AL0A 4AL1A 4YL3A 2H8AA 4YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YK5 A;  2Q7R A;  3DWW A;  4WAB A;  5BQI A;  3PCV A;  2UUH A;  3B29 A;  5HV9 A;  4NTA A;  3LEO A;  4YL0 A;  4NTB A;  4BPM A;  3HKK A;  4J7Y A;  4JRZ A;  4JCZ A;  5K0I A;  5BQG A;  2UUI A;  4JC7 A;  4J7T A;  5BQH A;  4NTF A;  2PNO A;  4AL0 A;  4AL1 A;  4YL3 A;  2H8A A;  4YL1 A; 
#chains in the Genus database with same CATH topology
 2R7X A;  1UFB A;  4MVO A;  2Y39 A;  2MHR A;  1TFO B;  1Z3I X;  3DAG A;  3U2M A;  2DB4 A;  2IXN A;  1LS1 A;  1M6T A;  3KYJ A;  1H9G A;  4E17 A;  4DXW A;  4EBJ A;  3DKA A;  3FDQ A;  1WN0 A;  3GEI A;  4YN0 B;  2WZG A;  4BJ5 C;  4KI2 A;  1YYX A;  4LLC A;  2EIJ C;  4JRZ A;  3NMI A;  1S05 A;  1VOM A;  5AC4 A;  2H7O A;  3DAF A;  4LDK A;  1OXB A;  2ZXP A;  2D4U A;  1KNY A;  2A1D D;  3ZVR A;  5E3C A;  2XS8 A;  1Z23 A;  1WAS A;  4Z9H A;  5DS4 A;  1ZHT A;  3MLG A;  3MYI A;  4RDA A;  2VCA A;  2C04 A;  1SZI A;  2RD9 A;  3T9O A;  4U5G A;  1RCP A;  4ANJ A;  2KQ9 A;  1G5Z A;  2MWQ A;  2A0B A;  1TKN A;  1XWJ A;  3DJN B;  1K04 A;  4JEB A;  2XS1 A;  4YT4 A;  2Q3T A;  2A6H F;  2OJQ A;  4IAQ A;  3KYI A;  4ULW A;  3ZSU A;  3FAP B;  3DXJ F;  5CI8 A;  3GEH A;  1TFK B;  3JZ0 A;  5BQI A;  1NU9 C;  1ZYR F;  1JOG A;  1CPQ A;  4CS8 A;  5HV9 A;  2DYS C;  2W4B A;  1D0Z A;  1LS4 A;  1MND A;  2HV6 A;  3EH1 A;  3M4C A;  3WG7 C;  2AP3 A;  2L7A A;  4EUK B;  2Z15 A;  3E9V A;  2J9V A;  2R03 A;  3U9M A;  3N2Z B;  4U9D A;  1O3U A;  4EBB A;  2XSE A;  2R02 A;  3EG9 A;  3QTH A;  3LLI A;  4G78 A;  4N6C A;  3US6 A;  5K0I A;  1CGO A;  2OKU A;  1WGW A;  2J45 A;  3DE8 A;  3HNK A;  3JT1 A;  3K66 A;  3O10 A;  4O7G A;  4BJ5 A;  5DQT A;  3QZC A;  3JYY A;  5KYX B;  2GA0 A;  1CGM E;  1PD0 A;  2JPU A;  3QW1 A;  1KU2 A;  1GM5 A;  3QMK A;  1TWH A;  5DS6 A;  1H6G A;  4ZLD A;  2Y3D A;  3RH3 A;  4FES A;  3GOD A;  1OCO C;  3K33 A;  2XM0 A;  4W8K A;  1WAT A;  2YZS A;  3HTK C;  3PCV A;  3UGP A;  1NLX A;  4PFO A;  2Y3G A;  1N1C A;  3Q6M A;  3K6B A;  4YL0 A;  3F47 A;  1HMD A;  2QY9 A;  4U5D E;  1RJ9 A;  3HKK A;  4JCH A;  3EGX B;  4PFP A;  4JCZ A;  3RIP A;  2NUT A;  3DJU B;  4JW1 A;  5F5H A;  2YRF A;  2NUP B;  3O55 A;  3W4Y A;  2AWC A;  2EPK X;  2J46 A;  1MMD A;  4HFK B;  4JC7 A;  2PX0 A;  3M4B A;  4I3M A;  5KYW A;  1TWC A;  4NY3 A;  2GFH A;  4DBR A;  3AQC A;  3AG1 C;  1VYK A;  2A6E F;  2QE9 A;  4HFF B;  3GEE A;  2P7V A;  3FOP A;  3SXK A;  1YYJ A;  4OD4 A;  4N4W A;  2EIL C;  4KC9 A;  3UMK A;  2YHS A;  4CIH A;  2KNH A;  3FHD A;  2JX0 A;  1WTY A;  2XLW A;  3M79 A;  1D1C A;  3NMK A;  2R7S A;  2IBF A;  3ABL C;  2EPN A;  3AJM A;  3JYH A;  1OQC A;  3L8I A;  3S28 A;  3F46 A;  1Q0M A;  4U5F E;  3TQO A;  1BR2 A;  4U5C E;  3MFN A;  5L0F A;  1G8X A;  2ETS A;  3VF0 A;  2J9B A;  4C3D A;  5DQZ A;  4DRI B;  4MTG A;  4FAP B;  1HW1 A;  3V5Z A;  1L7C A;  2IOQ A;  3A9C A;  4XEF A;  1VLT A;  4D4N A;  3L8J A;  4DRJ B;  2W45 A;  3JSZ A;  3L0I A;  3EZH A;  2QNL A;  3T6J A;  3IQ5 A;  2YLG A;  3LS0 A;  3Q6N A;  5F28 E;  3W2W A;  4CDA A;  4MTO A;  1H7I A;  3TD7 A;  3JCU Q;  1WWP A;  1Y6D A;  4YT8 A;  5KYY A;  3SYN A;  3LUT B;  4Q5S F;  3ATP A;  2YQY A;  3G4X A;  4D4X A;  1SMY F;  4NTA A;  1FMV A;  1E85 A;  2GAQ A;  3A11 A;  1JPJ A;  1BDJ B;  3B0U X;  2OU6 A;  1FNT c;  3HNJ A;  4IWB A;  2A0U A;  1OCC C;  4NC3 A;  2TMV P;  1MMA A;  3M1C B;  1F1M A;  5CIV A;  3DM9 B;  5E3A A;  3N24 A;  5E33 A;  3S29 A;  2OOC A;  3ZDL A;  5L0D A;  1VYI A;  5D92 A;  2L9J A;  1V54 C;  2XLV A;  2XL6 A;  1YJG A;  4CBE A;  2GWW A;  4RBN A;  3TUL A;  4QI2 A;  1BBH A;  2VCC A;  1AVO B;  2X0C A;  4G7O F;  4AL0 A;  4W8P A;  1FFT C;  1SR2 A;  1ZHY A;  3FOO A;  3RQE A;  4EBK A;  4EIY A;  1FFH A;  2XLO A;  2OCC C;  3ASN C;  3FAJ A;  5JT4 A;  4GYT A;  5DVW A;  2Q9A A;  3I5P A;  3K7D A;  4JTD B;  1OR3 A;  1YA9 A;  3LEV A;  4XQ1 A;  1ZHW A;  2HSQ A;  2ZD9 A;  2DYR C;  5L0I A;  1I4Y A;  3EHM A;  5JP7 A;  2WVO A;  2PF4 E;  4DJ9 A;  3U2L A;  3HJC A;  1W2W A;  1CGN A;  2XRH A;  3EZI A;  2G3K A;  3ASO C;  2XLE A;  3GWL A;  4NCQ A;  5JSL A;  4MVU A;  2L81 A;  1HY5 A;  1SF8 A;  3C63 A;  3S27 A;  1RXQ A;  4JVS A;  4R32 A;  3DZA A;  2ZXR A;  5A69 A;  3RQF A;  3O39 A;  3U9J A;  5IY5 C;  3VAY A;  3DD7 A;  3U0C A;  4CSA C;  1JMW A;  4CJG A;  2Y69 C;  5COM A;  3ECS A;  2H7B A;  2LFF A;  4U5B E;  4BEJ A;  3LNM B;  1M2V A;  2EPO A;  5A6A A;  4NQF A;  3C62 A;  2R7V A;  1OKK A;  1OW7 A;  3POV A;  1HW2 A;  2NSG A;  3EPV A;  3ZTM A;  3RFY A;  1RJ9 B;  4HE8 D;  4C7O B;  3B29 A;  2L6H A;  3SNH A;  2XXA A;  1XZQ A;  5KYU A;  2LIG A;  2DI3 A;  3RW0 A;  4MVR A;  4JUR I;  2QUP A;  1T9K A;  3C8G B;  5KYW B;  3ZG1 A;  1JR8 A;  1OR2 A;  2VB6 A;  2OEX A;  4PAC A;  3SXY A;  5A6J A;  2IXP A;  3B0P A;  3AG4 C;  1A41 A;  3X1O A;  4DVY P;  4ZLC A;  1T5O A;  1PCX A;  1I5N A;  4PJJ A;  4YL3 A;  3ABK C;  3BEH A;  3DI5 A;  2R7U A;  3K1I C;  2XLH A;  1IW7 F;  2CCY A;  4O6N A;  1TQG A;  5B1A C;  2R7O A;  1JAF A;  2Y3B A;  3HNL A;  2WB7 A;  2HMZ A;  3GAN A;  3NKD A;  1UG7 A;  1ZU4 A;  3LES A;  3MBG A;  4BJ6 C;  4AE4 A;  4G7H F;  4CSA A;  3B9Q A;  1U6H A;  5A6B A;  4N06 A;  4Q7C A;  4GEH A;  2FGY A;  1EI7 A;  1V4A A;  2CNW A;  3TOL A;  1T6Q A;  2ZXO A;  1I4Z A;  1OW8 A;  2VC9 A;  3GWN A;  3LNR A;  5JS5 A;  2OG2 A;  4BPM A;  4E7S A;  3SXM A;  4UDV A;  4A2N B;  1D1B A;  1RKC A;  1AEP A;  1A7D A;  1NG1 A;  4MVQ A;  1E84 A;  1BR1 A;  2KJG A;  1NSG B;  1G4U S;  1LVK A;  4JE9 A;  2BE5 F;  2IXO A;  1QSP A;  4IGG A;  4PR9 A;  1YZC A;  1MNE A;  1Z5Z A;  1ZW3 A;  3K1H A;  1J8Y F;  4MQ9 F;  3Q7L A;  1JPN A;  1YZA A;  2HV7 A;  3V7O A;  3ZQV A;  1NU7 D;  1MMN A;  1YDI A;  1FTS A;  2YEV A;  3EFO B;  3PMR A;  4X0R A;  3UGO A;  2YLD A;  3FVY A;  3IPM O;  1FMW A;  1QPU A;  1D0X A;  1GQA A;  2B0J A;  4E0H A;  4ER9 A;  1EKY A;  1Q0D A;  2KC3 A;  4XEV A;  4CIP A;  3JSE O;  3TOM A;  2Q9C A;  4WGZ A;  2VCB A;  2EIM C;  3L34 A;  3CAX A;  4BJT A;  1ZVZ A;  3U8V A;  2UUH A;  1WOL A;  5B3I A;  4EKW A;  2BL2 A;  3EQL F;  3U3B A;  3PHF 2;  4OIO F;  3W8H A;  3G50 A;  2J0X A;  4CS9 C;  2X51 A;  4BJ6 A;  2G62 A;  4MW8 A;  4ONS A;  3O6X A;  2DGJ A;  2KGO A;  4J7Y A;  4KBL A;  5EGY A;  4K0D A;  5FCL A;  4C3B A;  4XTK A;  4OIN F;  2UUI A;  1ZHX A;  256B A;  5JRA A;  4U9E A;  3W2V A;  2LP4 A;  1AUE A;  4P6I C;  3GM2 A;  1C03 A;  2PFD A;  3LAY A;  3TJ5 A;  1BZ4 A;  1YVI A;  2NG1 A;  2ZXW C;  2CW0 F;  2XL8 A;  5B1B C;  2EIN C;  3TJ6 A;  4CX9 A;  5KYX A;  2XLM A;  2J7P A;  2YVK A;  4C3E A;  3IHU A;  4RD9 A;  5KYN A;  2WVN A;  4O6Y A;  2A68 F;  4WAB A;  2G3V A;  4QDL A;  3B0V C;  4IAO A;  2CGE A;  1Q0G A;  2ICW G;  2WVQ A;  3SZR A;  2HSB A;  1V74 B;  4Z9I A;  2Y3H A;  4N6H A;  4EWC A;  4LDR A;  1VB5 A;  3EGD A;  3KPH A;  4JZA A;  4WGY A;  3ZIB A;  3R2P A;  2WZL A;  4U5E E;  1RMV A;  4DBQ A;  2IYL D;  3C8G D;  1S7Z A;  1FR0 A;  3ABM C;  5BQG A;  1Z63 A;  3QVY A;  4I1M A;  1Q0K A;  4H54 A;  2LK4 A;  4G0H A;  3UNG C;  4FX5 A;  1RKE A;  3OA1 A;  1YLM A;  2NUP A;  1Y4C A;  1L3P A;  1OCR C;  2ZPA A;  4OIQ F;  2HKV A;  3CSK A;  2PBE A;  5EK0 A;  5FZT A;  4CJO A;  4DRH B;  2R7W A;  3OEO A;  5DLJ A;  2O9X A;  3T4R A;  2OJE D;  2YL1 A;  2Q9B A;  1E86 A;  3BRJ A;  1T6U A;  2W9Y A;  3NDB B;  5F5F A;  4XPX A;  2YL0 A;  2P6V A;  3NYL A;  3HLZ A;  3I4U A;  3S0X A;  2H7V C;  3EG9 B;  4JJG A;  5T1D B;  3VM6 A;  3RVZ A;  3RVY A;  4NTB A;  1SYQ A;  2M4E A;  4XEK A;  3SXZ A;  1QQ3 A;  3QW0 A;  3ZWI A;  4YT2 A;  5GPG B;  4Q4Z F;  3C7J A;  4E18 A;  3V5Y A;  5BUO A;  3H2U A;  2LFD A;  5L0J A;  2PP4 A;  3J06 A;  3LJB A;  1OCZ C;  2FAP B;  2V26 A;  2J8W A;  4BG0 A;  1ORJ A;  4NTF A;  2CDQ A;  2R7R A;  1G4W R;  4KNV A;  3ITF A;  4AE4 B;  1K40 A;  2L6F A;  3CQZ A;  1MQV A;  4MVZ A;  4IAR A;  1DOV A;  4GQH A;  1QVX A;  4JEA A;  1KTM A;  5AC5 A;  3GM1 A;  1T6I A;  3S90 A;  2HZ8 A;  1QZX A;  4LAC B;  4MVS A;  4YK5 A;  3DWW A;  1VTM P;  4O79 A;  1C17 M;  1E2X A;  4MVM A;  4XLP F;  3FXH A;  2EIK C;  1B68 A;  5L0C A;  2NUT B;  3LEO A;  1K05 A;  2Q00 A;  2HS5 A;  3GOR A;  2P0N A;  3W8I A;  5A6K A;  2HFI A;  1T01 A;  2NSF A;  4E7Z A;  1GGQ A;  2GDC A;  4JKV A;  3R7C A;  4Z9J A;  1M56 C;  4OIP F;  2R7T A;  1LI7 A;  3EJN A;  3RKO F;  2R05 A;  1NZE A;  1VLS A;  4LER A;  2KYH A;  2EPM X;  2YLI A;  1FAP B;  3DE9 A;  3V5X A;  3WHN A;  4DVZ A;  3DM5 A;  4A4A A;  4F4B A;  2AU5 A;  1QLE C;  2L6G A;  2YKZ A;  4JTA B;  4MS2 A;  2XL4 A;  1APC A;  3IEE A;  2H8A A;  3L1M A;  4IRU A;  3C18 A;  5D91 A;  2VAS A;  3VYW A;  2JD3 A;  3GM3 A;  3NG1 A;  3AG2 C;  1D1A A;  3OWT A;  4U5H A;  4OIR F;  3H65 A;  1ZU5 A;  2Q4F A;  3JRM O;  3EHN A;  3KH2 A;  3SEO A;  4CDY A;  2A69 F;  1E83 A;  1VK5 A;  1O87 A;  3QVZ A;  2I15 A;  1LPE A;  3ZQY A;  4QI0 A;  2BC5 A;  1DOW A;  4O6M A;  4ULV A;  2J0W A;  3U5S A;  2XM4 A;  4MW3 A;  3AQB A;  4FWV A;  3CZ6 A;  2J9W A;  1U0B B;  3UR3 C;  1ORY A;  1OXK A;  3T6G B;  3S84 A;  1M2O A;  3IQT A;  1LKX A;  1YAR O;  2AVK A;  2FFH A;  4JIO A;  5T3W A;  2HJM A;  3AOU A;  4J7T A;  3ZTZ A;  2PNO A;  2QLA A;  2OQM A;  1OKK D;  3WAQ A;  2P1A A;  3G4Z A;  1ORS C;  2CYD A;  1LI5 A;  4PJN A;  3H2V A;  1CPR A;  2M64 A;  5KYY B;  3M15 A;  3MX3 A;  1XZP A;  1ZZP A;  4I1O B;  1NFO A;  4G7Z F;  1LIH A;  4XPY A;  4HEA J;  4DOZ A;  4BEM J;  2J9U A;  3AG3 C;  4IJJ A;  4L6R A;  3KL4 A;  3EGD B;  4AX2 A;  4AK9 A;  3U8P A;  1A0B A;  4XPW A;  4BJ1 A;  5JVE A;  2HMQ A;  3RF3 A;  2YWA A;  1C02 A;  3K1I A;  2C03 A;  3NYM A;  5L0G A;  1PV3 A;  3JRT A;  1J8M F;  5EHH A;  1HE9 A;  5T3T A;  3UMI A;  1H9T A;  2OEV A;  4C7O A;  5JLI A;  1Z6A A;  1RKE B;  2B0H A;  3N0T A;  4MTF A;  2YL3 A;  5E2Q A;  3B71 A;  5HSW A;  1LM3 B;  3LLK A;  2W4M A;  3C8G A;  2YL7 A;  1LE2 A;  2LD6 A;  3IQ6 A;  5L3Q A;  2NPU A;  1D0Y A;  1M57 C;  4K7B A;  1R4T A;  3TK0 A;  2KSF A;  2WL8 A;  4LDQ A;  2QTV A;  4EHP A;  5A6B D;  1ZHZ A;  2LCH A;  1OW6 A;  2CNW D;  3JTL O;  1EA8 A;  1QKR A;  4J32 B;  4LLE A;  1O5H A;  4OD5 A;  2Q7R A;  3SP1 A;  1NBB A;  4PK4 A;  3UMH A;  4PJL A;  4YJW A;  1A7E A;  2VH3 A;  3NYJ A;  2IXM A;  4M63 A;  2E87 A;  4JJF A;  3DMD A;  2ASR A;  2F22 A;  2XLD A;  3RYL A;  3VRC A;  3X2Q C;  1Z7Q c;  1TWG A;  4XLN F;  2KK1 A;  4CS9 A;  1M2V B;  3EGX A;  4B6I A;  2I8B A;  4I44 A;  5CI9 A;  1YA7 O;  1R5I D;  2MYS A;  3Q7G A;  2WZF A;  1U89 A;  2EPL X;  3NMJ A;  5AGF A;  3NKE A;  3I5Q A;  5L0H A;  2R9R B;  3T6B A;  2D5R B;  1A7V A;  4WJ0 A;  3EH2 A;  5COG A;  3S9O A;  2XXA B;  2KW3 C;  3EFO A;  5KYU B;  4E0I A;  3AGU A;  3KKB A;  5B3S C;  1HMO A;  1JRA A;  1LE4 A;  3KMI A;  3IQC A;  1YAU O;  3LS1 A;  5JUA A;  1TWA A;  3C8Z A;  1Q0F A;  1HE1 A;  2LQG A;  4CDV A;  4MND A;  2IM8 A;  1GS9 A;  2LSE A;  4KNW A;  1PD1 A;  3MYF A;  3E70 C;  4YT5 A;  4J30 B;  2V3C C;  3CEX A;  1EQ1 A;  5DS5 A;  1ST6 A;  1NFN A;  3AGT A;  4H4K C;  1VMA A;  1MMG A;  4P9T A;  1IZM A;  1V55 C;  2RSE B;  2R7Q A;  4K1O A;  3PDM P;  3ZC4 A;  3WOD F;  2PX3 A;  4CS7 A;  1ZW2 A;  3U3F A;  5BQH A;  3FMS A;  2P61 A;  2R25 A;  3NRH A;  2HUJ A;  4AL1 A;  4JTC B;  2J7P D;  4PJM A;  5COF A;  3RQG A;  4XWJ A;  4P9F A;  1TR2 A;  5L3V A;  2AWY A;  5TJ5 E;  4IB4 A;  3HNI A;  2HJ3 A;  4YL1 A;  4CS8 C;  1BR4 A;  4YWQ A; 
#chains in the Genus database with same CATH homology
 4YK5 A;  2Q7R A;  3DWW A;  4WAB A;  5BQI A;  3PCV A;  2UUH A;  3B29 A;  5HV9 A;  4NTA A;  3LEO A;  4YL0 A;  4NTB A;  4BPM A;  3HKK A;  4J7Y A;  4JRZ A;  4JCZ A;  5K0I A;  5BQG A;  2UUI A;  4JC7 A;  4J7T A;  5BQH A;  4NTF A;  2PNO A;  4AL0 A;  4AL1 A;  4YL3 A;  2H8A A;  4YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...